1YUXA

Mixed valant state of nigerythrin
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
202
structure length
200
Chain Sequence
MKVRAQVPTVKNATNFNMVADSKTSVGSTLENLKAAIAGETGAHAKYTAFAKAAREQGYEQIARLFEATAAAELIHIGLEYALVAEMEPGYEKPTVPSAYSCDLNLISGANGEIYETSDMYPAFIRKAQEEGNSKAVHVFTRAKLAESVHAERYLAAYNDIDAPDDDKFHLCPICGYIHKGEDFEKCPICFRPKDTFTAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Nigerythrin
publication title High-resolution crystal structures of Desulfovibrio vulgaris (Hildenborough) nigerythrin: facile, redox-dependent iron movement, domain interface variability, and peroxidase activity in the rubrerythrins.
pubmed doi rcsb
source organism Desulfovibrio vulgaris subsp. vulgaris
total genus 71
structure length 200
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02915 Rubrerythrin Rubrerythrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1yuxA01
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1yuxA02
1B71A 3KYYA 5D8OA 5HJFA 5K53A 1LKPA 4KVQA 1VEIA 1RCIA 2WLUA 2Z90A 1TJOA 2ZA6A 4IWJA 5FFEA 1TK6A 1YK4A 1JIGA 4DYXA 2V2NA 2CN6A 7RXNA 4EVCA 3BKNA 3E6SA 1YV1A 5IY0A 3Q4NA 2LCQA 3SIDA 1BCFA 4TOEA 2BK6A 1N1QA 2ZG9X 3R2SA 3GE4A 1RWDA 5D8RA 3NOZX 1Z4AA 2C2FA 2V15A 5E1UA 2Z5RA 3PW1B 3KA8A 2MS3A 4OYNA 4Y08A 5JKMA 2QF9A 1BG7A 2XJNA 3PVYB 4RC5A 4DASA 3WVUA 5CMRA 3R2LA 1O9RA 2OH3A 2VZBA 2FL0A 5LG8A 4AR6A 4DZ0A 2UX1A 2CLBA 4R42A 2GYQA 4LPNA 3RAVA 2PYAA 5IX6A 1KRQA 1S30A 3PZAA 1BQ8A 5FFDA 1BQ9A 2YW7A 2CN7A 4AR5A 3IQ1A 1B13A 2V2LA 1FHHA 5JKLA 4ISMA 2GMGA 4LQHA 5D8XA 1R0FA 3F33A 1RYTA 2YW6A 1SQ3A 3OGHA 4CVPA 2XJOA 3RGDA 2CHPA 4CY9A 4M33A 4POFA 1JREA 3SS2A 3WVVA 4XKSA 4REUA 5LG2A 2V2JA 4RC5B 1FHAA 3A9QA 1JTSA 2BW1A 3F36A 5RXNA 2XJMA 1NNQA 4LQVA 3UOIA 4AM4A 2FHAA 3VNXA 4ZLWA 1R0IA 2V2SA 1UVHA 2YJJA 3FSEA 1UMNA 1BE7A 1LKOA 2PVEA 4TO9A 4ZL5A 2WTLA 4PG1A 3TA8A 2FG4A 2ZG8X 3A44A 4ITWA 2CLUA 5CZUA 5GU3X 4RC6A 1LKMA 3BT5A 3PWFA 5J8WA 4MUDA 2GS4A 4XKUA 4MN9A 3E1NA 1IROA 4CMYV 4TOFA 2C2JA 2Y3QA 2VXXA 3F39A 4TOGA 1YK5A 2V2MA 2V3BB 4Z3BA 4ZKXA 3PVTA 5JKMG 1DVBA 2WLAA 1S24A 3GHQA 1ZS3A 1DX8A 3NP2X 4TOHA 3R2RA 1B2OA 4K9FA 3QVDA 4LQNA 1F33A 2KKDA 1S2ZA 4QUWA 2RBDA 3KWOA 5FFBA 4RC6B 3QHBA 1CAAA 3RE7A 2FG8A 2Z6MA 3BVEA 4CVTA 5HJHA 2BJYA 2PYBA 1YUZA 3QHCA 5JKLG 4CVRA 2ZA7A 3WNWA 4PGIA 1S3QA 1JGCA 3NP0X 3ES3A 4TOBA 3E1MA 1NFVA 5FEJA 5D8PA 1VJXA 2CHIA 2ZG7X 1RDVA 4RXNA 3BVKA 3PVTB 1R0GA 3R2MA 1QYBA 2FJCA 5AI3A 2IY4A 4CVSA 3BVFA 4ETRA 4P18A 3AJPA 1DATA 3AK8A 3RYGA 3UOFA 2C2UA 4MY7A 4POGA 3ISEA 1OTKA 2IB0A 2XKQA 4YKHA 1LTLA 1BFYA 3E2CA 5J8SA 5GOUA 1FHMA 4ME3A 2ZA8A 4ERUA 3AF8X 2Z5QA 3FI6A 4PGKA 3HIUA 4DI0A 2C41A 6RXNA 3SE1A 3QB9A 1JKVA 2BKCA 1ZRPA 3A68A 4XGSA 2K2DA 2FKZA 3KXUA 2V2RA 1Z6OM 1TKPA 4ZMCA 3KYXA 4PG0A 4TOAA 4ZJKA 3ISFA 1J30A 1MOJA 2CEIA 5GU2X 1JI5A 3RZTA 3UNOA 1O9IA 5D8YA 1RCEA 1BRFA 3EZ0A 2V2OA 4M32A 3BVLA 3RBCA 5E2DA 1L8HA 3RD0A 2Z5PA 3R2OA 4ZTTA 1T9QA 4LYXA 3EZUA 4EVEA 1RCGA 4XKTA 1ZUJA 2YJKA 1DPSA 3QD8A 3U90A 4ISPA 3Q4OA 4U3GA 4AR4A 5J93A 3KX9A 1XZ3A 1IERA 4TW3A 4E6KA 1CADA 5GU1X 1SMMA 2X170 1R0HA 1JKUA 2D5KA 4EVDA 3KYWA 1RCDA 2PVXA 3HL1A 1R0JA 3E1OA 4MJYA 2VL6A 4LYUA 2KN9A 4MKUA 4A25A 3F32A 1H7VA 2QL0A 4M34A 3GVYA 2G4HA 1HRSA 2M4YA 3FVBA 5D8SA 3PVRA 4YWMA 2V2IA 3AJQA 3E1LA 4LPJA 5AI2A 3F38A 3O7SA 1TKOA 5I4JA 4CMYA 5C6FA 3IS7A 3KA4A 4TPUA 4ZL6A 1YUXA 3E1PA 5ERJA 2VXIA 5D8QA 4AM2A 4ML5A 2CF7A 4RC7A 3PWQC 4ZKHA 3KA6A 3EGMA 5FFCA 1JI4A 1XZ1A 4M35A 3MPSA 1Z6OA 4DYUA 1QGHA 3F35A 1EUMA 3KYVA 2FFXJ 4II4A 1L8IA 3F34A 2C6RA 5K52A 4AR3A 2JD80 3AF7X 1JYBA 1R03A 3R2KA 2W0OA 1QCVA 3PVRB 3Q4RA 5CMQA 5ERKA 2HR5A 1VCXA 8RXNA 4KVSA 3H7GA 1LB3A 3WVWA 2HTNA 1SOFA 3O7RA 1VEQA 5GN8A 3RZ6A 3KYUA 2IU2A 3PW8A 4LPMA 4DE6A 3OJ5A 4RC7B 3SHXA 4LQJA 1BFRA 3E1QA 1NF4A 4CYBA 4ZKWA 1B2JA 2JD70 3AJOA 2QQYA 2V2PA 3E1JA 1NF6A 3E6RA 4II4B 5LS9A 1IRNA 2JD60 1IU5A 5FFAA 4CYAA 3KA3A 3PW8C 1E8JA 4AM5A 1IESA 1IU6A 5AXSA 2RDVA 5GU0X 2OC5A 2GYDA 1RB9A 5GN8B 1T9OA 4IXKA 4YWLA 4EVBA 4TODA 2DSXA 5J9VA 1MFRA 4Z5SA 3SH6A 3BVIA 1VLGA 1RCCA 4DYYA 4ITTA 1H96A 1GWGA 3F37A 1T9PA 1C09A 1F30A 1VELA 4RC8A 2ZURX 4KVRA 5HQOA 5LBHA 3ERZA 3Q4QA 1SMUA 4TOCA 2CIHA 2ITBA 5JACA 1SMWA 3PWQA 3AF9X 3IS8A 1RDGA 3PW1A 3QZ3A 4IWKA 1AEWA 3AK9A 3T9JA 4DYZA 2XGWA 3R2HA 3KA9A 3PVYA 2FZFA 2F7NA
