1YUXA

Mixed valant state of nigerythrin
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
202
structure length
200
Chain Sequence
MKVRAQVPTVKNATNFNMVADSKTSVGSTLENLKAAIAGETGAHAKYTAFAKAAREQGYEQIARLFEATAAAELIHIGLEYALVAEMEPGYEKPTVPSAYSCDLNLISGANGEIYETSDMYPAFIRKAQEEGNSKAVHVFTRAKLAESVHAERYLAAYNDIDAPDDDKFHLCPICGYIHKGEDFEKCPICFRPKDTFTAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nigerythrin
publication title High-resolution crystal structures of Desulfovibrio vulgaris (Hildenborough) nigerythrin: facile, redox-dependent iron movement, domain interface variability, and peroxidase activity in the rubrerythrins.
pubmed doi rcsb
source organism Desulfovibrio vulgaris subsp. vulgaris
molecule tags Oxidoreductase
total genus 71
structure length 200
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02915 Rubrerythrin Rubrerythrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1yuxA01
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1yuxA02
1O9IA 1LKPA 2CEIA 3PVYB 3NP2X 2QQYA 1RCEA 1Z4AA 2WTLA 1TKPA 3RZTA 2ZG9X 1CADA 3E1JA 2RDVA 1DATA 4CVRA 3R2RA 1RCGA 2CIHA 1YUZA 2FG4A 4TOHA 3PWQA 2IB0A 1UVHA 2YW7A 2V2MA 3HL1A 1RCDA 1TK6A 3E1OA 4XKTA 5K52A 3PW1B 4ERUA 2ZURX 3E1LA 1LTLA 3KYYA 3SS2A 1E8JA 4CMYV 3RBCA 2ZA7A 4AM2A 3BT5A 2FKZA 3FI6A 4LPNA 3F33A 5AI2A 3PWFA 2BW1A 3AJQA 4DYZA 3GVYA 2PYAA 5GU1X 3PW1A 1VELA 1R0JA 5GU2X 2G4HA 3O7RA 3R2SA 3E1NA 3F34A 2JD60 4M34A 3E6RA 3KX9A 4IWJA 5GN8B 2GYQA 1L8HA 1SMUA 1NFVA 1QCVA 3OGHA 2PVXA 5E1UA 3A9QA 1BFYA 4M35A 2GYDA 2PVEA 1BQ9A 1IESA 4ZKXA 1RDVA 1IROA 1DPSA 2V2OA 3BVEA 4ME3A 1DVBA 4LQHA 1YV1A 1JTSA 3R2LA 1J30A 4DYXA 3KYXA 3AJPA 4IXKA 2Y3QA 1JGCA 2YW6A 2V3BB 5IY0A 3BVIA 4M33A 1T9QA 1O9RA 4AR4A 2HTNA 3RYGA 5ERJA 4II4A 4LYUA 5E2DA 1DX8A 4M32A 2K2DA 4YWMA 3Q4RA 5HQOA 3AK9A 5LG2A 4ZKWA 4MUDA 4TOCA 1Z6OM 1FHMA 4LPMA 4LQJA 2V2SA 4MJYA 3KWOA 2Z5RA 3AF7X 2YJJA 1B2JA 3RAVA 3A44A 2FG8A 3ES3A 4ZTTA 1B2OA 1BRFA 3ISEA 2FHAA 5CMQA 3BVLA 4CMYA 1NF6A 5I4JA 3T9JA 1FHAA 1R0HA 2YJKA 3PW8A 2V2LA 1CAAA 1IU6A 2UX1A 4ML5A 4CVTA 4TODA 3U90A 2BKCA 4CVSA 2QL0A 5RXNA 4AR6A 3AF8X 5LBHA 2QF9A 3R2OA 2RBDA 4ETRA 3F37A 1VJXA 4AM5A 3KA8A 3Q4NA 2PYBA 3MPSA 2FFXJ 2CLUA 4PG0A 2GMGA 3KA9A 3WVUA 5JKMA 4RC5A 1ZS3A 1TKOA 3RE7A 2ZG8X 3R2MA 1S2ZA 4P18A 1RWDA 4TOFA 2ITBA 4TOBA 3VNXA 4MN9A 2C41A 5ERKA 2XKQA 3IS7A 4LPJA 3FSEA 3UOIA 3F39A 2V2RA 3KA4A 4LYXA 4DYYA 3EGMA 4CY9A 3F35A 1S24A 1B13A 4AR3A 3E1QA 3E1MA 3RGDA 5FFBA 4DASA 2JD80 4RC6A 1VCXA 3GHQA 3QHCA 1VEIA 1NF4A 3KXUA 4LQNA 1JI4A 1QYBA 3UOFA 4YKHA 5FFAA 4II4B 3KA3A 4ZL6A 2W0OA 2ZA6A 4TOGA 5C6FA 5J93A 3O7SA 4TOEA 3AF9X 1ZRPA 5D8SA 4E6KA 3QD8A 4OYNA 1B71A 3F36A 2WLAA 4Y08A 6RXNA 4ZKHA 1RCIA 4POFA 1C09A 1JKUA 5D8XA 2M4YA 5JKLA 2XJOA 4EVDA 4Z5SA 4MY7A 2Z90A 3ERZA 2VXIA 1JYBA 1N1QA 2KKDA 2BJYA 5HJFA 5AXSA 4K9FA 4LQVA 3F38A 2XJNA 1S30A 4QUWA 4ZLWA 5J8SA 2OC5A 2FL0A 4PGIA 2Z6MA 3KYUA 7RXNA 3SH6A 2Z5PA 1IERA 1TJOA 3E6SA 1RYTA 1UMNA 3WVVA 4A25A 2JD70 1R0GA 1OTKA 3SHXA 3SIDA 1LKOA 1SOFA 1MFRA 2DSXA 1H7VA 4TOAA 2V2JA 1EUMA 3WNWA 3QZ3A 2X170 3UNOA 8RXNA 4EVBA 1IRNA 2LCQA 3PVRA 3WVWA 3FVBA 1JKVA 3Q4OA 4U3GA 3R2KA 3SE1A 2ZG7X 1VEQA 2ZA8A 1SMWA 2HR5A 3EZ0A 4RC5B 2IU2A 2XJMA 3AJOA 4DYUA 5FFDA 4DE6A 3ISFA 1ZUJA 4ISMA 2GS4A 4EVEA 3KYVA 3A68A 3BKNA 1IU5A 4ISPA 1LB3A 3EZUA 2FJCA 5D8QA 3TA8A 3NP0X 3GE4A 3HIUA 3F32A 4RC7B 5JKMG 2VZBA 2CHIA 1H96A 2WLUA 4PG1A 1JI5A 4RC6B 3OJ5A 5GOUA 1L8IA 3AK8A 3PVYA 1FHHA 1AEWA 2VL6A 3IQ1A 2CHPA 1GWGA 3QB9A 5GU3X 4RC7A 4REUA 3KYWA 1HRSA 2VXXA 5J8WA 5D8YA 5AI3A 4CYAA 2Z5QA 3BVKA 4ZL5A 3PW8C 5K53A 2V2IA 4MKUA 2CN6A 4RC8A 4AM4A 1JIGA 4ZJKA 3NOZX 5HJHA 1BE7A 5D8RA 4EVCA 4ITTA 2C2UA 3KA6A 1JREA 3H7GA 2CN7A 3R2HA 2FZFA 2V15A 1RB9A 1F33A 4DI0A 1R0FA 1XZ1A 2XGWA 4POGA 1QGHA 3E1PA 3PWQC 1MOJA 5GU0X 1F30A 2KN9A 5CMRA 2IY4A 5GN8A 1SMMA 5D8OA 3PZAA 4KVQA 4TW3A 2MS3A 2BK6A 4RXNA 5LG8A 5J9VA 2V2PA 5JKLG 4DZ0A 5CZUA 4XKSA 2OH3A 1RCCA 3RZ6A 1Z6OA 4ZMCA 1YUXA 4CYBA 4KVSA 5FEJA 5FFEA 5FFCA 1VLGA 3PVTB 4YWLA 1R0IA 1LKMA 5D8PA 4PGKA 2C2FA 4KVRA 1BG7A 1BQ8A 3BVFA 4XKUA 4TPUA 4IWKA 3PVRB 2C2JA 1YK5A 1R03A 1XZ3A 1KRQA 2F7NA 2C6RA 3PVTA 1T9OA 2CF7A 5JACA 4TO9A 1NNQA 3IS8A 1SQ3A 4CVPA 1BFRA 2D5KA 3Q4QA 3QVDA 1T9PA 4AR5A 1S3QA 4ITWA 3QHBA 2V2NA 3RD0A 3E2CA 1YK4A 4Z3BA 1RDGA 2CLBA 4R42A 5IX6A 1BCFA 4XGSA 5LS9A
