1YUXA

Mixed valant state of nigerythrin
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
202
structure length
200
Chain Sequence
b'MKVRAQVPTVKNATNFNMVADSKTSVGSTLENLKAAIAGETGAHAKYTAFAKAAREQGYEQIARLFEATAAAELIHIGLEYALVAEMEPGYEKPTVPSAYSCDLNLISGANGEIYETSDMYPAFIRKAQEEGNSKAVHVFTRAKLAESVHAERYLAAYNDIDAPDDDKFHLCPICGYIHKGEDFEKCPICFRPKDTFTAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nigerythrin
publication title High-resolution crystal structures of Desulfovibrio vulgaris (Hildenborough) nigerythrin: facile, redox-dependent iron movement, domain interface variability, and peroxidase activity in the rubrerythrins.
pubmed doi rcsb
source organism Desulfovibrio vulgaris subsp. vulgaris
molecule tags Oxidoreductase
total genus 71
structure length 200
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02915 Rubrerythrin Rubrerythrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1yuxA01
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1yuxA02
3FSEA 3ISEA 4ITWA 1MOJA 4RC6B 3QHCA 1BQ8A 4ISMA 2BW1A 1YV1A 4LPNA 3QHBA 4ERUA 4QUWA 1T9OA 1IU5A 5J8WA 2FZFA 1IROA 1RCDA 4RC6A 2OC5A 3OGHA 2KN9A 5FFBA 4DYZA 1RB9A 1BFRA 3U90A 3ERZA 4LQJA 3SS2A 2FHAA 4RXNA 3PW8A 1SMMA 3BT5A 5GU0X 4RC8A 4Z5SA 1LKOA 2GS4A 1BFYA 1LKPA 1QGHA 2FKZA 2KKDA 3Q4OA 3E1OA 3RZTA 5GN8B 3HL1A 2CIHA 3GHQA 3PZAA 3KA4A 3BVKA 4ZL6A 5IY0A 4POGA 1VEQA 5CZUA 1JKUA 2DSXA 3VNXA 3WVUA 3E1JA 8RXNA 2Z5QA 2ZA6A 3PVRB 1H7VA 5J93A 1SMUA 2CN6A 2V2PA 1YUZA 5D8RA 3PVTB 2IB0A 1KRQA 1BRFA 3KA9A 3R2HA 2PYBA 5GN8A 3A44A 5D8PA 5HQOA 3AJQA 1JKVA 4ZKXA 2GYQA 4MN9A 5FFDA 3BVEA 5HJHA 4RC5A 3ISFA 2V2OA 5D8XA 2BJYA 3R2MA 5J9VA 2VZBA 2WLAA 3E1NA 2V2NA 1VJXA 3UOFA 5K52A 5GU2X 1VLGA 2PYAA 5FFAA 3F32A 3R2SA 3KYYA 3RAVA 4KVSA 4PGKA 3KA8A 3EZ0A 3PWFA 1MFRA 1B2JA 4PGIA 3F39A 3AK9A 2QQYA 4DI0A 2FFXJ 1R0FA 1QYBA 4PG0A 4CMYA 2V3BB 4CVSA 2FJCA 2YJJA 4YWLA 1SQ3A 5JKLA 4TW3A 1CAAA 5LG8A 4YKHA 1DATA 4LYUA 4AM2A 5JKMA 2QL0A 4REUA 5E2DA 2V2RA 4R42A 4RC7B 1L8HA 2ZURX 3GE4A 1S3QA 4II4A 1TKOA 4ME3A 3BVIA 4DYUA 1UMNA 3PW1B 1N1QA 1DPSA 2K2DA 1Z4AA 1F33A 2HTNA 3HIUA 3SIDA 4CVTA 2ZA7A 7RXNA 5D8QA 4LQNA 2ZG8X 3F35A 5ERKA 1OTKA 1TK6A 5ERJA 2G4HA 1C09A 4RC7A 3QB9A 2V2SA 4ZKHA 1T9PA 4POFA 3ES3A 2PVXA 3PW1A 3SH6A 1JGCA 3T9JA 3WNWA 1E8JA 2Z5PA 2D5KA 3FVBA 3KYUA 1Z6OA 2XJMA 4M33A 4ZKWA 1FHHA 2CHIA 2XJNA 2CLUA 3QZ3A 2GYDA 1B71A 2FG4A 3BVLA 