chains in the Genus database with same CATH superfamily
5AN9H 1B71A 3KYYA 5D8OA 2JI1A 3S2HL 5HJFA 5K53A 4Y52L 1LKPA 4KVQA 1VEIA 1TWAL 1RCIA 4E6YA 2WLUA 2Z90A 1TJOA 2ZA6A 3IU3I 4X6AL 4IWJA 5FFEA 1TK6A 1OWCA 1YK4A 1JIGA 2PSMC 4DYXA 2V2NA 2CN6A 7RXNA 4EVCA 3BKNA 3S14L 3E6SA 2XJUA 1YV1A 5IY0A 3S15L 2Y0SP 3Q4NA 2LCQA 3SIDA 1BCFA 4TOEA 3GTLL 2BK6A 1N1QA 2Z3QB 2ZG9X 3R2SA 2WWXB 3GE4A 1RWDA 5D8RA 2AQCA 5GADc 3NOZX 1Z4AA 2C2FA 2V15A 2NVQL 5E1UA 2Z5RA 3PW1B 3KA8A 1TWHL 3V3KB 4OYNA 2C6AA 2MS3A 4Y08A 5JKMA 2HVYC 2QF9A 1BG7A 2XJNA 5FJ8L 3PVYB 4RC5A 4BBSL 4A3GL 3LWOB 2A6HD 3HJYB 4DASA 2Z3RB 3HKZP 3HOYL 2WAQP 2AR0A 1Y1VL 3WVUA 2AYJA 3PKJA 5CMRA 3R2LA 1O9RA 3C21A 1K83L 2OH3A 2G38B 2VZBA 2FL0A 5LG8A 4AR6A 4DZ0A 2UX1A 3MSUA 2CLBA 4R42A 2GYQA 4LPNA 3RAVA 4YVZA 1VZIA 2PYAA 5IX6A 3VVAA 4AHXA 4E40A 1KRQA 1S30A 2M6OA 4WJG4 3PZAA 1BQ8A 5FFDA 2JA7L 1BQ9A 2YW7A 2CN7A 4AR5A 4A3KL 3IQ1A 1B13A 1R9TL 2O5JD 2V2LA 1FHHA 5JKLA 4ISMA 2GMGA 4LQHA 5D8XA 1R0FA 3F33A 4A3IL 1RYTA 2YW6A 5C44L 1SQ3A 3OGHA 4CVPA 2XJOA 3S1NL 3RGDA 4Y7NL 2CHPA 4CY9A 2XJPA 4M33A 3ZG6A 4POFA 1JREA 3SS2A 3WVVA 4QIWP 4XKSA 4REUA 5LG2A 2V2JA 4RC5B 1FHAA 3A9QA 2VUML 1JTSA 2BW1A 3F36A 5RXNA 2XJMA 1NNQA 5DM71 4LQVA 4UY81 3UOIA 4AM4A 4JAGA 2FHAA 3VNXA 4ZLWA 1R0IA 2V2SA 1UVHA 2YJJA 3FSEA 1TWGL 2A6ED 1UMNA 1BE7A 3PKIA 5M5YL 2CKAA 1LKOA 2PVEA 4TO9A 4C3IL 4ZL5A 2V0FA 2Y44A 2YU9L 2WTLA 4PG1A 3TA8A 2NVYL 5FLML 2FG4A 2ZG8X 5MGNA 2C6BA 3A44A 5IYCL 4A3CL 4AYBP 4ITWA 2JI2A 2CLUA 5CZUA 2XJRA 5GU3X 4RC6A 4A3ML 1LKMA 3JZ9A 3BT5A 3PWFA 5J8WA 4MUDA 3HOZL 2GS4A 4XKUA 4ZN1B 4MN9A 3E1NA 1IROA 4CMYV 3I4ML 4TOFA 2C2JA 2Y3QA 3PL5A 2XJTA 2EY4E 2VXXA 3F39A 4TOGA 1NXGA 2V2MA 1YK5A 2V3BB 4BY1L 2M6PA 3FRSA 1PFWA 4Z3BA 3NFPI 3WWNB 4ZKXA 3KDQA 3PVTA 5JKMG 3LWQB 1DVBA 2WLAA 1I50L 1S24A 3H9CA 3GHQA 5HU6D 1ZS3A 4ZN3B 2R92L 1DX8A 2MGYA 3DBYA 1PZXA 3NP2X 4TOHA 2CKCA 3MQKB 3R2RA 1B2OA 4K9FA 2E2JL 3QVDA 4XGHA 4LQNA 1F33A 1P7PA 2KKDA 1S2ZA 4QUWA 2RBDA 3KWOA 2PPTA 4LHNA 5FFBA 4RC6B 2BE5D 3QHBA 1CAAA 3RE7A 3N6OA 2FG8A 2Z6MA 5C3EL 3BVEA 4CVTA 4AI3A 3HAXC 5HJHA 1WCML 2XJVA 3LPEB 2BJYA 2JI3A 2PYBA 3C1ZA 1YUZA 3QHCA 4YXJA 5JKLG 4CVRA 2ZA7A 3WNWA 4PGIA 1S3QA 1JGCA 3NP0X 5DM61 3ES3A 4TOBA 2ZIXA 2APOB 3E1MA 1NFVA 5FEJA 1QQTA 5D8PA 1VJXA 2CHIA 2ZG7X 1RDVA 3P8BA 4RXNA 5MFPA 4BY7L 1VZHA 3BVKA 2A69D 3PVTB 1R0GA 3HOXL 3GTML 3R2MA 2B5ID 1QYBA 3LKDA 2FJCA 4U671 2CR8A 5AI3A 5MLC3 5M5WL 2IY4A 4CVSA 3BVFA 1I3QL 3VPBE 4ETRA 4P18A 3L0MA 3AJPA 1DATA 3AK8A 2XJQA 3RYGA 3UOFA 2C2UA 3W54A 2PMZP 3D19A 4MY7A 4POGA 3ISEA 1OTKA 2IB0A 2XKQA 4YKHA 1LTLA 1BFYA 5IP7L 4JADA 3E2CA 5J8SA 2V8UA 3UFBA 4BXXL 5GOUA 1FHMA 4ME3A 2ZA8A 4ERUA 3B0AB 1PFVA 3AF8X 2Z5QA 3FI6A 4PGKA 3HIUA 4DI0A 2C41A 6RXNA 3HOVL 3H97A 3GTOL 3SE1A 2V8TA 3B08B 2WB1P 3QB9A 3PO2L 1JKVA 2BKCA 1ZRPA 3J7Y1 3A68A 1I6HL 4XGSA 2K2DA 2E2IL 2FKZA 3KXUA 2V2RA 1Z6OM 3JZAB 3PIO1 1TKPA 4ZMCA 3KYXA 4PG0A 4TOAA 5IYDL 4ZJKA 3ISFA 1J30A 1MOJA 2CEIA 3S1QL 2R93L 4AHZA 4BBRL 5GU2X 1JI5A 3RZTA 3UNOA 1O9IA 5D8YA 1VZGA 1RCEA 5GAEc 1BRFA 4A3FL 3HOUL 5EIOC 3GGYA 3EZ0A 1OWBA 5M3FL 2V2OA 4M32A 3BVLA 3RBCA 5E2DA 1NXEA 3S1ML 5GAHc 2NYDA 1Y1WL 1TWFL 1L8HA 3RD0A 2Z5PA 2JA5L 2ERSA 3R2OA 4ZTTA 1T9QA 4JAEA 4LYXA 3H9BA 3EZUA 4EVEA 1RCGA 4XKTA 1ZUJA 2YJKA 1DPSA 4A3EL 3QD8A 3U90A 4ISPA 3Q4OA 4U3GA 1TWCL 4AR4A 4C2M1 2V0EA 5J93A 4G6BA 3KX9A 4KXRB 4WFN1 3GTPL 1XZ3A 5MF6A 1IERA 3S1RL 5M5XL 4TW3A 4E6KA 2ERJA 1CADA 5GU1X 1SMMA 2X170 1PFYA 3JR7A 1R0HA 1JKUA 2D5KA 4EVDA 1ODHA 3KYWA 1RCDA 2PVXA 3HL1A 1R0JA 3E1OA 1Z92B 4MJYA 5C4XL 1IW7D 2VL6A 3WWLA 4W4LB 4LYUA 2KN9A 4MKUA 4A25A 3P2AA 3F32A 1H7VA 2QL0A 4M34A 3LWVB 4XXBB 3RZOL 3GVYA 2G4HA 1HRSA 2M4YA 3FVBA 1RYQA 5D8SA 3PVRA 3CQZL 2XJSA 4YWMA 2V2IA 3AJQA 5MFZA 3E1LA 4LPJA 5AI2A 4A93L 3F38A 3GTGL 3O7SA 1TKOA 5I4JA 4AI2A 4CMYA 5C6FA 3IS7A 3PIP1 3KA4A 4TPUA 4ZL6A 1YUXA 3E1PA 5GAGc 5ERJA 2VXIA 5D8QA 4AM2A 4ML5A 3M4OL 2CF7A 4RC7A 3QQCE 3PWQC 4ZKHA 2CWLA 4TVMA 3LNLA 5JVG1 2E2HL 2A68D 2J9UB 2AUSB 3KA6A 3EGMA 3M3YL 5FFCA 1JI4A 1XZ1A 3KHKA 4GS7D 4B8CD 4M35A 3MPSA 1Z6OA 4DYUA 1QGHA 3F35A 4LHLA 3GTKL 1EUMA 3KYVA 3H3VM 