chains in the Genus database with same CATH superfamily
2H12A 1O9IA 1LKPA 2CEIA 4WFN1 1P7PA 3PVYB 4MXPA 5C4JL 3S17L 3NP2X 2QQYA 1RCEA 1Z4AA 2WTLA 1TKPA 3RZTA 2ZG9X 1CADA 3E1JA 2RDVA 3GGYA 1DATA 4CVRA 2V0EA 5M5XL 3GTPL 3MSUA 3R2RA 1RCGA 4ZN3B 2CIHA 1YUZA 3C23A 2JA5L 4YXJA 5IP7L 2FG4A 3S1QL 3JZ9A 4TOHA 3PWQA 2IB0A 5DM61 1UVHA 2YW7A 2V2MA 3HL1A 1RCDA 3HKZP 1TK6A 3E1OA 4XKTA 4A3KL 2JA7L 1VZHA 3MQKB 5K52A 3PW1B 4BY7L 4ERUA 2ZURX 3E1LA 1NXEA 1LTLA 3KYYA 3SS2A 1E8JA 4CMYV 3P8BA 3RBCA 2ZA7A 3KDQA 4AM2A 3BT5A 3H9CA 4A93L 2FKZA 3P2AA 3FI6A 3PKIA 4LPNA 3F33A 5AI2A 3LWVB 3PWFA 2BW1A 3AJQA 4DYZA 5DM71 3GVYA 2XJUA 5C4XL 2PYAA 5GU1X 3PW1A 1VELA 1R0JA 5GU2X 2R93L 2G4HA 3O7RA 3R2SA 4AHZA 3E1NA 3F34A 2JD60 4M34A 4XGHA 3HOUL 3E6RA 3KX9A 4IWJA 5GN8B 2XJTA 2GYQA 2JA6L 1L8HA 1PZXA 1SMUA 4QIWP 3LWRB 1NFVA 2PPTA 1QCVA 4C3IL 1VZGA 3GTJL 3OGHA 5HU6D 2PVXA 5E1UA 3A9QA 2ZIXA 4LHLA 1BFYA 4M35A 3J7Y1 2GYDA 2PVEA 1BQ9A 1IESA 4WJG4 3FRRA 3S15L 4ZKXA 1RDVA 4XXBB 3UFBA 2O5JD 2ERSA 1IROA 1DPSA 2V2OA 3BVEA 3FDJA 4ME3A 1DVBA 4LQHA 1YV1A 3GTGL 1JTSA 4ZN1B 3R2LA 1J30A 4DYXA 3KYXA 4BY1L 3AJPA 4IXKA 2Y3QA 4BXXL 1JGCA 2YW6A 2V3BB 3J7Z1 5IY0A 3BVIA 4M33A 1T9QA 1F4LA 1O9RA 4AR4A 2HTNA 3RYGA 5C3EL 5ERJA 4X6AL 5JVG1 4II4A 3I4NL 4LYUA 5E2DA 1DX8A 4M32A 2K2DA 4YWMA 3WWNB 3Q4RA 5HQOA 1ODHA 2RFKB 2AR0A 3AK9A 5LG2A 4ZKWA 4MUDA 3JR7A 4TOCA 1Z6OM 2XJVA 1FHMA 4LPMA 4LQJA 2V2SA 4TVMA 5JVH1 4MJYA 3KWOA 2Z5RA 5GAGc 3AF7X 2YJJA 1B2JA 2NYDA 3RAVA 3A44A 2JI1A 2FG8A 3N6OA 3ES3A 4ZTTA 1B2OA 1BRFA 3ISEA 2FHAA 4GS7D 5CMQA 3BVLA 4CMYA 1NF6A 5I4JA 3T9JA 1FHAA 1R0HA 2YJKA 3PW8A 2C6AA 2V2LA 2PMZP 4AI1A 1CAAA 3GTQL 2CWLA 3DBYA 1IU6A 2UX1A 3JZAB 3LWQB 4ML5A 4CVTA 4TODA 3U90A 2BKCA 4CVSA 2QL0A 5M5YL 5RXNA 4AR6A 3HAXC 3AF8X 5JDOB 5LBHA 2QF9A 1RYQA 4W4KB 1VZIA 4A3LL 3R2OA 2RBDA 4AYBP 4ETRA 3F37A 1VJXA 4AM5A 3KA8A 3Q4NA 2PYBA 1PFWA 3MPSA 2FFXJ 1I6HL 2CLUA 3PIP1 1TWGL 4PG0A 3GTLL 4YXMA 2GMGA 4JADA 3C21A 3KA9A 3WVUA 5JKMA 3GTOL 3LKDA 4RC5A 5JDOA 2HVYC 4AHWA 1ZS3A 1TKOA 3RE7A 2ZG8X 3K7AL 3R2MA 1S2ZA 4P18A 1RWDA 4TOFA 2ITBA 3C1ZA 3L0MA 4TOBA 5M3ML 3VNXA 4MN9A 4BBRL 2C41A 2XJRA 3I4ML 5FJ8L 5ERKA 2Z3RB 4C2M1 2XKQA 3IS7A 1Z92B 3FSEA 4LPJA 3UOIA 3F39A 2V2RA 3C1YA 3KA4A 4LYXA 3S1RL 4DYYA 3EGMA 4A3JL 4X0JA 4CY9A 4JAGA 3F35A 1S24A 1B13A 3LPEB 4AR3A 2E2HL 4A3ML 3E1QA 3E1MA 3RGDA 5FFBA 4DASA 2JD80 4RC6A 4A3DL 5EIOC 1VCXA 5IYBL 2YU9L 2M6OA 3GHQA 5EINC 3IU3I 3QHCA 5IYCL 1VEIA 1NF4A 2WWXB 3KXUA 4LQNA 5C44L 1JI4A 1QYBA 3UOFA 4YKHA 3S1NL 3GTKL 2NVTL 5FFAA 4II4B 2Y44A 3KA3A 4ZL6A 2W0OA 2ZA6A 4TOGA 5C6FA 5J93A 4LHNA 3O7SA 2WAQP 4TOEA 3AF9X 3B0AB 5FLML 3PKJA 1ZRPA 2M6PA 5D8SA 4C3JL 1IW7D 4E6KA 3QD8A 4OYNA 4JAEA 1B71A 3F36A 2WLAA 5GAHc 4Y08A 1TWAL 6RXNA 4ZKHA 1OWBA 1RCIA 4POFA 1C09A 1JKUA 2WB1P 5D8XA 2M4YA 3PO3L 5JKLA 2XJOA 4U671 3HOWL 4EVDA 2Y0SP 4Z5SA 3V3KB 2E2IL 4MY7A 2Z90A 3ERZA 2VXIA 1JYBA 1N1QA 2KKDA 2BJYA 4E40A 2J9UB 5HJFA 3QQCE 5AXSA 4K9FA 4LQVA 1I3QL 3H97A 3F38A 2XJNA 1S30A 1NXGA 4UY81 4QUWA 4ZLWA 3GTML 5J8SA 2OC5A 2FL0A 4PGIA 2VUML 2Z6MA 3KYUA 7RXNA 3SH6A 5IP9L 4JAFA 4A3GL 2Z5PA 5H1Sc 1IERA 3HOXL 1TJOA 3E6SA 2CKAA 3WWLA 1RYTA 1TWFL 1UMNA 3WVVA 4A25A 2JD70 1WCML 1WJVA 1R0GA 1OTKA 3SHXA 3SIDA 1PFYA 1LKOA 1SOFA 1MFRA 2DSXA 1H7VA 2A68D 4TOAA 2V2JA 1EUMA 3WNWA 3HJYB 5MFZA 3QZ3A 3K35A 2X170 3UNOA 8RXNA 4EVBA 1IRNA 2LCQA 3PVRA 4A3IL 3WVWA 1PFVA 3FVBA 1JKVA 3Q4OA 4U3GA 4B8CD 2E2JL 3R2KA 3S1ML 3SE1A 2ZG7X 1VEQA 1Y1WL 2ZA8A 1SMWA 2HR5A 3EZ0A 3M4OL 4RC5B 5AN9H 2IU2A 2XJMA 4AI0A 3LNLA 3AJOA 4DYUA 5FFDA 4DE6A 3ISFA 1ZUJA 4ISMA 4A3EL 2PSMC 2GS4A 4EVEA 3KYVA 5IYDL 3A68A 3BKNA 1IU5A 4ISPA 1LB3A 3EZUA 5MGNA 2FJCA 2NVYL 5D8QA 3TA8A 3NP0X 3GE4A 3HIUA 3CQZL 3F32A 4RC7B 5JKMG 2L0ZA 2VZBA 2CHIA 5GADc 1H96A 2WLUA 3B08B 5M3FL 4PG1A 1JI5A 4RC6B 3PIO1 3FKIL 3OJ5A 3M3YL 5GOUA 1L8IA 3AK8A 2MGYA 3PVYA 1TWHL 3H0GL 1FHHA 2EY4E 1AEWA 2C6BA 2APOB 3GGZA 3NFPI 5MLC3 4A3BL 1K83L 2VL6A 3PL5A 2A6ED 3IQ1A 2CHPA 2CR8A 2AUSB 1GWGA 3QB9A 5GU3X 4RC7A 4REUA 3KYWA 1HRSA 5M5WL 3H3VM 5MFPA 2VXXA 5J8WA 5D8YA 5AI3A 4CYAA 4AHYA 2Z5QA 3BVKA 4ZL5A 