1LKMA 2JD60 4TOFA 4MUDA 2RDVA 5E1UA 1RCEA 2WLUA 1NFVA 5AXSA 2HR5A 2Z90A 2C2FA 3KA3A 4M32A 1JREA 4XGSA 2Z5RA 1S30A 3RBCA 5C6FA 4EVCA 4CMYV 4IWKA 2IY4A 4TO9A 2CLBA 3SHXA 3BKNA 3PVYB 3QD8A 2XGWA 3EZUA 4LPJA 1TKPA 1HRSA 2FL0A 2BK6A 3KYXA 2YJKA 5FFCA 5LG2A 1IRNA 3NP0X 2YW7A 2JD80 1LTLA 4LQVA 3PWQC 5JACA 2Z6MA 4A25A 4DE6A 2ZG9X 2Y3QA 4U3GA 4DZ0A 1VCXA 3PVYA 3PVRA 4TOAA 1J30A 3PVTA 5IX6A 2LCQA 4ZJKA 3KYVA 1JI5A 1SOFA 4LYXA 2W0OA 1F30A 1RWDA 5AI2A 1RYTA 3E2CA 3EGMA 4P18A 2ZG7X 5D8SA 5LBHA 2X170 1YK4A 3F37A 2V2MA 1Z6OM 3FI6A 2M4YA 4MY7A 1LB3A 1QCVA 1ZUJA 1IU6A 3E6SA 4TODA 1DX8A 4XKTA 3Q4RA 3WVVA 3F33A 5FEJA 6RXNA 3R2LA 1CADA 3AK8A 4AR4A 1R03A 3RE7A 3BVFA 3KXUA 2FG8A 1S2ZA 1VEIA 4ITTA 2RBDA 5HJFA 2ITBA 4EVEA 2CHPA 1NF4A 4LPMA 4ETRA 1T9QA 2YW6A 5K53A 4TOHA 4CYAA 1H96A 1NF6A 3SE1A 4KVQA 2CF7A 3WVWA 3F36A 3E1QA 2XJOA 2IU2A 2BKCA 3MPSA 5J8SA 1L8IA 3E1LA 4Y08A 2MS3A 4M34A 2CN7A 4ZMCA 2V2IA 1XZ1A 4IWJA 1ZS3A 3NOZX 3UNOA 3TA8A 3PW8C 3AF9X 1R0HA 3Q4QA 3H7GA 3IS8A 3O7RA 1JYBA 4TOEA 4ML5A 4MKUA 5FFEA 1BE7A 4TOCA 2WTLA 1JTSA 1VELA 2ZA8A 5LS9A 3OJ5A 4E6KA 3NP2X 5GU3X 1O9RA 3AF8X 4CVRA 3E1MA 5GOUA 5CMQA 1BCFA 1BG7A 2V2LA 4DYXA 4ZL5A 4XKSA 1R0IA 2GMGA 2C6RA 4DASA 1DVBA 1RCGA 1ZRPA 1RDVA 4KVRA 3KX9A 4EVDA 3A68A 2OH3A 3KYWA 2QF9A 1O9IA 2UX1A 1XZ3A 5RXNA 3RYGA 4PG1A 4AR3A 3R2OA 5D8YA 5I4JA 1B2OA 4AR5A 1IERA 1UVHA 4TPUA 4CYBA 4CVPA 4K9FA 4RC5B 3Q4NA 4MJYA 2JD70 4ISPA 5CMRA 1JI4A 2VXXA 1JIGA 2C41A 3E1PA 3KWOA 4TOGA 4XKUA 2PVEA 1R0GA 3RGDA 1TJOA 4CY9A 3R2RA 3PWQA 1YK5A 5GU1X 2C2JA 1AEWA 1RCIA 3KA6A 3IQ1A 5D8OA 2VXIA 1GWGA 4YWMA 1YUXA 2C2UA 2V2JA 1BQ9A 4M35A 1SMWA 1RDGA 4LQHA 4ZLWA 2XKQA 4EVBA 3QVDA 3GVYA 3AJPA 1RCCA 4OYNA 1FHAA 3R2KA 4ZTTA 1FHMA 3UOIA 1IESA 5JKLG 1R0JA 4Z3BA 3AJOA 3E6RA 3F38A 4IXKA 2F7NA 4DYYA 1B13A 5JKMG 2VL6A 4AR6A 1EUMA 3RD0A 4II4B 3IS7A 3F34A 1NNQA 2V15A 4AM5A 3A9QA 5AI3A 3RZ6A 2CEIA 3AF7X 1S24A 3O7SA 4AM4A 4TOBA
chains in the Genus database with same CATH superfamily
3FSEA 3ISEA 4ITWA 1MOJA 3GTGL 3S1NL 4RC6B 3QHCA 1BQ8A 2Z3QB 2PPTA 4ISMA 2BW1A 1YV1A 3GTKL 3MSUA 4LPNA 3QHBA 4ERUA 4QUWA 5DM71 2M6OA 1T9OA 2CR8A 1IU5A 4A3KL 3J7Z1 5J8WA 2FZFA 3VV9A 3RZOL 3HOUL 4A3LL 2PSMC 1IROA 1OWCA 2H12A 1RCDA 5C4JL 4RC6A 2OC5A 3OGHA 2KN9A 1QQTA 3LWPB 5FFBA 3LWVB 5M3FL 3GTML 4G6BA 4DYZA 2NYDA 2M6PA 1RB9A 2PMZP 2E2HL 1BFRA 3U90A 3ERZA 4LQJA 3SS2A 2FHAA 5IYDL 3J7Y1 2R7ZL 