2FFXJ 4II4A 1L8IA 3F34A 2C6RA 5K52A 3GGZA 3S16L 5H1Sc 3J7Z1 5JVH1 2M4VA 4AR3A 1SFOL 2JA8L 2JD80 3AF7X 1JYBA 2NVXL 1R03A 3R2KA 2W0OA 1QCVA 3PVRB 3Q4RA 5CMQA 5ERKA 2HR5A 4C3JL 1VCXA 3H99A 8RXNA 4KVSA 1PFUA 3HOWL 3H7GA 1LB3A 3WVWA 2HTNA 3S2DL 1SOFA 3O7RA 1VEQA 5GN8A 3RZ6A 3KYUA 2N02A 2IU2A 3PW8A 4MXPA 4LPMA 3FRRA 3VV9A 4DE6A 3OJ5A 4RC7B 3SHXA 4LQJA 1BFRA 3FDJA 3E1QA 1NF4A 4CYBA 4ZKWA 1B2JA 5EINC 2JD70 3AJOA 4A3JL 2QQYA 5JDOA 2H12A 3C23A 3FKIL 2V2PA 3E1JA 1NF6A 3E6RA 5M3ML 4II4B 3LWRB 5LS9A 4A3DL 1IRNA 2JD60 1IU5A 4C3HL 5FFAA 4W4KB 4CYAA 3S17L 3KA3A 3PW8C 1E8JA 4AM5A 1IESA 1WJVA 3HJWB 1IU6A 3M6JA 5AXSA 1F4LA 4AI1A 3K7AL 2RDVA 5GU0X 2OC5A 3PO3L 2GYDA 4V196 1RB9A 5GN8B 1T9OA 4A3BL 4IXKA 5IP9L 4YWLA 4EVBA 3GTQL 4TODA 2DSXA 5J9VA 1MFRA 4Z5SA 2NVTL 2R7ZL 3SH6A 3BVIA 1VLGA 2L0ZA 1RCCA 4YXMA 4DYYA 4ITTA 1H96A 2JA6L 1GWGA 3F37A 1T9PA 4AI0A 5JDOB 3H0GL 5C4JL 3GTJL 1C09A 1F30A 3I4NL 1VELA 5K2ME 4RC8A 4X0JA 3K35A 2ZURX 4KVRA 5HQOA 5LBHA 3ERZA 3Q4QA 1SMUA 4TOCA 2CIHA 3LWPB 2ITBA 3C1YA 5JACA 4JAFA 1SMWA 4AHYA 3PWQA 3AF9X 3IS8A 1RDGA 5IYBL 3PW1A 3RZDL 3QZ3A 4IWKA 4AHWA 1AEWA 2OKCA 2RFKB 3AK9A 3T9JA 4DYZA 2B63L 2XGWA 3R2HA 3KA9A 3PVYA 2FZFA 4A3LL 2F7NA
chains in the Genus database with same CATH topology
5AN9H 1B71A 3KYYA 5D8OA 2JI1A 5HJFA 5K53A 1LKPA 4KVQA 1VEIA 1RCIA 4E6YA 2WLUA 2Z90A 1TJOA 2ZA6A 3IU3I 4IWJA 5FFEA 1TK6A 1OWCA 1YK4A 1JIGA 2PSMC 4DYXA 2V2NA 2CN6A 7RXNA 4EVCA 3BKNA 3E6SA 2XJUA 1YV1A 5IY0A 3Q4NA 2LCQA 3SIDA 1BCFA 4TOEA 2BK6A 1N1QA 2Z3QB 2ZG9X 3R2SA 2WWXB 3GE4A 1RWDA 5D8RA 5GADc 3NOZX 1Z4AA 2C2FA 2V15A 5E1UA 2Z5RA 3PW1B 3KA8A 2C6AA 3V3KB 4OYNA 2MS3A 4Y08A 5JKMA 2QF9A 1BG7A 2XJNA 3PVYB 4RC5A 2A6HD 4DASA 2Z3RB 2AR0A 3WVUA 2AYJA 3PKJA 5CMRA 3R2LA 1O9RA 3C21A 2OH3A 2G38B 2VZBA 2FL0A 5LG8A 4AR6A 4DZ0A 2UX1A 3MSUA 2CLBA 4R42A 2GYQA 4LPNA 3RAVA 4YVZA 1VZIA 2PYAA 5IX6A 3VVAA 4AHXA 4E40A 1KRQA 1S30A 2M6OA 4WJG4 3PZAA 1BQ8A 5FFDA 1BQ9A 2YW7A 2CN7A 4AR5A 3IQ1A 1B13A 2O5JD 2V2LA 1FHHA 5JKLA 4ISMA 2GMGA 4LQHA 5D8XA 1R0FA 3F33A 1RYTA 2YW6A 1SQ3A 3OGHA 4CVPA 2XJOA 3RGDA 2CHPA 4CY9A 2XJPA 4M33A 3ZG6A 4POFA 1JREA 3SS2A 3WVVA 4XKSA 4REUA 5LG2A 2V2JA 4RC5B 1FHAA 3A9QA 1JTSA 2BW1A 3F36A 5RXNA 2XJMA 1NNQA 5DM71 4LQVA 4UY81 3UOIA 4AM4A 4JAGA 2FHAA 3VNXA 4ZLWA 1R0IA 2V2SA 1UVHA 2YJJA 3FSEA 2A6ED 3PKIA 1UMNA 1BE7A 2CKAA 1LKOA 2PVEA 4TO9A 4ZL5A 2V0FA 2Y44A 2WTLA 4PG1A 3TA8A 2FG4A 2ZG8X 5MGNA 2C6BA 3A44A 4ITWA 2JI2A 2CLUA 5CZUA 2XJRA 5GU3X 4RC6A 1LKMA 3JZ9A 3BT5A 3PWFA 5J8WA 4MUDA 2GS4A 4XKUA 4ZN1B 4MN9A 3E1NA 1IROA 4CMYV 4TOFA 2C2JA 2Y3QA 2XJTA 2VXXA 3F39A 4TOGA 1NXGA 2V2MA 1YK5A 2V3BB 2M6PA 3FRSA 4Z3BA 3NFPI 3WWNB 4ZKXA 3KDQA 3PVTA 5JKMG 1DVBA 2WLAA 1S24A 3GHQA 5HU6D 1ZS3A 4ZN3B 1DX8A 2MGYA 3DBYA 3NP2X 4TOHA 2CKCA 3R2RA 1B2OA 4K9FA 3QVDA 4XGHA 4LQNA 1F33A 2KKDA 1S2ZA 4QUWA 2RBDA 3KWOA 2PPTA 4LHNA 5FFBA 4RC6B 2BE5D 3QHBA 1CAAA 3RE7A 3N6OA 2FG8A 2Z6MA 3BVEA 4CVTA 4AI3A 5HJHA 2XJVA 3LPEB 2BJYA 2JI3A 2PYBA 3C1ZA 1YUZA 3QHCA 4YXJA 5JKLG 4CVRA 2ZA7A 3WNWA 4PGIA 1S3QA 1JGCA 3NP0X 5DM61 3ES3A 4TOBA 2ZIXA 3E1MA 1NFVA 5FEJA 3P8BA 5D8PA 1VJXA 2CHIA 2ZG7X 1RDVA 4RXNA 5MFPA 1VZHA 3BVKA 2A69D 3PVTB 1R0GA 3R2MA 2B5ID 1QYBA 3LKDA 2FJCA 4U671 2CR8A 5AI3A 5MLC3 2IY4A 4CVSA 3BVFA 3VPBE 4ETRA 4P18A 3L0MA 3AJPA 1DATA 3AK8A 2XJQA 3RYGA 3UOFA 2C2UA 3W54A 3D19A 4MY7A 4POGA 3ISEA 1OTKA 2IB0A 2XKQA 4YKHA 1LTLA 1BFYA 4JADA 3E2CA 5J8SA 2V8UA 3UFBA 5GOUA 1FHMA 4ME3A 2ZA8A 4ERUA 3B0AB 3AF8X 2Z5QA 3FI6A 4PGKA 3HIUA 4DI0A 2C41A 6RXNA 3SE1A 2V8TA 3B08B 3QB9A 1JKVA 2BKCA 1ZRPA 3J7Y1 3A68A 4XGSA 2K2DA 2FKZA 3KXUA 2V2RA 1Z6OM 3JZAB 3PIO1 1TKPA 4ZMCA 3KYXA 4PG0A 4TOAA 4ZJKA 3ISFA 1J30A 1MOJA 2CEIA 4AHZA 5GU2X 1JI5A 3RZTA 3UNOA 1O9IA 5D8YA 1VZGA 1RCEA 5GAEc 1BRFA 5EIOC 3GGYA 3EZ0A 1OWBA 2V2OA 4M32A 3BVLA 3RBCA 5E2DA 1NXEA 5GAHc 2NYDA 1L8HA 3RD0A 2Z5PA 2ERSA 3R2OA 4ZTTA 1T9QA 4JAEA 4LYXA 3EZUA 4EVEA 1RCGA 4XKTA 1ZUJA 2YJKA 1DPSA 3QD8A 3U90A 4ISPA 3Q4OA 4U3GA 4AR4A 2V0EA 5J93A 4G6BA 3KX9A 4KXRB 4WFN1 1XZ3A 5MF6A 1IERA 4TW3A 4E6KA 2ERJA 1CADA 5GU1X 1SMMA 2X170 1R0HA 1JKUA 2D5KA 4EVDA 1ODHA 3KYWA 1RCDA 2PVXA 3HL1A 1R0JA 3E1OA 1Z92B 4MJYA 1IW7D 2VL6A 3WWLA 4W4LB 4LYUA 2KN9A 4MKUA 4A25A 3P2AA 