1PFUA 3PW8C 5K53A 2V2IA 4MKUA 2CN6A 4RC8A 4AM4A 1R9TL 1JIGA 2N02A 3NOZX 4ZJKA 5HJHA 4KXRB 1BE7A 4E6YA 5D8RA 2CKCA 5MF6A 4EVCA 3VPBE 2OKCA 4ITTA 2C2UA 3KA6A 1JREA 3H7GA 5GAEc 2CN7A 3R2HA 2FZFA 2BE5D 4AHXA 4A3FL 3S16L 4A3CL 2V15A 1RB9A 1F33A 4DI0A 1R0FA 1XZ1A 4C3HL 4Y52L 2XGWA 4POGA 1QGHA 3HOVL 3RZOL 3FRSA 2AQCA 3E1PA 3PWQC 2NVQL 1MOJA 5GU0X 1F30A 3D19A 5CMRA 2IY4A 2ERJA 2KN9A 5GN8A 4V196 1SMMA 2B63L 5D8OA 3PZAA 5K2ME 4KVQA 4TW3A 2MS3A 2BK6A 4RXNA 4AI3A 5LG8A 4BBSL 4W4LB 1SFOL 5J9VA 2V2PA 5JKLG 4AI2A 4DZ0A 3ZG6A 5CZUA 4XKSA 2OH3A 2V0FA 2JI2A 1RCCA 3VVAA 3RZ6A 1Z6OA 2V8TA 4ZMCA 1YUXA 3VV9A 1Y1VL 4CYBA 4KVSA 5FEJA 5FFEA 5FFCA 1VLGA 1I50L 3HOYL 3PVTB 4YWLA 1R0IA 1LKMA 5D8PA 3HJWB 2G38B 2AYJA 3S2DL 4Y7NL 3RZDL 4PGKA 2C2FA 4KVRA 1BG7A 1BQ8A 2A6HD 3LWOB 3BVFA 3S2HL 2B5ID 4XKUA 3H99A 2JI3A 4IWKA 4TPUA 2XJPA 3PVRB 2C2JA 2JA8L 1YK5A 1R03A 3M6JA 1XZ3A 1KRQA 2F7NA 3S14L 2V8UA 2C6RA 3KHKA 3PVTA 1T9OA 2CF7A 5JACA 4TO9A 2NVXL 1NNQA 3IS8A 4YVZA 2Z3QB 2R92L 2R7ZL 1SQ3A 4CVPA 1BFRA 3W54A 2D5KA 3Q4QA 3QVDA 3PO2L 2A69D 1T9PA 4G6BA 1OWCA 2XJQA 4AR5A 1QQTA 1S3QA 2M4VA 4ITWA 3H9BA 3LWPB 3QHBA 2V2NA 3RD0A 3E2CA 1YK4A 4Z3BA 3HOZL 2XJSA 1RDGA 2CLBA 1TWCL 4R42A 5IX6A 1BCFA 4XGSA 5LS9A
chains in the Genus database with same CATH topology
2H12A 1O9IA 1LKPA 2CEIA 4WFN1 3PVYB 4MXPA 3NP2X 2QQYA 1RCEA 1Z4AA 2WTLA 1TKPA 3RZTA 2ZG9X 1CADA 3E1JA 2RDVA 3GGYA 1DATA 4CVRA 2V0EA 3MSUA 3R2RA 1RCGA 4ZN3B 2CIHA 1YUZA 3C23A 4YXJA 2FG4A 3JZ9A 4TOHA 3PWQA 2IB0A 5DM61 1UVHA 2YW7A 2V2MA 3HL1A 1RCDA 1TK6A 3E1OA 4XKTA 1VZHA 5K52A 3PW1B 4ERUA 2ZURX 3E1LA 1NXEA 1LTLA 3KYYA 3SS2A 1E8JA 4CMYV 3P8BA 3RBCA 2ZA7A 3KDQA 4AM2A 3BT5A 2FKZA 3P2AA 3FI6A 3PKIA 4LPNA 3F33A 5AI2A 3PWFA 2BW1A 3AJQA 4DYZA 5DM71 3GVYA 2XJUA 2PYAA 5GU1X 3PW1A 1VELA 1R0JA 5GU2X 2G4HA 3O7RA 3R2SA 4AHZA 3E1NA 3F34A 2JD60 4M34A 4XGHA 3E6RA 3KX9A 4IWJA 5GN8B 2XJTA 2GYQA 1L8HA 1SMUA 1NFVA 2PPTA 1QCVA 1VZGA 3OGHA 5HU6D 2PVXA 5E1UA 3A9QA 2ZIXA 4LHLA 1BFYA 4M35A 3J7Y1 2GYDA 2PVEA 1BQ9A 1IESA 4WJG4 3FRRA 4ZKXA 1RDVA 4XXBB 3UFBA 2O5JD 2ERSA 1IROA 1DPSA 2V2OA 3BVEA 4ME3A 1DVBA 4LQHA 1YV1A 1JTSA 4ZN1B 3R2LA 1J30A 4DYXA 3KYXA 3AJPA 4IXKA 2Y3QA 1JGCA 2YW6A 2V3BB 3J7Z1 5IY0A 3BVIA 4M33A 1T9QA 1O9RA 4AR4A 2HTNA 3RYGA 5ERJA 5JVG1 4II4A 4LYUA 5E2DA 1DX8A 4M32A 2K2DA 4YWMA 3WWNB 3Q4RA 5HQOA 1ODHA 2AR0A 3AK9A 5LG2A 4ZKWA 4MUDA 4TOCA 1Z6OM 2XJVA 1FHMA 4LPMA 4LQJA 2V2SA 4TVMA 5JVH1 4MJYA 3KWOA 2Z5RA 5GAGc 3AF7X 2YJJA 1B2JA 2NYDA 3RAVA 3A44A 2JI1A 2FG8A 3N6OA 3ES3A 4ZTTA 1B2OA 1BRFA 3ISEA 2FHAA 4GS7D 5CMQA 3BVLA 4CMYA 1NF6A 5I4JA 3T9JA 1FHAA 1R0HA 2YJKA 3PW8A 2C6AA 2V2LA 4AI1A 1CAAA 2CWLA 3DBYA 1IU6A 2UX1A 3JZAB 4ML5A 4CVTA 4TODA 3U90A 2BKCA 4CVSA 2QL0A 5RXNA 4AR6A 3AF8X 5JDOB 5LBHA 2QF9A 1RYQA 4W4KB 1VZIA 3R2OA 2RBDA 4ETRA 3F37A 1VJXA 4AM5A 3KA8A 3Q4NA 2PYBA 3MPSA 2FFXJ 2CLUA 3PIP1 4PG0A 4YXMA 2GMGA 4JADA 3C21A 3KA9A 3WVUA 5JKMA 3LKDA 4RC5A 5JDOA 4AHWA 1ZS3A 1TKOA 3RE7A 2ZG8X 3R2MA 1S2ZA 4P18A 1RWDA 4TOFA 2ITBA 3C1ZA 3L0MA 4TOBA 3VNXA 4MN9A 2C41A 2XJRA 5ERKA 2Z3RB 2XKQA 3IS7A 1Z92B 3FSEA 4LPJA 3UOIA 3F39A 2V2RA 3C1YA 3KA4A 4LYXA 4DYYA 3EGMA 4X0JA 4CY9A 4JAGA 3F35A 1S24A 1B13A 3LPEB 4AR3A 3E1QA 3E1MA 3RGDA 5FFBA 4DASA 2JD80 4RC6A 5EIOC 1VCXA 2M6OA 3GHQA 5EINC 3IU3I 3QHCA 1VEIA 1NF4A 2WWXB 3KXUA 4LQNA 1JI4A 1QYBA 3UOFA 4YKHA 5FFAA 4II4B 2Y44A 3KA3A 4ZL6A 2W0OA 2ZA6A 4TOGA 5C6FA 5J93A 4LHNA 3O7SA 4TOEA 3AF9X 3B0AB 3PKJA 1ZRPA 2M6PA 5D8SA 1IW7D 4E6KA 3QD8A 4OYNA 4JAEA 1B71A 3F36A 2WLAA 5GAHc 4Y08A 6RXNA 4ZKHA 1OWBA 1RCIA 4POFA 1C09A 1JKUA 5D8XA 2M4YA 5JKLA 2XJOA 4U671 4EVDA 4Z5SA 3V3KB 4MY7A 2Z90A 3ERZA 2VXIA 1JYBA 1N1QA 2KKDA 2BJYA 4E40A 2J9UB 5HJFA 3QQCE 5AXSA 4K9FA 4LQVA 3F38A 2XJNA 1S30A 1NXGA 4UY81 4QUWA 4ZLWA 5J8SA 2OC5A 2FL0A 4PGIA 2Z6MA 3KYUA 7RXNA 3SH6A 4JAFA 2Z5PA 5H1Sc 1IERA 1TJOA 3E6SA 2CKAA 3WWLA 1RYTA 1UMNA 3WVVA 4A25A 2JD70 1WJVA 1R0GA 1OTKA 3SHXA 3SIDA 1LKOA 1SOFA 1MFRA 2DSXA 1H7VA 2A68D 4TOAA 2V2JA 1EUMA 3WNWA 5MFZA 3QZ3A 3K35A 2X170 3UNOA 8RXNA 4EVBA 1IRNA 2LCQA 3PVRA 3WVWA 3FVBA 1JKVA 3Q4OA 4U3GA 4B8CD 3R2KA 3SE1A 2ZG7X 1VEQA 2ZA8A 1SMWA 2HR5A 3EZ0A 4RC5B 5AN9H 2IU2A 2XJMA 4AI0A 3LNLA 3AJOA 4DYUA 5FFDA 4DE6A 3ISFA 1ZUJA 