4RXNA 3PW8A 1SMMA 3BT5A 5GU0X 1Y1VL 4RC8A 3C21A 4Z5SA 5JDOB 1LKOA 3PIO1 2GS4A 1BFYA 1LKPA 5GADc 1QGHA 3H0GL 2FKZA 2KKDA 3H3VM 3Q4OA 3E1OA 3RZTA 5GN8B 3HL1A 2CIHA 3FRSA 3S14L 3GHQA 3PZAA 3KA4A 3BVKA 4ZL6A 5IY0A 4POGA 2AUSB 3PIP1 4W4LB 1VEQA 5CZUA 3PKJA 3DBYA 1JKUA 2DSXA 3VNXA 3WVUA 3E1JA 8RXNA 3HOYL 2Z5QA 5JVG1 4A3CL 2ZA6A 5M5YL 3PVRB 1H7VA 5J93A 1SMUA 2CN6A 4V196 2V2PA 1YUZA 5D8RA 3PVTB 2IB0A 2L0ZA 1ODHA 3HOVL 1KRQA 1TWCL 4AI1A 1BRFA 3KA9A 4JAEA 4AHWA 3R2HA 2PYBA 5GN8A 3A44A 3HOWL 4Y52L 5D8PA 5HQOA 3AJQA 1JKVA 4ZKXA 4X6AL 2GYQA 4MN9A 5FFDA 1F4LA 3BVEA 4E6YA 2V0FA 5HJHA 4RC5A 3ISFA 3S2HL 5MGNA 2CKAA 2V2OA 3GTJL 3S1ML 5D8XA 2BJYA 2Z3RB 3R2MA 5J9VA 2VZBA 2MGYA 2WLAA 4WJG4 3E1NA 2V2NA 4ZN1B 3LKDA 1VJXA 5MF6A 2CWLA 3UOFA 3ZG6A 5K52A 5GU2X 1VLGA 2PYAA 5FFAA 3HAXC 3F32A 5FLML 2EY4E 3R2SA 3KYYA 3RAVA 5GAEc 4KVSA 2NVQL 4PGKA 4C3IL 3KA8A 2J9UB 3PKIA 3EZ0A 3S15L 3PWFA 5C3EL 1VZIA 1MFRA 1B2JA 3PO2L 4PGIA 3F39A 3AK9A 3C23A 5C44L 2QQYA 4DI0A 2FFXJ 1R0FA 1QYBA 4PG0A 4CMYA 2V3BB 4CVSA 2FJCA 4BY7L 1R9TL 5MFPA 2R92L 2YJJA 4YWLA 1SQ3A 2JI2A 5JKLA 4TW3A 1CAAA 5LG8A 4YKHA 1DATA 4TVMA 3S16L 4LYUA 4AM2A 5JKMA 2QL0A 3LWQB 4REUA 5E2DA 2V2RA 2O5JD 4R42A 4RC7B 3LPEB 1L8HA 2ZURX 3GE4A 3M6JA 1S3QA 3MQKB 4II4A 1TKOA 4ME3A 3FKIL 3NFPI 3LWRB 3BVIA 3K35A 4DYUA 1UMNA 3PW1B 1N1QA 1DPSA 2ERJA 2K2DA 2JA6L 1Z4AA 1F33A 2VUML 2HTNA 3HIUA 3SIDA 4CVTA 2ZA7A 7RXNA 5D8QA 4LQNA 4YXJA 2ZG8X 3F35A 5ERKA 1OTKA 5C4XL 1TK6A 1P7PA 5ERJA 3FDJA 2G4HA 1C09A 1WJVA 4RC7A 2V8TA 3QB9A 4LHLA 4WFN1 2V2SA 4ZKHA 4C3HL 1T9PA 4POFA 5FJ8L 2C6AA 3GTPL 3QQCE 3ES3A 2PVXA 3UFBA 4A3GL 3PW1A 3SH6A 1JGCA 2JI3A 2XJQA 3T9JA 3WNWA 1E8JA 2Z5PA 3S1RL 4UY81 2D5KA 3FVBA 3KYUA 1Z6OA 2XJVA 3HOZL 2XJMA 4M33A 4ZKWA 2JA8L 2M4VA 2ZIXA 2WAQP 1FHHA 4QIWP 2CHIA 2XJNA 2CLUA 3QZ3A 2GYDA 1B71A 2FG4A 3BVLA 1LKMA 2JD60 4TOFA 4MUDA 2RDVA 5E1UA 1RCEA 2WLUA 1NFVA 5AXSA 1NXGA 2HR5A 2Z90A 2C2FA 3KA3A 3HKZP 4M32A 1JREA 4XGSA 2Z5RA 1Z92B 1TWHL 1S30A 3RBCA 5C6FA 4EVCA 3JZAB 4CMYV 4IWKA 5HU6D 3B0AB 2IY4A 4TO9A 2CLBA 3GGYA 3SHXA 3BKNA 3PVYB 2AQCA 3QD8A 2A6ED 2XGWA 5JDOA 2XJUA 3EZUA 4BY1L 4LPJA 4C2M1 1NXEA 1TKPA 1HRSA 2FL0A 2BK6A 4W4KB 2XJRA 3KYXA 2YJKA 5FFCA 3N6OA 4X0JA 5LG2A 1IRNA 3NP0X 2AR0A 2YW7A 2JD80 1LTLA 4LQVA 4JAGA 3PWQC 2C6BA 5JACA 3RZDL 2Z6MA 4A25A 4DE6A 2ZG9X 2Y3QA 4U3GA 4DZ0A 1VCXA 5JVH1 3PVYA 3PVRA 4TOAA 1J30A 4Y7NL 3PVTA 5IX6A 