3F32A 1H7VA 2QL0A 4M34A 4XXBB 3GVYA 2G4HA 1HRSA 2M4YA 3FVBA 1RYQA 5D8SA 3PVRA 2XJSA 4YWMA 2V2IA 3AJQA 5MFZA 3E1LA 4LPJA 5AI2A 3F38A 3O7SA 1TKOA 5I4JA 4AI2A 4CMYA 5C6FA 3IS7A 3PIP1 3KA4A 4TPUA 4ZL6A 1YUXA 3E1PA 5GAGc 5ERJA 2VXIA 5D8QA 4AM2A 4ML5A 2CF7A 4RC7A 3QQCE 3PWQC 4ZKHA 2CWLA 4TVMA 3LNLA 5JVG1 2A68D 2J9UB 3KA6A 3EGMA 5FFCA 1JI4A 1XZ1A 3KHKA 4GS7D 4B8CD 4M35A 3MPSA 1Z6OA 4DYUA 1QGHA 3F35A 4LHLA 1EUMA 3KYVA 2FFXJ 4II4A 1L8IA 3F34A 2C6RA 5K52A 3GGZA 5H1Sc 3J7Z1 5JVH1 2M4VA 4AR3A 2JD80 3AF7X 1JYBA 1R03A 3R2KA 2W0OA 1QCVA 3PVRB 3Q4RA 5CMQA 5ERKA 2HR5A 1VCXA 8RXNA 4KVSA 3H7GA 1LB3A 3WVWA 2HTNA 1SOFA 3O7RA 1VEQA 5GN8A 3RZ6A 3KYUA 2N02A 2IU2A 3PW8A 4MXPA 4LPMA 3FRRA 3VV9A 4DE6A 3OJ5A 4RC7B 3SHXA 4LQJA 1BFRA 3E1QA 1NF4A 4CYBA 4ZKWA 1B2JA 5EINC 2JD70 3AJOA 2QQYA 5JDOA 2H12A 3C23A 2V2PA 3E1JA 1NF6A 3E6RA 4II4B 5LS9A 1IRNA 2JD60 1IU5A 5FFAA 4W4KB 4CYAA 3KA3A 3PW8C 1E8JA 4AM5A 1IESA 1WJVA 1IU6A 3M6JA 5AXSA 4AI1A 2RDVA 5GU0X 2OC5A 2GYDA 4V196 1RB9A 5GN8B 1T9OA 4IXKA 4YWLA 4EVBA 4TODA 2DSXA 5J9VA 1MFRA 4Z5SA 3SH6A 3BVIA 1VLGA 2L0ZA 1RCCA 4YXMA 4DYYA 4ITTA 1H96A 1GWGA 3F37A 1T9PA 4AI0A 5JDOB 1C09A 1F30A 1VELA 5K2ME 4RC8A 4X0JA 3K35A 2ZURX 4KVRA 5HQOA 5LBHA 3ERZA 3Q4QA 1SMUA 4TOCA 2CIHA 2ITBA 3C1YA 5JACA 4JAFA 1SMWA 4AHYA 3PWQA 3AF9X 3IS8A 1RDGA 3PW1A 3QZ3A 4IWKA 4AHWA 1AEWA 2OKCA 3AK9A 3T9JA 4DYZA 2XGWA 3R2HA 3KA9A 3PVYA 2FZFA 2F7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B71 A;  3KYY A;  5D8O A;  5HJF A;  5K53 A;  1LKP A;  4KVQ A;  1VEI A;  1RCI A;  2WLU A;  2Z90 A;  1TJO A;  2ZA6 A;  4IWJ A;  5FFE A;  1TK6 A;  1YK4 A;  1JIG A;  4DYX A;  2V2N A;  2CN6 A;  7RXN A;  4EVC A;  3BKN A;  3E6S A;  1YV1 A;  5IY0 A;  3Q4N A;  2LCQ A;  3SID A;  1BCF A;  4TOE A;  2BK6 A;  1N1Q A;  2ZG9 X;  3R2S A;  3GE4 A;  1RWD A;  5D8R A;  3NOZ X;  1Z4A A;  2C2F A;  2V15 A;  5E1U A;  2Z5R A;  3PW1 B;  3KA8 A;  2MS3 A;  4OYN A;  4Y08 A;  5JKM A;  2QF9 A;  1BG7 A;  2XJN A;  3PVY B;  4RC5 A;  4DAS A;  3WVU A;  5CMR A;  3R2L A;  1O9R A;  2OH3 A;  2VZB A;  2FL0 A;  5LG8 A;  4AR6 A;  4DZ0 A;  2UX1 A;  2CLB A;  4R42 A;  2GYQ A;  4LPN A;  3RAV A;  2PYA A;  5IX6 A;  1KRQ A;  1S30 A;  3PZA A;  1BQ8 A;  5FFD A;  1BQ9 A;  2YW7 A;  2CN7 A;  4AR5 A;  3IQ1 A;  1B13 A;  2V2L A;  1FHH A;  5JKL A;  4ISM A;  2GMG A;  4LQH A;  5D8X A;  1R0F A;  3F33 A;  1RYT A;  2YW6 A;  1SQ3 A;  3OGH A;  4CVP A;  2XJO A;  3RGD A;  2CHP A;  4CY9 A;  4M33 A;  4POF A;  1JRE A;  3SS2 A;  3WVV A;  4XKS A;  4REU A;  5LG2 A;  2V2J A;  4RC5 B;  1FHA A;  3A9Q A;  1JTS A;  2BW1 A;  3F36 A;  5RXN A;  2XJM A;  1NNQ A;  4LQV A;  3UOI A;  4AM4 A;  2FHA A;  3VNX A;  4ZLW A;  1R0I A;  2V2S A;  1UVH A;  2YJJ A;  3FSE A;  1UMN A;  1BE7 A;  1LKO A;  2PVE A;  4TO9 A;  4ZL5 A;  2WTL A;  4PG1 A;  3TA8 A;  2FG4 A;  2ZG8 X;  3A44 A;  4ITW A;  2CLU A;  5CZU A;  5GU3 X;  4RC6 A;  1LKM A;  3BT5 A;  3PWF A;  5J8W A;  4MUD A;  2GS4 A;  4XKU A;  4MN9 A;  3E1N A;  1IRO A;  4CMY V;  4TOF A;  2C2J A;  2Y3Q A;  2VXX A;  3F39 A;  4TOG A;  1YK5 A;  2V2M A;  2V3B B;  4Z3B A;  4ZKX A;  3PVT A;  5JKM G;  1DVB A;  2WLA A;  1S24 A;  3GHQ A;  1ZS3 A;  1DX8 A;  3NP2 X;  4TOH A;  3R2R A;  1B2O A;  4K9F A;  3QVD A;  4LQN A;  1F33 A;  2KKD A;  1S2Z A;  4QUW A;  2RBD A;  3KWO A;  5FFB A;  4RC6 B;  3QHB A;  1CAA A;  3RE7 A;  2FG8 A;  2Z6M A;  3BVE A;  4CVT A;  5HJH A;  2BJY A;  2PYB A;  1YUZ A;  3QHC A;  5JKL G;  4CVR A;  2ZA7 A;  3WNW A;  4PGI A;  1S3Q A;  1JGC A;  3NP0 X;  3ES3 A;  4TOB A;  3E1M A;  1NFV A;  5FEJ A;  5D8P A;  1VJX A;  2CHI A;  2ZG7 X;  1RDV A;  4RXN A;  3BVK A;  3PVT B;  1R0G A;  3R2M A;  1QYB A;  2FJC A;  5AI3 A;  2IY4 A;  4CVS A;  3BVF A;  4ETR A;  4P18 A;  3AJP A;  1DAT A;  3AK8 A;  3RYG A;  3UOF A;  2C2U A;  4MY7 A;  4POG A;  3ISE A;  1OTK A;  2IB0 A;  2XKQ A;  4YKH A;  1LTL A;  1BFY A;  3E2C A;  5J8S A;  5GOU A;  1FHM A;  4ME3 A;  2ZA8 A;  4ERU A;  3AF8 X;  2Z5Q A;  3FI6 A;  4PGK A;  3HIU A;  4DI0 A;  2C41 A;  6RXN A;  3SE1 A;  3QB9 A;  1JKV A;  2BKC A;  1ZRP A;  3A68 A;  4XGS A;  2K2D A;  2FKZ A;  3KXU A;  2V2R A;  1Z6O M;  1TKP A;  4ZMC A;  3KYX A;  4PG0 A;  4TOA A;  4ZJK A;  3ISF A;  1J30 A;  1MOJ A;  2CEI