4ISMA 2PSMC 2GS4A 4EVEA 3KYVA 3A68A 3BKNA 1IU5A 4ISPA 1LB3A 3EZUA 5MGNA 2FJCA 5D8QA 3TA8A 3NP0X 3GE4A 3HIUA 3F32A 4RC7B 5JKMG 2L0ZA 2VZBA 2CHIA 5GADc 1H96A 2WLUA 3B08B 4PG1A 1JI5A 4RC6B 3PIO1 3OJ5A 5GOUA 1L8IA 3AK8A 2MGYA 3PVYA 1FHHA 1AEWA 2C6BA 3GGZA 3NFPI 5MLC3 2VL6A 2A6ED 3IQ1A 2CHPA 2CR8A 1GWGA 3QB9A 5GU3X 4RC7A 4REUA 3KYWA 1HRSA 5MFPA 2VXXA 5J8WA 5D8YA 5AI3A 4CYAA 4AHYA 2Z5QA 3BVKA 4ZL5A 3PW8C 5K53A 2V2IA 4MKUA 2CN6A 4RC8A 4AM4A 1JIGA 2N02A 3NOZX 4ZJKA 5HJHA 4KXRB 1BE7A 4E6YA 5D8RA 2CKCA 5MF6A 4EVCA 3VPBE 2OKCA 4ITTA 2C2UA 3KA6A 1JREA 3H7GA 5GAEc 2CN7A 3R2HA 2FZFA 2BE5D 4AHXA 2V15A 1RB9A 1F33A 4DI0A 1R0FA 1XZ1A 2XGWA 4POGA 1QGHA 3FRSA 3E1PA 3PWQC 1MOJA 5GU0X 1F30A 3D19A 5CMRA 2IY4A 2ERJA 2KN9A 5GN8A 4V196 1SMMA 5D8OA 3PZAA 5K2ME 4KVQA 4TW3A 2MS3A 2BK6A 4RXNA 4AI3A 5LG8A 4W4LB 5J9VA 2V2PA 5JKLG 4AI2A 4DZ0A 3ZG6A 5CZUA 4XKSA 2OH3A 2V0FA 2JI2A 1RCCA 3VVAA 3RZ6A 1Z6OA 2V8TA 4ZMCA 1YUXA 3VV9A 4CYBA 4KVSA 5FEJA 5FFEA 5FFCA 1VLGA 3PVTB 4YWLA 1R0IA 1LKMA 5D8PA 2G38B 2AYJA 4PGKA 2C2FA 4KVRA 1BG7A 1BQ8A 2A6HD 3BVFA 2B5ID 4XKUA 4TPUA 2JI3A 4IWKA 2XJPA 3PVRB 2C2JA 1YK5A 1R03A 3M6JA 1XZ3A 1KRQA 2F7NA 2V8UA 2C6RA 3KHKA 3PVTA 1T9OA 2CF7A 5JACA 4TO9A 1NNQA 3IS8A 4YVZA 2Z3QB 1SQ3A 4CVPA 1BFRA 3W54A 2D5KA 3Q4QA 3QVDA 2A69D 1T9PA 4G6BA 1OWCA 2XJQA 4AR5A 1S3QA 2M4VA 4ITWA 3QHBA 2V2NA 3RD0A 3E2CA 1YK4A 4Z3BA 2XJSA 1RDGA 2CLBA 4R42A 5IX6A 1BCFA 4XGSA 5LS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O9I A;  1LKP A;  2CEI A;  3PVY B;  3NP2 X;  2QQY A;  1RCE A;  1Z4A A;  2WTL A;  1TKP A;  3RZT A;  2ZG9 X;  1CAD A;  3E1J A;  2RDV A;  1DAT A;  4CVR A;  3R2R A;  1RCG A;  2CIH A;  1YUZ A;  2FG4 A;  4TOH A;  3PWQ A;  2IB0 A;  1UVH A;  2YW7 A;  2V2M A;  3HL1 A;  1RCD A;  1TK6 A;  3E1O A;  4XKT A;  5K52 A;  3PW1 B;  4ERU A;  2ZUR X;  3E1L A;  1LTL A;  3KYY A;  3SS2 A;  1E8J A;  4CMY V;  3RBC A;  2ZA7 A;  4AM2 A;  3BT5 A;  2FKZ A;  3FI6 A;  4LPN A;  3F33 A;  5AI2 A;  3PWF A;  2BW1 A;  3AJQ A;  4DYZ A;  3GVY A;  2PYA A;  5GU1 X;  3PW1 A;  1VEL A;  1R0J A;  5GU2 X;  2G4H A;  3O7R A;  3R2S A;  3E1N A;  3F34 A;  2JD6 0;  4M34 A;  3E6R A;  3KX9 A;  4IWJ A;  5GN8 B;  2GYQ A;  1L8H A;  1SMU A;  1NFV A;  1QCV A;  3OGH A;  2PVX A;  5E1U A;  3A9Q A;  1BFY A;  4M35 A;  2GYD A;  2PVE A;  1BQ9 A;  1IES A;  4ZKX A;  1RDV A;  1IRO A;  1DPS A;  2V2O A;  3BVE A;  4ME3 A;  1DVB A;  4LQH A;  1YV1 A;  1JTS A;  3R2L A;  1J30 A;  4DYX A;  3KYX A;  3AJP A;  4IXK A;  2Y3Q A;  1JGC A;  2YW6 A;  2V3B B;  5IY0 A;  3BVI A;  4M33 A;  1T9Q A;  1O9R A;  4AR4 A;  2HTN A;  3RYG A;  5ERJ A;  4II4 A;  4LYU A;  5E2D A;  1DX8 A;  4M32 A;  2K2D A;  4YWM A;  3Q4R A;  5HQO A;  3AK9 A;  5LG2 A;  4ZKW A;  4MUD A;  4TOC A;  1Z6O M;  1FHM A;  4LPM A;  4LQJ A;  2V2S A;  4MJY A;  3KWO A;  2Z5R A;  3AF7 X;  2YJJ A;  1B2J A;  3RAV A;  3A44 A;  2FG8 A;  3ES3 A;  4ZTT A;  1B2O A;  1BRF A;  3ISE A;  2FHA A;  5CMQ A;  3BVL A;  4CMY A;  1NF6 A;  5I4J A;  3T9J A;  1FHA A;  1R0H A;  2YJK A;  3PW8 A;  2V2L A;  1CAA A;  1IU6 A;  2UX1 A;  4ML5 A;  4CVT A;  4TOD A;  3U90 A;  2BKC A;  4CVS A;  2QL0 A;  5RXN A;  4AR6 A;  3AF8 X;  5LBH A;  2QF9 A;  3R2O A;  2RBD A;  4ETR A;  3F37 A;  1VJX A;  4AM5 A;  3KA8 A;  3Q4N A;  2PYB A;  3MPS A;  2FFX J;  2CLU A;  4PG0 A;  2GMG A;  3KA9 A;  3WVU A;  5JKM A;  4RC5 A;  1ZS3 A;  1TKO A;  3RE7 A;  2ZG8 X;  3R2M A;  1S2Z A;  4P18 A;  1RWD A;  4TOF A;  2ITB A;  4TOB A;  3VNX A;  4MN9 A;  2C41 A;  5ERK A;  2XKQ A;  3IS7 A;  4LPJ A;  3FSE A;  3UOI A;  3F39 A;  2V2R A;  3KA4 A;  4LYX A;  4DYY A;  3EGM A;  4CY9 A;  3F35 A;  1S24 A;  1B13 A;  4AR3 A;  3E1Q A;  3E1M A;  3RGD A;  5FFB A;  4DAS A;  2JD8 0;  4RC6 A;  1VCX A;  3GHQ A;  3QHC A;  1VEI A;  1NF4 A;  3KXU A;  4LQN A;  1JI4 A;  1QYB A;  3UOF A;  4YKH A;  5FFA A;  4II4 B;  3KA3 A;  4ZL6 A;  2W0O A;  2ZA6 A;  4TOG A;  5C6F A;  5J93 A;  3O7S A;  4TOE A;  3AF9 X;  1ZRP A;  5D8S A;  4E6K A;  3QD8 A;  4OYN A;  1B71 A;  3F36 A;  2WLA A;  4Y08 A;  6RXN A;  4ZKH A;  1RCI A;  4POF A;  1C09 A;  1JKU A;  5D8X A;  2M4Y A;  5JKL A;  2XJO A;  4EVD A;  4Z5S A;  4MY7 A;  2Z90 A;  3ERZ A;  2VXI A;  1JYB A;  1N1Q A;  2KKD A;  2BJY A;  5HJF A;  