2LCQA 3S2DL 4ZJKA 3KYVA 4AHYA 1JI5A 1SOFA 4B8CD 2APOB 2BE5D 2NVTL 4LYXA 2W0OA 1F30A 3WWNB 1RWDA 5AI2A 1RYTA 4A93L 3E2CA 3M3YL 3EGMA 3C1ZA 4P18A 2ZG7X 5D8SA 5LBHA 2X170 1PZXA 3H9CA 1YK4A 3F37A 2V2MA 1Z6OM 3FI6A 3GTLL 2M4YA 4MY7A 1PFUA 2XJSA 1LB3A 1QCVA 3H9BA 1ZUJA 3KHKA 1TWFL 1IU6A 3E6SA 4TODA 1TWAL 1SFOL 1DX8A 4XKTA 3Q4RA 3WVVA 3F33A 5FEJA 6RXNA 3V3KB 1WCML 2NVYL 2XJTA 3R2LA 3P8BA 1CADA 1PFYA 3C1YA 3AK8A 3W54A 4AR4A 1R03A 3RE7A 1PFVA 3BVFA 3KXUA 2FG8A 1S2ZA 1VEIA 5GAHc 4ITTA 2RBDA 5HJFA 3I4ML 2ITBA 4EVEA 5EIOC 1K83L 2CHPA 5IP7L 2JA7L 1RYQA 2RFKB 3K7AL 1NF4A 3GTQL 4LPMA 4YXMA 4ETRA 1T9QA 3L0MA 2YW6A 5K53A 4TOHA 4CYAA 1VZHA 2OKCA 3HJWB 1H96A 1NF6A 3SE1A 4KVQA 2CF7A 3WVWA 3F36A 2NVXL 3FRRA 3E1QA 3P2AA 2JA5L 2XJOA 2IU2A 2BKCA 3MPSA 5J8SA 1L8IA 4AI2A 3E1LA 4Y08A 2MS3A 5IYBL 4M34A 5H1Sc 5IYCL 2CN7A 4A3JL 3GTOL 1VZGA 4BBSL 4ZMCA 3D19A 3IU3I 2V2IA 3GGZA 1XZ1A 4IWJA 1ZS3A 3NOZX 3UNOA 4AI0A 4A3ML 3TA8A 3PW8C 3AF9X 4C3JL 4A3EL 1R0HA 2E2JL 2WWXB 3Q4QA 3H7GA 5MFZA 3IS8A 3O7RA 1I6HL 1JYBA 2V8UA 2Y0SP 1I3QL 3S17L 4TOEA 4ML5A 3HJYB 4MKUA 5FFEA 2CKCA 1BE7A 4TOCA 5MLC3 2WTLA 1JTSA 1TWGL 5IP9L 1VELA 5K2ME 2ZA8A 5LS9A 4ZN3B 4U671 3OJ5A 4E6KA 3NP2X 5GU3X 1O9RA 3AF8X 4CVRA 1I50L 3E1MA 5GOUA 2A68D 5CMQA 4A3FL 1Y1WL 1BCFA 3KDQA 1BG7A 2V2LA 3PO3L 5DM61 4DYXA 3B08B 3VVAA 4A3BL 4ZL5A 4XKSA 3PL5A 1R0IA 2GMGA 4XXBB 4BXXL 2C6RA 4DASA 1DVBA 1RCGA 1ZRPA 1RDVA 4KVRA 3KX9A 4EVDA 3A68A 2OH3A 2B5ID 2V0EA 2QF9A 1O9IA 3H97A 2UX1A 3KYWA 3LWOB 1XZ3A 4YVZA 5RXNA 3RYGA 4PG1A 4AR3A 3R2OA 5D8YA 3LNLA 4AHZA 4BBRL 5I4JA 1B2OA 4AR5A 1IERA 4MXPA 1UVHA 4E40A 2A69D 4TPUA 4CYBA 2B63L 4CVPA 4K9FA 4RC5B 3WWLA 3Q4NA 4XGHA 5AN9H 4MJYA 4LHNA 4JAFA 2JD70 4ISPA 5CMRA 1JI4A 2VXXA 1JIGA 2C41A 3E1PA 2WB1P 2AYJA 4AI3A 3KWOA 4TOGA 4XKUA 2E2IL 2PVEA 1R0GA 3RGDA 1TJOA 4CY9A 2XJPA 3R2RA 4AYBP 2HVYC 3PWQA 1YK5A 5GU1X 1PFWA 2JI1A 3H99A 2C2JA 1AEWA 1RCIA 3KA6A 3IQ1A 5D8OA 3JR7A 3JZ9A 2VXIA 1GWGA 4YWMA 4JADA 1YUXA 2ERSA 5M5XL 2C2UA 2A6HD 2V2JA 3VPBE 5EINC 1BQ9A 4M35A 1SMWA 3CQZL 1RDGA 4LQHA 4ZLWA 2XKQA 4EVBA 5GAGc 3QVDA 1OWBA 3GVYA 3AJPA 1RCCA 5M5WL 4OYNA 1FHAA 4AHXA 3R2KA 4ZTTA 1FHMA 3UOIA 1IESA 5JKLG 1R0JA 4GS7D 1IW7D 4Z3BA 3AJOA 3E6RA 3F38A 4IXKA 4KXRB 2F7NA 4DYYA 1B13A 5M3ML 5JKMG 2Y44A 2VL6A 4AR6A 3S1QL 1EUMA 3RD0A 2R93L 3HOXL 4II4B 3IS7A 2N02A 3F34A 4A3DL 1NNQA 2V15A 4AM5A 3A9QA 5AI3A 2G38B 3RZ6A 2CEIA 3AF7X 1S24A 3O7SA 3M4OL 4A3IL 3I4NL 4AM4A 2YU9L 4TOBA