A;  5GU2 X;  1JI5 A;  3RZT A;  3UNO A;  1O9I A;  5D8Y A;  1RCE A;  1BRF A;  3EZ0 A;  2V2O A;  4M32 A;  3BVL A;  3RBC A;  5E2D A;  1L8H A;  3RD0 A;  2Z5P A;  3R2O A;  4ZTT A;  1T9Q A;  4LYX A;  3EZU A;  4EVE A;  1RCG A;  4XKT A;  1ZUJ A;  2YJK A;  1DPS A;  3QD8 A;  3U90 A;  4ISP A;  3Q4O A;  4U3G A;  4AR4 A;  5J93 A;  3KX9 A;  1XZ3 A;  1IER A;  4TW3 A;  4E6K A;  1CAD A;  5GU1 X;  1SMM A;  2X17 0;  1R0H A;  1JKU A;  2D5K A;  4EVD A;  3KYW A;  1RCD A;  2PVX A;  3HL1 A;  1R0J A;  3E1O A;  4MJY A;  2VL6 A;  4LYU A;  2KN9 A;  4MKU A;  4A25 A;  3F32 A;  1H7V A;  2QL0 A;  4M34 A;  3GVY A;  2G4H A;  1HRS A;  2M4Y A;  3FVB A;  5D8S A;  3PVR A;  4YWM A;  2V2I A;  3AJQ A;  3E1L A;  4LPJ A;  5AI2 A;  3F38 A;  3O7S A;  1TKO A;  5I4J A;  4CMY A;  5C6F A;  3IS7 A;  3KA4 A;  4TPU A;  4ZL6 A;  1YUX A;  3E1P A;  5ERJ A;  2VXI A;  5D8Q A;  4AM2 A;  4ML5 A;  2CF7 A;  4RC7 A;  3PWQ C;  4ZKH A;  3KA6 A;  3EGM A;  5FFC A;  1JI4 A;  1XZ1 A;  4M35 A;  3MPS A;  1Z6O A;  4DYU A;  1QGH A;  3F35 A;  1EUM A;  3KYV A;  2FFX J;  4II4 A;  1L8I A;  3F34 A;  2C6R A;  5K52 A;  4AR3 A;  2JD8 0;  3AF7 X;  1JYB A;  1R03 A;  3R2K A;  2W0O A;  1QCV A;  3PVR B;  3Q4R A;  5CMQ A;  5ERK A;  2HR5 A;  1VCX A;  8RXN A;  4KVS A;  3H7G A;  1LB3 A;  3WVW A;  2HTN A;  1SOF A;  3O7R A;  1VEQ A;  5GN8 A;  3RZ6 A;  3KYU A;  2IU2 A;  3PW8 A;  4LPM A;  4DE6 A;  3OJ5 A;  4RC7 B;  3SHX A;  4LQJ A;  1BFR A;  3E1Q A;  1NF4 A;  4CYB A;  4ZKW A;  1B2J A;  2JD7 0;  3AJO A;  2QQY A;  2V2P A;  3E1J A;  1NF6 A;  3E6R A;  4II4 B;  5LS9 A;  1IRN A;  2JD6 0;  1IU5 A;  5FFA A;  4CYA A;  3KA3 A;  3PW8 C;  1E8J A;  4AM5 A;  1IES A;  1IU6 A;  5AXS A;  2RDV A;  5GU0 X;  2OC5 A;  2GYD A;  1RB9 A;  5GN8 B;  1T9O A;  4IXK A;  4YWL A;  4EVB A;  4TOD A;  2DSX A;  5J9V A;  1MFR A;  4Z5S A;  3SH6 A;  3BVI A;  1VLG A;  1RCC A;  4DYY A;  4ITT A;  1H96 A;  1GWG A;  3F37 A;  1T9P A;  1C09 A;  1F30 A;  1VEL A;  4RC8 A;  2ZUR X;  4KVR A;  5HQO A;  5LBH A;  3ERZ A;  3Q4Q A;  1SMU A;  4TOC A;  2CIH A;  2ITB A;  5JAC A;  1SMW A;  3PWQ A;  3AF9 X;  3IS8 A;  1RDG A;  3PW1 A;  3QZ3 A;  4IWK A;  1AEW A;  3AK9 A;  3T9J A;  4DYZ A;  2XGW A;  3R2H A;  3KA9 A;  3PVY A;  2FZF A;  2F7N A; 
#chains in the Genus database with same CATH topology
 5AN9 H;  1B71 A;  3KYY A;  5D8O A;  2JI1 A;  3S2H L;  5HJF A;  5K53 A;  4Y52 L;  1LKP A;  4KVQ A;  1VEI A;  1TWA L;  1RCI A;  4E6Y A;  2WLU A;  2Z90 A;  1TJO A;  2ZA6 A;  3IU3 I;  4X6A L;  4IWJ A;  5FFE A;  1TK6 A;  1OWC A;  1YK4 A;  1JIG A;  2PSM C;  4DYX A;  2V2N A;  2CN6 A;  7RXN A;  4EVC A;  3BKN A;  3S14 L;  3E6S A;  2XJU A;  1YV1 A;  5IY0 A;  3S15 L;  2Y0S P;  3Q4N A;  2LCQ A;  3SID A;  1BCF A;  4TOE A;  3GTL L;  2BK6 A;  1N1Q A;  2Z3Q B;  2ZG9 X;  3R2S A;  2WWX B;  3GE4 A;  1RWD A;  5D8R A;  2AQC A;  5GAD c;  3NOZ X;  1Z4A A;  2C2F A;  2V15 A;  2NVQ L;  5E1U A;  2Z5R A;  3PW1 B;  3KA8 A;  1TWH L;  3V3K B;  4OYN A;  2C6A A;  2MS3 A;  4Y08 A;  5JKM A;  2HVY C;  2QF9 A;  1BG7 A;  2XJN A;  5FJ8 L;  3PVY B;  4RC5 A;  4BBS L;  4A3G L;  3LWO B;  2A6H D;  3HJY B;  4DAS A;  2Z3R B;  3HKZ P;  3HOY L;  2WAQ P;  2AR0 A;  1Y1V L;  3WVU A;  2AYJ A;  3PKJ A;  5CMR A;  3R2L A;  1O9R A;  3C21 A;  1K83 L;  2OH3 A;  2G38 B;  2VZB A;  2FL0 A;  5LG8 A;  4AR6 A;  4DZ0 A;  2UX1 A;  3MSU A;  2CLB A;  4R42 A;  2GYQ A;  4LPN A;  3RAV A;  4YVZ A;  1VZI A;  2PYA A;  5IX6 A;  3VVA A;  4AHX A;  4E40 A;  1KRQ A;  1S30 A;  2M6O A;  4WJG 4;  3PZA A;  1BQ8 A;  5FFD A;  2JA7 L;  1BQ9 A;  2YW7 A;  2CN7 A;  4AR5 A;  4A3K L;  3IQ1 A;  1B13 A;  1R9T L;  2O5J D;  2V2L A;  1FHH A;  5JKL A;  4ISM A;  2GMG A;  4LQH A;  5D8X A;  1R0F A;  3F33 A;  4A3I L;  1RYT A;  2YW6 A;  5C44 L;  1SQ3 A;  3OGH A;  4CVP A;  2XJO A;  3S1N L;  3RGD A;  4Y7N L;  2CHP A;  4CY9 A;  2XJP A;  4M33 A;  3ZG6 A;  4POF A;  1JRE A;  3SS2 A;  3WVV A;  4QIW P;  4XKS A;  4REU A;  5LG2 A;  2V2J A;  4RC5 B;  1FHA A;  3A9Q A;  2VUM L;  1JTS A;  2BW1 A;  3F36 A;  5RXN A;  2XJM A;  1NNQ A;  5DM7 1;  4LQV A;  4UY8 1;  3UOI A;  4AM4 A;  4JAG A;  2FHA A;  3VNX A;  4ZLW A;  1R0I A;  2V2S A;  1UVH A;  2YJJ A;  3FSE A;  1TWG L;  2A6E D;  1UMN A;  1BE7 A;  3PKI A;  