5AXS A;  4K9F A;  4LQV A;  3F38 A;  2XJN A;  1S30 A;  4QUW A;  4ZLW A;  5J8S A;  2OC5 A;  2FL0 A;  4PGI A;  2Z6M A;  3KYU A;  7RXN A;  3SH6 A;  2Z5P A;  1IER A;  1TJO A;  3E6S A;  1RYT A;  1UMN A;  3WVV A;  4A25 A;  2JD7 0;  1R0G A;  1OTK A;  3SHX A;  3SID A;  1LKO A;  1SOF A;  1MFR A;  2DSX A;  1H7V A;  4TOA A;  2V2J A;  1EUM A;  3WNW A;  3QZ3 A;  2X17 0;  3UNO A;  8RXN A;  4EVB A;  1IRN A;  2LCQ A;  3PVR A;  3WVW A;  3FVB A;  1JKV A;  3Q4O A;  4U3G A;  3R2K A;  3SE1 A;  2ZG7 X;  1VEQ A;  2ZA8 A;  1SMW A;  2HR5 A;  3EZ0 A;  4RC5 B;  2IU2 A;  2XJM A;  3AJO A;  4DYU A;  5FFD A;  4DE6 A;  3ISF A;  1ZUJ A;  4ISM A;  2GS4 A;  4EVE A;  3KYV A;  3A68 A;  3BKN A;  1IU5 A;  4ISP A;  1LB3 A;  3EZU A;  2FJC A;  5D8Q A;  3TA8 A;  3NP0 X;  3GE4 A;  3HIU A;  3F32 A;  4RC7 B;  5JKM G;  2VZB A;  2CHI A;  1H96 A;  2WLU A;  4PG1 A;  1JI5 A;  4RC6 B;  3OJ5 A;  5GOU A;  1L8I A;  3AK8 A;  3PVY A;  1FHH A;  1AEW A;  2VL6 A;  3IQ1 A;  2CHP A;  1GWG A;  3QB9 A;  5GU3 X;  4RC7 A;  4REU A;  3KYW A;  1HRS A;  2VXX A;  5J8W A;  5D8Y A;  5AI3 A;  4CYA A;  2Z5Q A;  3BVK A;  4ZL5 A;  3PW8 C;  5K53 A;  2V2I A;  4MKU A;  2CN6 A;  4RC8 A;  4AM4 A;  1JIG A;  4ZJK A;  3NOZ X;  5HJH A;  1BE7 A;  5D8R A;  4EVC A;  4ITT A;  2C2U A;  3KA6 A;  1JRE A;  3H7G A;  2CN7 A;  3R2H A;  2FZF A;  2V15 A;  1RB9 A;  1F33 A;  4DI0 A;  1R0F A;  1XZ1 A;  2XGW A;  4POG A;  1QGH A;  3E1P A;  3PWQ C;  1MOJ A;  5GU0 X;  1F30 A;  2KN9 A;  5CMR A;  2IY4 A;  5GN8 A;  1SMM A;  5D8O A;  3PZA A;  4KVQ A;  4TW3 A;  2MS3 A;  2BK6 A;  4RXN A;  5LG8 A;  5J9V A;  2V2P A;  5JKL G;  4DZ0 A;  5CZU A;  4XKS A;  2OH3 A;  1RCC A;  3RZ6 A;  1Z6O A;  4ZMC A;  1YUX A;  4CYB A;  4KVS A;  5FEJ A;  5FFE A;  5FFC A;  1VLG A;  3PVT B;  4YWL A;  1R0I A;  1LKM A;  5D8P A;  4PGK A;  2C2F A;  4KVR A;  1BG7 A;  1BQ8 A;  3BVF A;  4XKU A;  4TPU A;  4IWK A;  3PVR B;  2C2J A;  1YK5 A;  1R03 A;  1XZ3 A;  1KRQ A;  2F7N A;  2C6R A;  3PVT A;  1T9O A;  2CF7 A;  5JAC A;  4TO9 A;  1NNQ A;  3IS8 A;  1SQ3 A;  4CVP A;  1BFR A;  2D5K A;  3Q4Q A;  3QVD A;  1T9P A;  4AR5 A;  1S3Q A;  4ITW A;  3QHB A;  2V2N A;  3RD0 A;  3E2C A;  1YK4 A;  4Z3B A;  1RDG A;  2CLB A;  4R42 A;  5IX6 A;  1BCF A;  4XGS A;  5LS9 A; 
#chains in the Genus database with same CATH topology
 2H12 A;  1O9I A;  1LKP A;  2CEI A;  4WFN 1;  1P7P A;  3PVY B;  4MXP A;  5C4J L;  3S17 L;  3NP2 X;  2QQY A;  1RCE A;  1Z4A A;  2WTL A;  1TKP A;  3RZT A;  2ZG9 X;  1CAD A;  3E1J A;  2RDV A;  3GGY A;  1DAT A;  4CVR A;  2V0E A;  5M5X L;  3GTP L;  3MSU A;  3R2R A;  1RCG A;  4ZN3 B;  2CIH A;  1YUZ A;  3C23 A;  2JA5 L;  4YXJ A;  5IP7 L;  2FG4 A;  3S1Q L;  3JZ9 A;  4TOH A;  3PWQ A;  2IB0 A;  5DM6 1;  1UVH A;  2YW7 A;  2V2M A;  3HL1 A;  1RCD A;  3HKZ P;  1TK6 A;  3E1O A;  4XKT A;  4A3K L;  2JA7 L;  1VZH A;  3MQK B;  5K52 A;  3PW1 B;  4BY7 L;  4ERU A;  2ZUR X;  3E1L A;  1NXE A;  1LTL A;  3KYY A;  3SS2 A;  1E8J A;  4CMY V;  3P8B A;  3RBC A;  2ZA7 A;  3KDQ A;  4AM2 A;  3BT5 A;  3H9C A;  4A93 L;  2FKZ A;  3P2A A;  3FI6 A;  3PKI A;  4LPN A;  3F33 A;  5AI2 A;  3LWV B;  3PWF A;  2BW1 A;  3AJQ A;  4DYZ A;  5DM7 1;  3GVY A;  2XJU A;  5C4X L;  2PYA A;  5GU1 X;  3PW1 A;  1VEL A;  1R0J A;  5GU2 X;  2R93 L;  2G4H A;  3O7R A;  3R2S A;  4AHZ A;  3E1N A;  3F34 A;  2JD6 0;  4M34 A;  4XGH A;  3HOU L;  3E6R A;  3KX9 A;  4IWJ A;  5GN8 B;  2XJT A;  2GYQ A;  2JA6 L;  1L8H A;  1PZX A;  1SMU A;  4QIW P;  3LWR B;  1NFV A;  2PPT A;  1QCV A;  4C3I L;  1VZG A;  3GTJ L;  3OGH A;  5HU6 D;  2PVX A;  5E1U A;  3A9Q A;  2ZIX A;  4LHL A;  1BFY A;  4M35 A;  3J7Y 1;  2GYD A;  2PVE A;  1BQ9 A;  1IES A;  4WJG 4;  3FRR A;  3S15 L;  4ZKX A;  1RDV A;  4XXB B;  3UFB A;  2O5J D;  2ERS A;  1IRO A;  1DPS A;  2V2O A;  3BVE A;  3FDJ A;  4ME3 A;  1DVB A;  4LQH A;  1YV1 A;  3GTG L;  1JTS A;  4ZN1 B;  3R2L A;  1J30 A;  4DYX A;  3KYX A;  4BY1 L;  3AJP A;  4IXK A;  2Y3Q A;  4BXX L;  1JGC A;  2YW6 A;  2V3B B;  3J7Z 1;  5IY0 A;  3BVI A;  4M33 A;  1T9Q A;  1F4L A;  1O9R A;  4AR4 A;  2HTN A;  3RYG A;  5C3E L;  5ERJ A;  4X6A L;  5JVG 1;  4II4 A;  3I4N L;  4LYU A;  5E2D A;  1DX8 A;  4M32 A;  2K2D A;  4YWM A;  3WWN B;  3Q4R A;  5HQO A;  1ODH