chains in the Genus database with same CATH topology
3FSEA 3ISEA 4ITWA 1MOJA 4RC6B 3QHCA 1BQ8A 2Z3QB 2PPTA 4ISMA 2BW1A 1YV1A 3MSUA 4LPNA 3QHBA 4ERUA 4QUWA 5DM71 2M6OA 1T9OA 2CR8A 1IU5A 3J7Z1 5J8WA 2FZFA 3VV9A 2PSMC 1IROA 1OWCA 2H12A 1RCDA 4RC6A 2OC5A 3OGHA 2KN9A 5FFBA 4G6BA 4DYZA 2NYDA 2M6PA 1RB9A 1BFRA 3U90A 3ERZA 4LQJA 3SS2A 2FHAA 3J7Y1 4RXNA 3PW8A 1SMMA 3BT5A 5GU0X 4RC8A 3C21A 4Z5SA 5JDOB 1LKOA 3PIO1 2GS4A 1BFYA 1LKPA 5GADc 1QGHA 2FKZA 2KKDA 3Q4OA 3E1OA 3RZTA 5GN8B 3HL1A 2CIHA 3FRSA 3GHQA 3PZAA 3KA4A 3BVKA 4ZL6A 5IY0A 4POGA 3PIP1 4W4LB 1VEQA 5CZUA 3PKJA 3DBYA 1JKUA 2DSXA 3VNXA 3WVUA 3E1JA 8RXNA 2Z5QA 5JVG1 2ZA6A 3PVRB 1H7VA 5J93A 1SMUA 2CN6A 4V196 2V2PA 1YUZA 5D8RA 3PVTB 2IB0A 2L0ZA 1ODHA 1KRQA 4AI1A 1BRFA 3KA9A 4JAEA 4AHWA 3R2HA 2PYBA 5GN8A 3A44A 5D8PA 5HQOA 3AJQA 1JKVA 4ZKXA 2GYQA 4MN9A 5FFDA 3BVEA 4E6YA 2V0FA 5HJHA 4RC5A 3ISFA 5MGNA 2CKAA 2V2OA 5D8XA 2BJYA 2Z3RB 3R2MA 5J9VA 2VZBA 2MGYA 2WLAA 4WJG4 3E1NA 2V2NA 4ZN1B 3LKDA 1VJXA 5MF6A 2CWLA 3UOFA 3ZG6A 5K52A 5GU2X 1VLGA 2PYAA 5FFAA 3F32A 3R2SA 3KYYA 3RAVA 5GAEc 4KVSA 4PGKA 3KA8A 2J9UB 3PKIA 3EZ0A 3PWFA 1VZIA 1MFRA 1B2JA 4PGIA 3F39A 3AK9A 3C23A 2QQYA 4DI0A 2FFXJ 1R0FA 1QYBA 4PG0A 4CMYA 2V3BB 4CVSA 2FJCA 5MFPA 2YJJA 4YWLA 1SQ3A 2JI2A 5JKLA 4TW3A 1CAAA 5LG8A 4YKHA 1DATA 4TVMA 4LYUA 4AM2A 5JKMA 2QL0A 4REUA 5E2DA 2V2RA 2O5JD 4R42A 4RC7B 3LPEB 1L8HA 2ZURX 3GE4A 3M6JA 1S3QA 4II4A 1TKOA 4ME3A 3NFPI 3BVIA 3K35A 4DYUA 1UMNA 3PW1B 1N1QA 1DPSA 2ERJA 2K2DA 1Z4AA 1F33A 2HTNA 3HIUA 3SIDA 4CVTA 2ZA7A 7RXNA 5D8QA 4LQNA 4YXJA 2ZG8X 3F35A 5ERKA 1OTKA 1TK6A 5ERJA 2G4HA 1C09A 1WJVA 4RC7A 2V8TA 3QB9A 4LHLA 4WFN1 2V2SA 4ZKHA 1T9PA 4POFA 2C6AA 3QQCE 3ES3A 2PVXA 3UFBA 3PW1A 3SH6A 1JGCA 2JI3A 2XJQA 3T9JA 3WNWA 1E8JA 2Z5PA 4UY81 2D5KA 3FVBA 3KYUA 1Z6OA 2XJVA 2XJMA 4M33A 4ZKWA 2M4VA 2ZIXA 1FHHA 2CHIA 2XJNA 2CLUA 3QZ3A 2GYDA 1B71A 2FG4A 3BVLA 1LKMA 2JD60 4TOFA 4MUDA 2RDVA 5E1UA 1RCEA 2WLUA 1NFVA 5AXSA 1NXGA 2HR5A 2Z90A 2C2FA 3KA3A 4M32A 1JREA 4XGSA 2Z5RA 1Z92B 1S30A 3RBCA 5C6FA 4EVCA 3JZAB 4CMYV 4IWKA 5HU6D 3B0AB 2IY4A 4TO9A 2CLBA 3GGYA 3SHXA 3BKNA 3PVYB 2A6ED 3QD8A 2XJUA 2XGWA 5JDOA 3EZUA 4LPJA 1NXEA 1TKPA 1HRSA 2FL0A 2BK6A 4W4KB 2XJRA 3KYXA 2YJKA 5FFCA 3N6OA 4X0JA 5LG2A 1IRNA 3NP0X 2AR0A 2YW7A 2JD80 1LTLA 4LQVA 4JAGA 3PWQC 2C6BA 5JACA 2Z6MA 4A25A 4DE6A 2ZG9X 2Y3QA 