5M5Y L;  2CKA A;  1LKO A;  2PVE A;  4TO9 A;  4C3I L;  4ZL5 A;  2V0F A;  2Y44 A;  2YU9 L;  2WTL A;  4PG1 A;  3TA8 A;  2NVY L;  5FLM L;  2FG4 A;  2ZG8 X;  5MGN A;  2C6B A;  3A44 A;  5IYC L;  4A3C L;  4AYB P;  4ITW A;  2JI2 A;  2CLU A;  5CZU A;  2XJR A;  5GU3 X;  4RC6 A;  4A3M L;  1LKM A;  3JZ9 A;  3BT5 A;  3PWF A;  5J8W A;  4MUD A;  3HOZ L;  2GS4 A;  4XKU A;  4ZN1 B;  4MN9 A;  3E1N A;  1IRO A;  4CMY V;  3I4M L;  4TOF A;  2C2J A;  2Y3Q A;  3PL5 A;  2XJT A;  2EY4 E;  2VXX A;  3F39 A;  4TOG A;  1NXG A;  2V2M A;  1YK5 A;  2V3B B;  4BY1 L;  2M6P A;  3FRS A;  1PFW A;  4Z3B A;  3NFP I;  3WWN B;  4ZKX A;  3KDQ A;  3PVT A;  5JKM G;  3LWQ B;  1DVB A;  2WLA A;  1I50 L;  1S24 A;  3H9C A;  3GHQ A;  5HU6 D;  1ZS3 A;  4ZN3 B;  2R92 L;  1DX8 A;  2MGY A;  3DBY A;  1PZX A;  3NP2 X;  4TOH A;  2CKC A;  3MQK B;  3R2R A;  1B2O A;  4K9F A;  2E2J L;  3QVD A;  4XGH A;  4LQN A;  1F33 A;  1P7P A;  2KKD A;  1S2Z A;  4QUW A;  2RBD A;  3KWO A;  2PPT A;  4LHN A;  5FFB A;  4RC6 B;  2BE5 D;  3QHB A;  1CAA A;  3RE7 A;  3N6O A;  2FG8 A;  2Z6M A;  5C3E L;  3BVE A;  4CVT A;  4AI3 A;  3HAX C;  5HJH A;  1WCM L;  2XJV A;  3LPE B;  2BJY A;  2JI3 A;  2PYB A;  3C1Z A;  1YUZ A;  3QHC A;  4YXJ A;  5JKL G;  4CVR A;  2ZA7 A;  3WNW A;  4PGI A;  1S3Q A;  1JGC A;  3NP0 X;  5DM6 1;  3ES3 A;  4TOB A;  2ZIX A;  2APO B;  3E1M A;  1NFV A;  5FEJ A;  1QQT A;  5D8P A;  1VJX A;  2CHI A;  2ZG7 X;  1RDV A;  3P8B A;  4RXN A;  5MFP A;  4BY7 L;  1VZH A;  3BVK A;  2A69 D;  3PVT B;  1R0G A;  3HOX L;  3GTM L;  3R2M A;  2B5I D;  1QYB A;  3LKD A;  2FJC A;  4U67 1;  2CR8 A;  5AI3 A;  5MLC 3;  5M5W L;  2IY4 A;  4CVS A;  3BVF A;  1I3Q L;  3VPB E;  4ETR A;  4P18 A;  3L0M A;  3AJP A;  1DAT A;  3AK8 A;  2XJQ A;  3RYG A;  3UOF A;  2C2U A;  3W54 A;  2PMZ P;  3D19 A;  4MY7 A;  4POG A;  3ISE A;  1OTK A;  2IB0 A;  2XKQ A;  4YKH A;  1LTL A;  1BFY A;  5IP7 L;  4JAD A;  3E2C A;  5J8S A;  2V8U A;  3UFB A;  4BXX L;  5GOU A;  1FHM A;  4ME3 A;  2ZA8 A;  4ERU A;  3B0A B;  1PFV A;  3AF8 X;  2Z5Q A;  3FI6 A;  4PGK A;  3HIU A;  4DI0 A;  2C41 A;  6RXN A;  3HOV L;  3H97 A;  3GTO L;  3SE1 A;  2V8T A;  3B08 B;  2WB1 P;  3QB9 A;  3PO2 L;  1JKV A;  2BKC A;  1ZRP A;  3J7Y 1;  3A68 A;  1I6H L;  4XGS A;  2K2D A;  2E2I L;  2FKZ A;  3KXU A;  2V2R A;  1Z6O M;  3JZA B;  3PIO 1;  1TKP A;  4ZMC A;  3KYX A;  4PG0 A;  4TOA A;  5IYD L;  4ZJK A;  3ISF A;  1J30 A;  1MOJ A;  2CEI A;  3S1Q L;  2R93 L;  4AHZ A;  4BBR L;  5GU2 X;  1JI5 A;  3RZT A;  3UNO A;  1O9I A;  5D8Y A;  1VZG A;  1RCE A;  5GAE c;  1BRF A;  4A3F L;  3HOU L;  5EIO C;  3GGY A;  3EZ0 A;  1OWB A;  5M3F L;  2V2O A;  4M32 A;  3BVL A;  3RBC A;  5E2D A;  1NXE A;  3S1M L;  5GAH c;  2NYD A;  1Y1W L;  1TWF L;  1L8H A;  3RD0 A;  2Z5P A;  2JA5 L;  2ERS A;  3R2O A;  4ZTT A;  1T9Q A;  4JAE A;  4LYX A;  3H9B A;  3EZU A;  4EVE A;  1RCG A;  4XKT A;  1ZUJ A;  2YJK A;  1DPS A;  4A3E L;  3QD8 A;  3U90 A;  4ISP A;  3Q4O A;  4U3G A;  1TWC L;  4AR4 A;  4C2M 1;  2V0E A;  5J93 A;  4G6B A;  3KX9 A;  4KXR B;  4WFN 1;  3GTP L;  1XZ3 A;  5MF6 A;  1IER A;  3S1R L;  5M5X L;  4TW3 A;  4E6K A;  2ERJ A;  1CAD A;  5GU1 X;  1SMM A;  2X17 0;  1PFY A;  3JR7 A;  1R0H A;  1JKU A;  2D5K A;  4EVD A;  1ODH A;  3KYW A;  1RCD A;  2PVX A;  3HL1 A;  1R0J A;  3E1O A;  1Z92 B;  4MJY A;  5C4X L;  1IW7 D;  2VL6 A;  3WWL A;  4W4L B;  4LYU A;  2KN9 A;  4MKU A;  4A25 A;  3P2A A;  3F32 A;  1H7V A;  2QL0 A;  4M34 A;  3LWV B;  4XXB B;  3RZO L;  3GVY A;  2G4H A;  1HRS A;  2M4Y A;  3FVB A;  1RYQ A;  5D8S A;  3PVR A;  3CQZ L;  2XJS A;  4YWM A;  2V2I A;  3AJQ A;  5MFZ A;  3E1L A;  4LPJ A;  5AI2 A;  4A93 L;  3F38 A;  3GTG L;  3O7S A;  1TKO A;  5I4J A;  4AI2 A;  4CMY A;  5C6F A;  3IS7 A;  3PIP 1;  3KA4 A;  4TPU A;  4ZL6 A;  1YUX A;  3E1P A;  5GAG c;  5ERJ A;  2VXI A;  5D8Q A;  4AM2 A;  4ML5 A;  3M4O L;  2CF7 A;  4RC7 A;  3QQC E;  3PWQ C;  4ZKH A;  2CWL A;  4TVM A;  3LNL A;  5JVG 1;  2E2H L;  2A68 D;  2J9U B;  2AUS B;  3KA6 A;  3EGM A;  3M3Y L;  5FFC A;  1JI4 A;  1XZ1 A;  3KHK A;  4GS7 D;  4B8C D;  4M35 A;  3MPS A;  1Z6O A;  4DYU A;  1QGH A;  3F35 A;  4LHL A;  3GTK L;  1EUM A;  3KYV A;  3H3V M;  2FFX J;  4II4 A;  1L8I A;  3F34 A;  2C6R A;  5K52 A;  3GGZ A;  3S16 L;  5H1S c;  3J7Z 1;  5JVH 1;  2M4V A;  4AR3 A;  1SFO L;  2JA8 L;  2JD8 0;  3AF7 X;  1JYB A;  2NVX L;  1R03 A;  3R2K A;  2W0O A;  1QCV A;  3PVR B;  3Q4R A;  5CMQ A;  5ERK A;  2HR5 A;  4C3J L;  1VCX A;  3H99 A;  8RXN A;  4KVS A;  1PFU A;  3HOW L;  3H7G A;  1LB3 A;  3WVW A;  2HTN A;  3S2D L;  1SOF A;  3O7R A;  1VEQ A;  5GN8 A;  3RZ6 A;  3KYU A;  2N02 A;  2IU2 A;  3PW8 A;  4MXP A;  4LPM A;  3FRR A;  3VV9 A;  4DE6 A;  3OJ5 A;  4RC7 B;  3SHX A;  4LQJ A;  1BFR A;  3FDJ A;  3E1Q A;  1NF4 A;  4CYB A;  4ZKW A;  1B2J A;  5EIN C;  2JD7 0;  3AJO A;  4A3J L;  2QQY A;  5JDO A;  2H12 A;  3C23 A;  3FKI L;  2V2P A;  3E1J A;  1NF6 A;  3E6R A;  5M3M L;  4II4 B;  3LWR B;  5LS9 A;  4A3D L;  1IRN A;  2JD6 0;  1IU5 A;  4C3H L;  5FFA A;  4W4K B;  4CYA A;  3S17 L;  3KA3 A;  3PW8 C;  1E8J A;  4AM5 A;  1IES A;  1WJV A;  3HJW B;  1IU6 A;  3M6J A;  5AXS A;  1F4L A;  4AI1 A;  3K7A L;  2RDV A;  5GU0 X;  2OC5 A;  3PO3 L;  2GYD A;  4V19 6;  1RB9 A;  5GN8 B;  1T9O A;  4A3B L;  4IXK A;  5IP9 L;  4YWL A;  4EVB A;  3GTQ L;  4TOD A;  2DSX A;  5J9V A;  1MFR A;  4Z5S A;  2NVT L;  2R7Z L;  3SH6 A;  3BVI A;  1VLG A;  2L0Z A;  1RCC A;  4YXM A;  4DYY A;  4ITT A;  1H96 A;  2JA6 L;  1GWG A;  3F37 A;  1T9P A;  4AI0 A;  5JDO B;  3H0G L;  5C4J L;  3GTJ L;  1C09 A;  1F30 A;  3I4N L;  1VEL A;  5K2M E;  4RC8 A;  4X0J A;  3K35 A;  2ZUR X;  4KVR A;  5HQO A;  5LBH A;  3ERZ A;  3Q4Q A;  1SMU A;  4TOC A;  2CIH A;  3LWP B;  2ITB A;  3C1Y A;  5JAC A;  4JAF A;  1SMW A;  4AHY A;  3PWQ A;  3AF9 X;  3IS8 A;  1RDG A;  5IYB L;  3PW1 A;  3RZD L;  3QZ3 A;  4IWK A;  4AHW A;  1AEW A;  2OKC A;  2RFK B;  3AK9 A;  3T9J A;  4DYZ A;  2B63 L;  2XGW A;  3R2H A;  3KA9 A;  3PVY A;  2FZF A;  4A3L L;  2F7N A; 
#chains in the Genus database with same CATH homology
 5AN9 H;  1B71 A;  3KYY A;  5D8O A;  2JI1 A;  5HJF A;  5K53 A;  1LKP A;  4KVQ A;  1VEI A;  1RCI A;  4E6Y A;  2WLU A;  2Z90 A;  1TJO A;  2ZA6 A;  3IU3 I;  4IWJ A;  5FFE A;  1TK6 A;  1OWC A;  1YK4 A;  1JIG A;  2PSM C;  4DYX A;  2V2N A;  2CN6 A;  7RXN A;  4EVC A;  3BKN A;  3E6S A;  2XJU A;  1YV1 A;  5IY0 A;  3Q4N A;  2LCQ A;  3SID A;  1BCF A;  4TOE A;  2BK6 A;  1N1Q A;  2Z3Q B;  2ZG9 X;  3R2S A;  2WWX B;  3GE4 A;  1RWD A;  5D8R A;  5GAD c;  3NOZ X;  1Z4A A;  2C2F A;  2V15 A;  5E1U A;  2Z5R A;  3PW1 B;  3KA8 A;  2C6A A;  3V3K B;  4OYN A;  2MS3 A;  4Y08 A;  5JKM A;  2QF9 A;  1BG7 A;  2XJN A;  3PVY B;  4RC5 A;  2A6H D;  4DAS A;  2Z3R B;  2AR0 A;  3WVU A;  2AYJ A;  3PKJ A;  5CMR A;  3R2L A;  1O9R A;  3C21 A;  2OH3 A;  2G38 B;  2VZB A;  2FL0 A;  5LG8 A;  4AR6 A;  4DZ0 A;  2UX1 A;  3MSU A;  2CLB A;  4R42 A;  2GYQ A;  4LPN A;  3RAV A;  4YVZ A;  1VZI A;  2PYA A;  5IX6 A;  3VVA A;  4AHX A;  4E40 A;  1KRQ A;  1S30 A;  2M6O A;  4WJG 4;  3PZA A;  1BQ8 A;  5FFD A;  1BQ9 A;  2YW7 A;  2CN7 A;  4AR5 A;  3IQ1 A;  1B13 A;  2O5J D;  2V2L A;  1FHH A;  5JKL A;  4ISM A;  2GMG A;  4LQH A;  5D8X A;  1R0F A;  3F33 A;  1RYT A;  2YW6 A;  1SQ3 A;  3OGH A;  4CVP A;  2XJO A;  3RGD A;  2CHP A;  4CY9 A;  2XJP A;  4M33 A;  3ZG6 A;  4POF A;  1JRE A;  3SS2 A;  3WVV A;  4XKS A;  4REU A;  5LG2 A;  2V2J A;  4RC5 B;  1FHA A;  3A9Q A;  1JTS A;  2BW1 A;  3F36 A;  5RXN A;  2XJM A;  1NNQ A;  5DM7 1;  4LQV A;  4UY8 1;  3UOI A;  4AM4 A;  4JAG A;  2FHA A;  3VNX A;  4ZLW A;  1R0I A;  2V2S A;  1UVH A;  2YJJ A;  3FSE A;  2A6E D;  3PKI A;  1UMN A;  1BE7 A;  2CKA A;  1LKO A;  2PVE A;  4TO9 A;  4ZL5 A;  2V0F A;  2Y44 A;  2WTL A;  4PG1 A;  3TA8 A;  2FG4 A;  2ZG8 X;  5MGN A;  2C6B A;  3A44 A;  4ITW A;  2JI2 A;  2CLU A;  5CZU A;  2XJR A;  5GU3 X;  4RC6 A;  1LKM A;  3JZ9 A;  3BT5 A;  3PWF A;  5J8W A;  4MUD A;  2GS4 A;  4XKU A;  4ZN1 B;  4MN9 A;  3E1N A;  1IRO A;  4CMY V;  4TOF A;  2C2J A;  2Y3Q A;  2XJT A;  2VXX A;  3F39 A;  4TOG A;  1NXG A;  2V2M A;  1YK5 A;  2V3B B;  2M6P A;  3FRS A;  4Z3B A;  3NFP I;  3WWN B;  4ZKX A;  3KDQ A;  3PVT A;  5JKM G;  1DVB A;  2WLA A;  1S24 A;  3GHQ A;  5HU6 D;  1ZS3 A;  4ZN3 B;  1DX8 A;  2MGY A;  3DBY A;  3NP2 X;  4TOH A;  2CKC A;  3R2R A;  1B2O A;  4K9F A;  3QVD A;  4XGH A;  4LQN A;  1F33 A;  2KKD A;  1S2Z A;  4QUW A;  2RBD A;  3KWO A;  2PPT