A;  2RFK B;  2AR0 A;  3AK9 A;  5LG2 A;  4ZKW A;  4MUD A;  3JR7 A;  4TOC A;  1Z6O M;  2XJV A;  1FHM A;  4LPM A;  4LQJ A;  2V2S A;  4TVM A;  5JVH 1;  4MJY A;  3KWO A;  2Z5R A;  5GAG c;  3AF7 X;  2YJJ A;  1B2J A;  2NYD A;  3RAV A;  3A44 A;  2JI1 A;  2FG8 A;  3N6O A;  3ES3 A;  4ZTT A;  1B2O A;  1BRF A;  3ISE A;  2FHA A;  4GS7 D;  5CMQ A;  3BVL A;  4CMY A;  1NF6 A;  5I4J A;  3T9J A;  1FHA A;  1R0H A;  2YJK A;  3PW8 A;  2C6A A;  2V2L A;  2PMZ P;  4AI1 A;  1CAA A;  3GTQ L;  2CWL A;  3DBY A;  1IU6 A;  2UX1 A;  3JZA B;  3LWQ B;  4ML5 A;  4CVT A;  4TOD A;  3U90 A;  2BKC A;  4CVS A;  2QL0 A;  5M5Y L;  5RXN A;  4AR6 A;  3HAX C;  3AF8 X;  5JDO B;  5LBH A;  2QF9 A;  1RYQ A;  4W4K B;  1VZI A;  4A3L L;  3R2O A;  2RBD A;  4AYB P;  4ETR A;  3F37 A;  1VJX A;  4AM5 A;  3KA8 A;  3Q4N A;  2PYB A;  1PFW A;  3MPS A;  2FFX J;  1I6H L;  2CLU A;  3PIP 1;  1TWG L;  4PG0 A;  3GTL L;  4YXM A;  2GMG A;  4JAD A;  3C21 A;  3KA9 A;  3WVU A;  5JKM A;  3GTO L;  3LKD A;  4RC5 A;  5JDO A;  2HVY C;  4AHW A;  1ZS3 A;  1TKO A;  3RE7 A;  2ZG8 X;  3K7A L;  3R2M A;  1S2Z A;  4P18 A;  1RWD A;  4TOF A;  2ITB A;  3C1Z A;  3L0M A;  4TOB A;  5M3M L;  3VNX A;  4MN9 A;  4BBR L;  2C41 A;  2XJR A;  3I4M L;  5FJ8 L;  5ERK A;  2Z3R B;  4C2M 1;  2XKQ A;  3IS7 A;  1Z92 B;  3FSE A;  4LPJ A;  3UOI A;  3F39 A;  2V2R A;  3C1Y A;  3KA4 A;  4LYX A;  3S1R L;  4DYY A;  3EGM A;  4A3J L;  4X0J A;  4CY9 A;  4JAG A;  3F35 A;  1S24 A;  1B13 A;  3LPE B;  4AR3 A;  2E2H L;  4A3M L;  3E1Q A;  3E1M A;  3RGD A;  5FFB A;  4DAS A;  2JD8 0;  4RC6 A;  4A3D L;  5EIO C;  1VCX A;  5IYB L;  2YU9 L;  2M6O A;  3GHQ A;  5EIN C;  3IU3 I;  3QHC A;  5IYC L;  1VEI A;  1NF4 A;  2WWX B;  3KXU A;  4LQN A;  5C44 L;  1JI4 A;  1QYB A;  3UOF A;  4YKH A;  3S1N L;  3GTK L;  2NVT L;  5FFA A;  4II4 B;  2Y44 A;  3KA3 A;  4ZL6 A;  2W0O A;  2ZA6 A;  4TOG A;  5C6F A;  5J93 A;  4LHN A;  3O7S A;  2WAQ P;  4TOE A;  3AF9 X;  3B0A B;  5FLM L;  3PKJ A;  1ZRP A;  2M6P A;  5D8S A;  4C3J L;  1IW7 D;  4E6K A;  3QD8 A;  4OYN A;  4JAE A;  1B71 A;  3F36 A;  2WLA A;  5GAH c;  4Y08 A;  1TWA L;  6RXN A;  4ZKH A;  1OWB A;  1RCI A;  4POF A;  1C09 A;  1JKU A;  2WB1 P;  5D8X A;  2M4Y A;  3PO3 L;  5JKL A;  2XJO A;  4U67 1;  3HOW L;  4EVD A;  2Y0S P;  4Z5S A;  3V3K B;  2E2I L;  4MY7 A;  2Z90 A;  3ERZ A;  2VXI A;  1JYB A;  1N1Q A;  2KKD A;  2BJY A;  4E40 A;  2J9U B;  5HJF A;  3QQC E;  5AXS A;  4K9F A;  4LQV A;  1I3Q L;  3H97 A;  3F38 A;  2XJN A;  1S30 A;  1NXG A;  4UY8 1;  4QUW A;  4ZLW A;  3GTM L;  5J8S A;  2OC5 A;  2FL0 A;  4PGI A;  2VUM L;  2Z6M A;  3KYU A;  7RXN A;  3SH6 A;  5IP9 L;  4JAF A;  4A3G L;  2Z5P A;  5H1S c;  1IER A;  3HOX L;  1TJO A;  3E6S A;  2CKA A;  3WWL A;  1RYT A;  1TWF L;  1UMN A;  3WVV A;  4A25 A;  2JD7 0;  1WCM L;  1WJV A;  1R0G A;  1OTK A;  3SHX A;  3SID A;  1PFY A;  1LKO A;  1SOF A;  1MFR A;  2DSX A;  1H7V A;  2A68 D;  4TOA A;  2V2J A;  1EUM A;  3WNW A;  3HJY B;  5MFZ A;  3QZ3 A;  3K35 A;  2X17 0;  3UNO A;  8RXN A;  4EVB A;  1IRN A;  2LCQ A;  3PVR A;  4A3I L;  3WVW A;  1PFV A;  3FVB A;  1JKV A;  3Q4O A;  4U3G A;  4B8C D;  2E2J L;  3R2K A;  3S1M L;  3SE1 A;  2ZG7 X;  1VEQ A;  1Y1W L;  2ZA8 A;  1SMW A;  2HR5 A;  3EZ0 A;  3M4O L;  4RC5 B;  5AN9 H;  2IU2 A;  2XJM A;  4AI0 A;  3LNL A;  3AJO A;  4DYU A;  5FFD A;  4DE6 A;  3ISF A;  1ZUJ A;  4ISM A;  4A3E L;  2PSM C;  2GS4 A;  4EVE A;  3KYV A;  5IYD L;  3A68 A;  3BKN A;  1IU5 A;  4ISP A;  1LB3 A;  3EZU A;  5MGN A;  2FJC A;  2NVY L;  5D8Q A;  3TA8 A;  3NP0 X;  3GE4 A;  3HIU A;  3CQZ L;  3F32 A;  4RC7 B;  5JKM G;  2L0Z A;  2VZB A;  2CHI A;  5GAD c;  1H96 A;  2WLU A;  3B08 B;  5M3F L;  4PG1 A;  1JI5 A;  4RC6 B;  3PIO 1;  3FKI L;  3OJ5 A;  3M3Y L;  5GOU A;  1L8I A;  3AK8 A;  2MGY A;  3PVY A;  1TWH L;  3H0G L;  1FHH A;  2EY4 E;  1AEW A;  2C6B A;  2APO B;  3GGZ A;  3NFP I;  5MLC 3;  4A3B L;  1K83 L;  2VL6 A;  3PL5 A;  2A6E D;  3IQ1 A;  2CHP A;  2CR8 A;  2AUS B;  1GWG A;  3QB9 A;  5GU3 X;  4RC7 A;  4REU A;  3KYW A;  1HRS A;  5M5W L;  3H3V M;  5MFP A;  2VXX A;  5J8W A;  5D8Y A;  5AI3 A;  4CYA A;  4AHY A;  2Z5Q A;  3BVK A;  4ZL5 A;  1PFU A;  3PW8 C;  5K53 A;  2V2I A;  4MKU A;  2CN6 A;  4RC8 A;  4AM4 