4U3GA 4DZ0A 1VCXA 5JVH1 3PVYA 3PVRA 4TOAA 1J30A 3PVTA 5IX6A 2LCQA 4ZJKA 3KYVA 4AHYA 1JI5A 1SOFA 4B8CD 2BE5D 4LYXA 2W0OA 1F30A 3WWNB 1RWDA 5AI2A 1RYTA 3E2CA 3EGMA 3C1ZA 4P18A 2ZG7X 5D8SA 5LBHA 2X170 1YK4A 3F37A 2V2MA 1Z6OM 3FI6A 2M4YA 4MY7A 2XJSA 1LB3A 1QCVA 1ZUJA 3KHKA 1IU6A 3E6SA 4TODA 1DX8A 4XKTA 3Q4RA 3WVVA 3F33A 5FEJA 6RXNA 3V3KB 2XJTA 3R2LA 3P8BA 1CADA 3C1YA 3AK8A 3W54A 4AR4A 1R03A 3RE7A 3BVFA 3KXUA 2FG8A 1S2ZA 1VEIA 5GAHc 4ITTA 2RBDA 5HJFA 2ITBA 4EVEA 5EIOC 2CHPA 1RYQA 1NF4A 4LPMA 4YXMA 4ETRA 1T9QA 3L0MA 2YW6A 5K53A 4TOHA 4CYAA 1VZHA 2OKCA 1H96A 1NF6A 3SE1A 4KVQA 2CF7A 3WVWA 3F36A 3FRRA 3E1QA 3P2AA 2XJOA 2IU2A 2BKCA 3MPSA 5J8SA 1L8IA 4AI2A 3E1LA 4Y08A 2MS3A 5H1Sc 4M34A 2CN7A 1VZGA 4ZMCA 3D19A 3IU3I 2V2IA 3GGZA 1XZ1A 4IWJA 1ZS3A 3NOZX 3UNOA 4AI0A 3TA8A 3PW8C 3AF9X 1R0HA 2WWXB 3Q4QA 3H7GA 5MFZA 3IS8A 3O7RA 1JYBA 2V8UA 4TOEA 4ML5A 4MKUA 5FFEA 2CKCA 1BE7A 4TOCA 5MLC3 2WTLA 1JTSA 4U671 1VELA 5K2ME 2ZA8A 5LS9A 4ZN3B 3OJ5A 4E6KA 3NP2X 5GU3X 1O9RA 3AF8X 4CVRA 3E1MA 5GOUA 2A68D 5CMQA 1BCFA 3KDQA 1BG7A 2V2LA 5DM61 4DYXA 3B08B 3VVAA 4ZL5A 4XKSA 1R0IA 2GMGA 4XXBB 2C6RA 4DASA 1DVBA 1RCGA 1ZRPA 1RDVA 4KVRA 3KX9A 4EVDA 3A68A 2OH3A 2B5ID 2V0EA 2QF9A 1O9IA 3KYWA 2UX1A 1XZ3A 4YVZA 5RXNA 3RYGA 4PG1A 4AR3A 3R2OA 5D8YA 3LNLA 4AHZA 5I4JA 1B2OA 4AR5A 1IERA 4MXPA 1UVHA 4E40A 2A69D 4TPUA 4CYBA 4CVPA 4K9FA 4RC5B 3WWLA 3Q4NA 4XGHA 5AN9H 4MJYA 4LHNA 4JAFA 2JD70 4ISPA 5CMRA 1JI4A 2VXXA 1JIGA 2C41A 3E1PA 2AYJA 4AI3A 3KWOA 4TOGA 4XKUA 2PVEA 1R0GA 3RGDA 1TJOA 4CY9A 2XJPA 3R2RA 3PWQA 1YK5A 5GU1X 2JI1A 2C2JA 1AEWA 1RCIA 3KA6A 3IQ1A 5D8OA 3JZ9A 2VXIA 1GWGA 4YWMA 4JADA 1YUXA 2ERSA 2C2UA 2A6HD 2V2JA 3VPBE 5EINC 1BQ9A 4M35A 1SMWA 1RDGA 4LQHA 4ZLWA 2XKQA 4EVBA 5GAGc 3QVDA 1OWBA 3GVYA 3AJPA 1RCCA 4OYNA 1FHAA 4AHXA 3R2KA 4ZTTA 1FHMA 3UOIA 1IESA 5JKLG 1R0JA 4GS7D 1IW7D 4Z3BA 3AJOA 3E6RA 3F38A 4IXKA 4KXRB 2F7NA 4DYYA 1B13A 5JKMG 2Y44A 2VL6A 4AR6A 1EUMA 3RD0A 4II4B 3IS7A 2N02A 3F34A 1NNQA 2V15A 4AM5A 3A9QA 5AI3A 2G38B 3RZ6A 2CEIA 3AF7X 1S24A 3O7SA 4AM4A 4TOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FSE A;  3ISE A;  4ITW A;  1MOJ A;  4RC6 B;  3QHC A;  1BQ8 A;  4ISM A;  2BW1 A;  1YV1 A;  4LPN A;  3QHB A;  4ERU A;  4QUW A;  1T9O A;  1IU5 A;  5J8W A;  2FZF A;  1IRO A;  1RCD A;  4RC6 A;  2OC5 A;  3OGH A;  2KN9 A;  5FFB A;  4DYZ A;  1RB9 A;  1BFR A;  3U90 A;  3ERZ A;  4LQJ A;  3SS2 A;  2FHA A;  4RXN A;  3PW8 A;  1SMM A;  3BT5 A;  5GU0 X;  4RC8 A;  4Z5S A;  1LKO A;  2GS4 A;  1BFY A;  1LKP A;  1QGH A;  2FKZ A;  2KKD A;  3Q4O A;  3E1O A;  3RZT A;  5GN8 B;  3HL1 A;  2CIH A;  3GHQ A;  3PZA A;  3KA4 A;  3BVK A;  4ZL6 A;  5IY0 A;  4POG A;  1VEQ A;  5CZU A;  1JKU A;  2DSX A;  3VNX A;  3WVU A;  3E1J A;  8RXN A;  2Z5Q A;  2ZA6 A;  3PVR B;  1H7V A;  5J93 A;  1SMU A;  2CN6 A;  2V2P A;  1YUZ A;  5D8R A;  3PVT B;  2IB0 A;  1KRQ A;  1BRF A;  3KA9 A;  3R2H A;  2PYB A;  5GN8 A;  3A44 A;  5D8P A;  5HQO A;  3AJQ A;  1JKV A;  4ZKX A;  2GYQ A;  4MN9 A;  5FFD A;  3BVE A;  5HJH A;  4RC5 A;  3ISF A;  2V2O A;  5D8X A;  2BJY A;  3R2M A;  5J9V A;  2VZB A;  2WLA A;  3E1N A;  2V2N A;  1VJX A;  3UOF A;  5K52 A;  5GU2 X;  1VLG A;  2PYA A;  5FFA A;  3F32 A;  3R2S A;  3KYY A;  3RAV A;  4KVS A;  4PGK A;  3KA8 A;  3EZ0 A;  3PWF A;  1MFR A;  1B2J A;  4PGI A;  3F39 A;  3AK9 A;  2QQY A;  4DI0 A;  2FFX J;  1R0F A;  1QYB A;  4PG0 A;  4CMY A;  2V3B B;  4CVS A;  2FJC A;  2YJJ A;  4YWL A;  1SQ3 A;  5JKL A;  4TW3 A;  1CAA A;  5LG8 A;  4YKH A;  1DAT A;  4LYU A;  4AM2 A;  5JKM A;  2QL0 A;  4REU A;  5E2D A;  2V2R A;  4R42 A;  4RC7 B;  1L8H A;  2ZUR X;  3GE4 A;  1S3Q A;  4II4 A;  1TKO A;  4ME3 A;  3BVI A;  4DYU A;  1UMN A;  3PW1 B;  1N1Q A;  1DPS A;  2K2D A;  1Z4A A;  1F33 A;  2HTN A;  3HIU A;  3SID A;  4CVT A;  2ZA7 A;  7RXN A;  5D8Q A;  4LQN A;  2ZG8 X;  3F35 A;  5ERK A;  1OTK A;  1TK6 A;  5ERJ A;  2G4H A;  1C09 A;  4RC7 A;  3QB9 A;  2V2S A;  4ZKH A;  1T9P A;  4POF A;  3ES3 A;  2PVX A;  3PW1 A;  3SH6 A;  1JGC A;  3T9J A;  3WNW A;  1E8J A;  2Z5P A;  2D5K A;  3FVB A;  3KYU A;  1Z6O A;  2XJM A;  4M33 A;  4ZKW A;  1FHH A;  2CHI A;  2XJN A;  2CLU A;  3QZ3 A;  2GYD A;  1B71 A;  2FG4 A;  3BVL A;  1LKM A;  2JD6 0;  4TOF A;  4MUD A;  2RDV A;  5E1U A;  1RCE A;  2WLU A;  1NFV A;  5AXS A;  2HR5 A;  2Z90 A;  2C2F A;  3KA3 A;  4M32 A;  1JRE A;  4XGS A;  2Z5R A;  1S30 A;  3RBC A;  5C6F A;  4EVC A;  4CMY V;  4IWK A;  2IY4 A;  4TO9 A;  2CLB A;  3SHX A;  3BKN A;  3PVY B;  3QD8 A;  2XGW A;  3EZU A;  4LPJ A;  1TKP A;  1HRS A;  2FL0 A;  2BK6 A;  3KYX A;  2YJK A;  5FFC A;  5LG2 A;  1IRN A;  3NP0 X;  2YW7 A;  2JD8 0;  1LTL A;  4LQV A;  3PWQ C;  5JAC A;  2Z6M A;  4A25 A;  4DE6 A;  2ZG9 X;  2Y3Q A;  4U3G A;  4DZ0 A;  1VCX A;  3PVY A;  3PVR A;  4TOA A;  1J30 A;  3PVT A;  5IX6 A;  