A;  4LHN A;  5FFB A;  4RC6 B;  2BE5 D;  3QHB A;  1CAA A;  3RE7 A;  3N6O A;  2FG8 A;  2Z6M A;  3BVE A;  4CVT A;  4AI3 A;  5HJH A;  2XJV A;  3LPE B;  2BJY A;  2JI3 A;  2PYB A;  3C1Z A;  1YUZ A;  3QHC A;  4YXJ A;  5JKL G;  4CVR A;  2ZA7 A;  3WNW A;  4PGI A;  1S3Q A;  1JGC A;  3NP0 X;  5DM6 1;  3ES3 A;  4TOB A;  2ZIX A;  3E1M A;  1NFV A;  5FEJ A;  3P8B A;  5D8P A;  1VJX A;  2CHI A;  2ZG7 X;  1RDV A;  4RXN A;  5MFP A;  1VZH A;  3BVK A;  2A69 D;  3PVT B;  1R0G A;  3R2M A;  2B5I D;  1QYB A;  3LKD A;  2FJC A;  4U67 1;  2CR8 A;  5AI3 A;  5MLC 3;  2IY4 A;  4CVS A;  3BVF A;  3VPB E;  4ETR A;  4P18 A;  3L0M A;  3AJP A;  1DAT A;  3AK8 A;  2XJQ A;  3RYG A;  3UOF A;  2C2U A;  3W54 A;  3D19 A;  4MY7 A;  4POG A;  3ISE A;  1OTK A;  2IB0 A;  2XKQ A;  4YKH A;  1LTL A;  1BFY A;  4JAD A;  3E2C A;  5J8S A;  2V8U A;  3UFB A;  5GOU A;  1FHM A;  4ME3 A;  2ZA8 A;  4ERU A;  3B0A B;  3AF8 X;  2Z5Q A;  3FI6 A;  4PGK A;  3HIU A;  4DI0 A;  2C41 A;  6RXN A;  3SE1 A;  2V8T A;  3B08 B;  3QB9 A;  1JKV A;  2BKC A;  1ZRP A;  3J7Y 1;  3A68 A;  4XGS A;  2K2D A;  2FKZ A;  3KXU A;  2V2R A;  1Z6O M;  3JZA B;  3PIO 1;  1TKP A;  4ZMC A;  3KYX A;  4PG0 A;  4TOA A;  4ZJK A;  3ISF A;  1J30 A;  1MOJ A;  2CEI A;  4AHZ A;  5GU2 X;  1JI5 A;  3RZT A;  3UNO A;  1O9I A;  5D8Y A;  1VZG A;  1RCE A;  5GAE c;  1BRF A;  5EIO C;  3GGY A;  3EZ0 A;  1OWB A;  2V2O A;  4M32 A;  3BVL A;  3RBC A;  5E2D A;  1NXE A;  5GAH c;  2NYD A;  1L8H A;  3RD0 A;  2Z5P A;  2ERS A;  3R2O A;  4ZTT A;  1T9Q A;  4JAE A;  4LYX A;  3EZU A;  4EVE A;  1RCG A;  4XKT A;  1ZUJ A;  2YJK A;  1DPS A;  3QD8 A;  3U90 A;  4ISP A;  3Q4O A;  4U3G A;  4AR4 A;  2V0E A;  5J93 A;  4G6B A;  3KX9 A;  4KXR B;  4WFN 1;  1XZ3 A;  5MF6 A;  1IER A;  4TW3 A;  4E6K A;  2ERJ A;  1CAD A;  5GU1 X;  1SMM A;  2X17 0;  1R0H A;  1JKU A;  2D5K A;  4EVD A;  1ODH A;  3KYW A;  1RCD A;  2PVX A;  3HL1 A;  1R0J A;  3E1O A;  1Z92 B;  4MJY A;  1IW7 D;  2VL6 A;  3WWL A;  4W4L B;  4LYU A;  2KN9 A;  4MKU A;  4A25 A;  3P2A A;  3F32 A;  1H7V A;  2QL0 A;  4M34 A;  4XXB B;  3GVY A;  2G4H A;  1HRS A;  2M4Y A;  3FVB A;  1RYQ A;  5D8S A;  3PVR A;  2XJS A;  4YWM A;  2V2I A;  3AJQ A;  5MFZ A;  3E1L A;  4LPJ A;  5AI2 A;  3F38 A;  3O7S A;  1TKO A;  5I4J A;  4AI2 A;  4CMY A;  5C6F A;  3IS7 A;  3PIP 1;  3KA4 A;  4TPU A;  4ZL6 A;  1YUX A;  3E1P A;  5GAG c;  5ERJ A;  2VXI A;  5D8Q A;  4AM2 A;  4ML5 A;  2CF7 A;  4RC7 A;  3QQC E;  3PWQ C;  4ZKH A;  2CWL A;  4TVM A;  3LNL A;  5JVG 1;  2A68 D;  2J9U B;  3KA6 A;  3EGM A;  5FFC A;  1JI4 A;  1XZ1 A;  3KHK A;  4GS7 D;  4B8C D;  4M35 A;  3MPS A;  1Z6O A;  4DYU A;  1QGH A;  3F35 A;  4LHL A;  1EUM A;  3KYV A;  2FFX J;  4II4 A;  1L8I A;  3F34 A;  2C6R A;  5K52 A;  3GGZ A;  5H1S c;  3J7Z 1;  5JVH 1;  2M4V A;  4AR3 A;  2JD8 0;  3AF7 X;  1JYB A;  1R03 A;  3R2K A;  2W0O A;  1QCV A;  3PVR B;  3Q4R A;  5CMQ A;  5ERK A;  2HR5 A;  1VCX A;  8RXN A;  4KVS A;  3H7G A;  1LB3 A;  3WVW A;  2HTN A;  1SOF A;  3O7R A;  1VEQ A;  5GN8 A;  3RZ6 A;  3KYU A;  2N02 A;  2IU2 A;  3PW8 A;  4MXP A;  4LPM A;  3FRR A;  3VV9 A;  4DE6 A;  3OJ5 A;  4RC7 B;  3SHX A;  4LQJ A;  1BFR A;  3E1Q A;  1NF4 A;  4CYB A;  4ZKW A;  1B2J A;  5EIN C;  2JD7 0;  3AJO A;  2QQY A;  5JDO A;  2H12 A;  3C23 A;  2V2P A;  3E1J A;  1NF6 A;  3E6R A;  4II4 B;  5LS9 A;  1IRN A;  2JD6 0;  1IU5 A;  5FFA A;  4W4K B;  4CYA A;  3KA3 A;  3PW8 C;  1E8J A;  4AM5 A;  1IES A;  1WJV A;  1IU6 A;  3M6J A;  5AXS A;  4AI1 A;  2RDV A;  5GU0 X;  2OC5 A;  2GYD A;  4V19 6;  1RB9 A;  5GN8 B;  1T9O A;  4IXK A;  4YWL A;  4EVB A;  4TOD A;  2DSX A;  5J9V A;  1MFR A;  4Z5S A;  3SH6 A;  3BVI A;  1VLG A;  2L0Z A;  1RCC A;  4YXM A;  4DYY A;  4ITT A;  1H96 A;  1GWG A;  3F37 A;  1T9P A;  4AI0 A;  5JDO B;  1C09 A;  1F30 A;  1VEL A;  5K2M E;  4RC8 A;  4X0J A;  3K35 A;  2ZUR X;  4KVR A;  5HQO A;  5LBH A;  3ERZ A;  3Q4Q A;  1SMU A;  4TOC A;  2CIH A;  2ITB A;  3C1Y A;  5JAC A;  4JAF A;  1SMW A;  4AHY A;  3PWQ A;  3AF9 X;  3IS8 A;  1RDG A;  3PW1 A;  3QZ3 A;  4IWK A;  4AHW A;  1AEW A;  2OKC A;  3AK9 A;  3T9J A;  4DYZ A;  2XGW A;  3R2H A;  3KA9 A;  3PVY A;  2FZF A;  2F7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...