A;  1R9T L;  1JIG A;  2N02 A;  3NOZ X;  4ZJK A;  5HJH A;  4KXR B;  1BE7 A;  4E6Y A;  5D8R A;  2CKC A;  5MF6 A;  4EVC A;  3VPB E;  2OKC A;  4ITT A;  2C2U A;  3KA6 A;  1JRE A;  3H7G A;  5GAE c;  2CN7 A;  3R2H A;  2FZF A;  2BE5 D;  4AHX A;  4A3F L;  3S16 L;  4A3C L;  2V15 A;  1RB9 A;  1F33 A;  4DI0 A;  1R0F A;  1XZ1 A;  4C3H L;  4Y52 L;  2XGW A;  4POG A;  1QGH A;  3HOV L;  3RZO L;  3FRS A;  2AQC A;  3E1P A;  3PWQ C;  2NVQ L;  1MOJ A;  5GU0 X;  1F30 A;  3D19 A;  5CMR A;  2IY4 A;  2ERJ A;  2KN9 A;  5GN8 A;  4V19 6;  1SMM A;  2B63 L;  5D8O A;  3PZA A;  5K2M E;  4KVQ A;  4TW3 A;  2MS3 A;  2BK6 A;  4RXN A;  4AI3 A;  5LG8 A;  4BBS L;  4W4L B;  1SFO L;  5J9V A;  2V2P A;  5JKL G;  4AI2 A;  4DZ0 A;  3ZG6 A;  5CZU A;  4XKS A;  2OH3 A;  2V0F A;  2JI2 A;  1RCC A;  3VVA A;  3RZ6 A;  1Z6O A;  2V8T A;  4ZMC A;  1YUX A;  3VV9 A;  1Y1V L;  4CYB A;  4KVS A;  5FEJ A;  5FFE A;  5FFC A;  1VLG A;  1I50 L;  3HOY L;  3PVT B;  4YWL A;  1R0I A;  1LKM A;  5D8P A;  3HJW B;  2G38 B;  2AYJ A;  3S2D L;  4Y7N L;  3RZD L;  4PGK A;  2C2F A;  4KVR A;  1BG7 A;  1BQ8 A;  2A6H D;  3LWO B;  3BVF A;  3S2H L;  2B5I D;  4XKU A;  3H99 A;  2JI3 A;  4IWK A;  4TPU A;  2XJP A;  3PVR B;  2C2J A;  2JA8 L;  1YK5 A;  1R03 A;  3M6J A;  1XZ3 A;  1KRQ A;  2F7N A;  3S14 L;  2V8U A;  2C6R A;  3KHK A;  3PVT A;  1T9O A;  2CF7 A;  5JAC A;  4TO9 A;  2NVX L;  1NNQ A;  3IS8 A;  4YVZ A;  2Z3Q B;  2R92 L;  2R7Z L;  1SQ3 A;  4CVP A;  1BFR A;  3W54 A;  2D5K A;  3Q4Q A;  3QVD A;  3PO2 L;  2A69 D;  1T9P A;  4G6B A;  1OWC A;  2XJQ A;  4AR5 A;  1QQT A;  1S3Q A;  2M4V A;  4ITW A;  3H9B A;  3LWP B;  3QHB A;  2V2N A;  3RD0 A;  3E2C A;  1YK4 A;  4Z3B A;  3HOZ L;  2XJS A;  1RDG A;  2CLB A;  1TWC L;  4R42 A;  5IX6 A;  1BCF A;  4XGS A;  5LS9 A; 
#chains in the Genus database with same CATH homology
 2H12 A;  1O9I A;  1LKP A;  2CEI A;  4WFN 1;  3PVY B;  4MXP A;  3NP2 X;  2QQY A;  1RCE A;  1Z4A A;  2WTL A;  1TKP A;  3RZT A;  2ZG9 X;  1CAD A;  3E1J A;  2RDV A;  3GGY A;  1DAT A;  4CVR A;  2V0E A;  3MSU A;  3R2R A;  1RCG A;  4ZN3 B;  2CIH A;  1YUZ A;  3C23 A;  4YXJ A;  2FG4 A;  3JZ9 A;  4TOH A;  3PWQ A;  2IB0 A;  5DM6 1;  1UVH A;  2YW7 A;  2V2M A;  3HL1 A;  1RCD A;  1TK6 A;  3E1O A;  4XKT A;  1VZH A;  5K52 A;  3PW1 B;  4ERU A;  2ZUR X;  3E1L A;  1NXE A;  1LTL A;  3KYY A;  3SS2 A;  1E8J A;  4CMY V;  3P8B A;  3RBC A;  2ZA7 A;  3KDQ A;  4AM2 A;  3BT5 A;  2FKZ A;  3P2A A;  3FI6 A;  3PKI A;  4LPN A;  3F33 A;  5AI2 A;  3PWF A;  2BW1 A;  3AJQ A;  4DYZ A;  5DM7 1;  3GVY A;  2XJU A;  2PYA A;  5GU1 X;  3PW1 A;  1VEL A;  1R0J A;  5GU2 X;  2G4H A;  3O7R A;  3R2S A;  4AHZ A;  3E1N A;  3F34 A;  2JD6 0;  4M34 A;  4XGH A;  3E6R A;  3KX9 A;  4IWJ A;  5GN8 B;  2XJT A;  2GYQ A;  1L8H A;  1SMU A;  1NFV A;  2PPT A;  1QCV A;  1VZG A;  3OGH A;  5HU6 D;  2PVX A;  5E1U A;  3A9Q A;  2ZIX A;  4LHL A;  1BFY A;  4M35 A;  3J7Y 1;  2GYD A;  2PVE A;  1BQ9 A;  1IES A;  4WJG 4;  3FRR A;  4ZKX A;  1RDV A;  4XXB B;  3UFB A;  2O5J D;  2ERS A;  1IRO A;  1DPS A;  2V2O A;  3BVE A;  4ME3 A;  1DVB A;  4LQH A;  1YV1 A;  1JTS A;  4ZN1 B;  3R2L A;  1J30 A;  4DYX A;  3KYX A;  3AJP A;  4IXK A;  2Y3Q A;  1JGC A;  2YW6 A;  2V3B B;  3J7Z 1;  5IY0 A;  3BVI A;  4M33 A;  1T9Q A;  1O9R A;  4AR4 A;  2HTN A;  3RYG A;  5ERJ A;  5JVG 1;  4II4 A;  4LYU A;  5E2D A;  1DX8 A;  4M32 A;  2K2D A;  4YWM A;  3WWN B;  3Q4R A;  5HQO A;  1ODH A;  2AR0 A;  3AK9 A;  5LG2 A;  4ZKW A;  4MUD A;  4TOC A;  1Z6O M;  2XJV A;  1FHM A;  4LPM A;  4LQJ A;  2V2S A;  4TVM A;  5JVH 1;  4MJY A;  3KWO A;  2Z5R A;  5GAG c;  3AF7 X;  2YJJ A;  1B2J A;  2NYD A;  3RAV A;  3A44 A;  2JI1 A;  2FG8 A;  3N6O A;  3ES3 A;  4ZTT A;  1B2O A;  1BRF A;  3ISE A;  2FHA A;  4GS7 D;  5CMQ A;  3BVL A;  4CMY A;  1NF6 A;  5I4J A;  3T9J A;  1FHA A;  1R0H A;  2YJK A;  3PW8 A;  2C6A A;  2V2L A;  4AI1 A;  1CAA A;  2CWL A;  3DBY A;  1IU6 A;  2UX1 A;  3JZA B;  4ML5 A;  4CVT A;  4TOD A;  3U90 A;  2BKC A;  4CVS A;  2QL0 A;  5RXN A;  4AR6 A;  3AF8 X;  5JDO B;  5LBH A;  2QF9 A;  1RYQ A;  4W4K B;  1VZI A;  3R2O A;  2RBD A;  4ETR A;  3F37 A;  1VJX A;  4AM5 A;  3KA8 A;  3Q4N A;  2PYB A;  3MPS A;  2FFX J;  2CLU A;  3PIP 1;  4PG0 A;  4YXM A;  2GMG A;  4JAD A;  3C21 A;  3KA9 A;  3WVU A;  5JKM A;  3LKD A;  4RC5 A;  5JDO A;  4AHW A;  1ZS3 A;  1TKO A;  3RE7 A;  2ZG8 X;  3R2M A;  1S2Z A;  4P18 A;  1RWD A;  4TOF A;  2ITB A;  3C1Z A;  3L0M A;  4TOB A;  3VNX A;  4MN9 A;  2C41 A;  2XJR A;  5ERK A;  2Z3R B;  2XKQ A;  3IS7 A;  1Z92 B;  3FSE A;  4LPJ A;  3UOI A;  3F39 A;  2V2R A;  3C1Y A;  3KA4 A;  4LYX A;  4DYY A;  3EGM A;  4X0J A;  4CY9 A;  4JAG A;  3F35 A;  1S24 A;  1B13 A;  3LPE B;  4AR3 A;  3E1Q A;  3E1M A;  3RGD A;  5FFB A;  4DAS A;  2JD8 0;  4RC6 A;  5EIO C;  1VCX A;  2M6O A;  3GHQ A;  5EIN C;  3IU3 I;  3QHC A;  1VEI A;  1NF4 A;  2WWX B;  3KXU A;  4LQN A;  1JI4 A;  1QYB A;  3UOF A;  4YKH A;  5FFA A;  4II4 B;  2Y44 A;  3KA3 A;  4ZL6 A;  2W0O A;  2ZA6 A;  4TOG A;  5C6F A;  5J93 A;  4LHN A;  3O7S A;  4TOE A;  3AF9 X;  3B0A B;  3PKJ A;  1ZRP A;  2M6P A;  5D8S A;  1IW7 D;  4E6K A;  3QD8 A;  4OYN A;  4JAE A;  1B71 A;  3F36 A;  2WLA A;  5GAH c;  4Y08 A;  6RXN A;  4ZKH A;  1OWB A;  1RCI A;  4POF A;  1C09 A;  1JKU A;  5D8X A;  2M4Y A;  5JKL A;  2XJO A;  4U67 1;  4EVD A;  4Z5S A;  3V3K B;  4MY7 A;  2Z90 A;  3ERZ A;  2VXI A;  1JYB A;  1N1Q A;  2KKD A;  2BJY A;  4E40 A;  2J9U B;  5HJF A;  3QQC E;  5AXS A;  4K9F A;  4LQV A;  3F38 A;  2XJN A;  1S30 A;  1NXG A;  4UY8 1;  4QUW A;  4ZLW A;  5J8S A;  2OC5 A;  2FL0 A;  4PGI A;  2Z6M A;  3KYU A;  7RXN A;  3SH6 A;  4JAF A;  2Z5P A;  5H1S c;  1IER A;  1TJO A;  3E6S A;  2CKA A;  3WWL A;  1RYT A;  1UMN A;  3WVV A;  4A25 A;  2JD7 0;  1WJV A;  1R0G A;  1OTK A;  3SHX A;  3SID A;  1LKO A;  1SOF A;  1MFR A;  2DSX A;  1H7V A;  2A68 D;  4TOA A;  2V2J A;  1EUM A;  3WNW A;  5MFZ A;  3QZ3 A;  3K35 A;  2X17 0;  3UNO A;  8RXN A;  4EVB A;  1IRN A;  2LCQ A;  3PVR A;  3WVW A;  3FVB A;  1JKV A;  3Q4O A;  4U3G A;  4B8C D;  3R2K A;  3SE1 A;  2ZG7 X;  1VEQ A;  2ZA8 A;  1SMW A;  2HR5 A;  3EZ0 A;  4RC5 B;  5AN9 H;  2IU2 A;  2XJM A;  4AI0 A;  3LNL A;  3AJO A;  4DYU A;  5FFD A;  4DE6 A;  3ISF A;  1ZUJ A;  4ISM A;  2PSM C;  2GS4 A;  4EVE A;  3KYV A;  3A68 A;  3BKN A;  1IU5 A;  4ISP A;  1LB3 A;  3EZU A;  5MGN A;  2FJC A;  5D8Q A;  3TA8 A;  3NP0 X;  3GE4 A;  3HIU A;  3F32 A;  4RC7 B;  5JKM G;  2L0Z A;  2VZB A;  2CHI A;  5GAD c;  1H96 A;  2WLU A;  3B08 B;  4PG1 A;  1JI5 A;  4RC6 B;  3PIO 1;  3OJ5 A;  5GOU A;  1L8I A;  3AK8 A;  2MGY A;  3PVY A;  1FHH A;  1AEW A;  2C6B A;  3GGZ A;  3NFP I;  5MLC 3;  2VL6 A;  2A6E D;  3IQ1 A;  2CHP A;  2CR8 A;  1GWG A;  3QB9 A;  5GU3 X;  4RC7 A;  4REU A;  3KYW A;  1HRS A;  5MFP A;  2VXX A;  5J8W A;  5D8Y A;  5AI3 A;  4CYA A;  4AHY A;  2Z5Q A;  3BVK A;  4ZL5 A;  3PW8 C;  5K53 A;  2V2I A;  4MKU A;  2CN6 A;  4RC8 A;  4AM4 A;  1JIG A;  2N02 A;  3NOZ X;  4ZJK A;  5HJH A;  4KXR B;  1BE7 A;  4E6Y A;  5D8R A;  2CKC A;  5MF6 A;  4EVC A;  3VPB E;  2OKC A;  4ITT A;  2C2U A;  3KA6 A;  1JRE A;  3H7G A;  5GAE c;  2CN7 A;  3R2H A;  2FZF A;  2BE5 D;  4AHX A;  2V15 A;  1RB9 A;  1F33 A;  4DI0 A;  1R0F A;  1XZ1 A;  2XGW A;  4POG A;  1QGH A;  3FRS A;  3E1P A;  3PWQ C;  1MOJ A;  5GU0 X;  1F30 A;  3D19 A;  5CMR A;  2IY4 A;  2ERJ A;  2KN9 A;  5GN8 A;  4V19 6;  1SMM A;  5D8O A;  3PZA A;  5K2M E;  4KVQ A;  4TW3 A;  2MS3 A;  2BK6 A;  4RXN A;  4AI3 A;  5LG8 A;  4W4L B;  5J9V A;  2V2P A;  5JKL G;  4AI2 A;  4DZ0 A;  3ZG6 A;  5CZU A;  4XKS A;  2OH3 A;  2V0F A;  2JI2 A;  1RCC A;  3VVA A;  3RZ6 A;  1Z6O A;  2V8T A;  4ZMC A;  1YUX A;  3VV9 A;  4CYB A;  4KVS A;  5FEJ A;  5FFE A;  5FFC A;  1VLG A;  3PVT B;  4YWL A;  1R0I A;  1LKM A;  5D8P A;  2G38 B;  2AYJ A;  4PGK A;  2C2F A;  4KVR A;  1BG7 A;  1BQ8 A;  2A6H D;  3BVF A;  2B5I D;  4XKU A;  4TPU A;  2JI3 A;  4IWK A;  2XJP A;  3PVR B;  2C2J A;  1YK5 A;  1R03 A;  3M6J A;  1XZ3 A;  1KRQ A;  2F7N A;  2V8U A;  2C6R A;  3KHK A;  3PVT A;  1T9O A;  2CF7 A;  5JAC A;  4TO9 A;  1NNQ A;  3IS8 A;  4YVZ A;  2Z3Q B;  1SQ3 A;  4CVP A;  1BFR A;  3W54 A;  2D5K A;  3Q4Q A;  3QVD A;  2A69 D;  1T9P A;  4G6B A;  1OWC A;  2XJQ A;  4AR5 A;  1S3Q A;  2M4V A;  4ITW A;  3QHB A;  2V2N A;  3RD0 A;  3E2C A;  1YK4 A;  4Z3B A;  2XJS A;  1RDG A;  2CLB A;  4R42 A;  5IX6 A;  1BCF A;  4XGS A;  5LS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...