2LCQ A;  4ZJK A;  3KYV A;  1JI5 A;  1SOF A;  4LYX A;  2W0O A;  1F30 A;  1RWD A;  5AI2 A;  1RYT A;  3E2C A;  3EGM A;  4P18 A;  2ZG7 X;  5D8S A;  5LBH A;  2X17 0;  1YK4 A;  3F37 A;  2V2M A;  1Z6O M;  3FI6 A;  2M4Y A;  4MY7 A;  1LB3 A;  1QCV A;  1ZUJ A;  1IU6 A;  3E6S A;  4TOD A;  1DX8 A;  4XKT A;  3Q4R A;  3WVV A;  3F33 A;  5FEJ A;  6RXN A;  3R2L A;  1CAD A;  3AK8 A;  4AR4 A;  1R03 A;  3RE7 A;  3BVF A;  3KXU A;  2FG8 A;  1S2Z A;  1VEI A;  4ITT A;  2RBD A;  5HJF A;  2ITB A;  4EVE A;  2CHP A;  1NF4 A;  4LPM A;  4ETR A;  1T9Q A;  2YW6 A;  5K53 A;  4TOH A;  4CYA A;  1H96 A;  1NF6 A;  3SE1 A;  4KVQ A;  2CF7 A;  3WVW A;  3F36 A;  3E1Q A;  2XJO A;  2IU2 A;  2BKC A;  3MPS A;  5J8S A;  1L8I A;  3E1L A;  4Y08 A;  2MS3 A;  4M34 A;  2CN7 A;  4ZMC A;  2V2I A;  1XZ1 A;  4IWJ A;  1ZS3 A;  3NOZ X;  3UNO A;  3TA8 A;  3PW8 C;  3AF9 X;  1R0H A;  3Q4Q A;  3H7G A;  3IS8 A;  3O7R A;  1JYB A;  4TOE A;  4ML5 A;  4MKU A;  5FFE A;  1BE7 A;  4TOC A;  2WTL A;  1JTS A;  1VEL A;  2ZA8 A;  5LS9 A;  3OJ5 A;  4E6K A;  3NP2 X;  5GU3 X;  1O9R A;  3AF8 X;  4CVR A;  3E1M A;  5GOU A;  5CMQ A;  1BCF A;  1BG7 A;  2V2L A;  4DYX A;  4ZL5 A;  4XKS A;  1R0I A;  2GMG A;  2C6R A;  4DAS A;  1DVB A;  1RCG A;  1ZRP A;  1RDV A;  4KVR A;  3KX9 A;  4EVD A;  3A68 A;  2OH3 A;  3KYW A;  2QF9 A;  1O9I A;  2UX1 A;  1XZ3 A;  5RXN A;  3RYG A;  4PG1 A;  4AR3 A;  3R2O A;  5D8Y A;  5I4J A;  1B2O A;  4AR5 A;  1IER A;  1UVH A;  4TPU A;  4CYB A;  4CVP A;  4K9F A;  4RC5 B;  3Q4N A;  4MJY A;  2JD7 0;  4ISP A;  5CMR A;  1JI4 A;  2VXX A;  1JIG A;  2C41 A;  3E1P A;  3KWO A;  4TOG A;  4XKU A;  2PVE A;  1R0G A;  3RGD A;  1TJO A;  4CY9 A;  3R2R A;  3PWQ A;  1YK5 A;  5GU1 X;  2C2J A;  1AEW A;  1RCI A;  3KA6 A;  3IQ1 A;  5D8O A;  2VXI A;  1GWG A;  4YWM A;  1YUX A;  2C2U A;  2V2J A;  1BQ9 A;  4M35 A;  1SMW A;  1RDG A;  4LQH A;  4ZLW A;  2XKQ A;  4EVB A;  3QVD A;  3GVY A;  3AJP A;  1RCC A;  4OYN A;  1FHA A;  3R2K A;  4ZTT A;  1FHM A;  3UOI A;  1IES A;  5JKL G;  1R0J A;  4Z3B A;  3AJO A;  3E6R A;  3F38 A;  4IXK A;  2F7N A;  4DYY A;  1B13 A;  5JKM G;  2VL6 A;  4AR6 A;  1EUM A;  3RD0 A;  4II4 B;  3IS7 A;  3F34 A;  1NNQ A;  2V15 A;  4AM5 A;  3A9Q A;  5AI3 A;  3RZ6 A;  2CEI A;  3AF7 X;  1S24 A;  3O7S A;  4AM4 A;  4TOB A; 
#chains in the Genus database with same CATH topology
 3FSE A;  3ISE A;  4ITW A;  1MOJ A;  3GTG L;  3S1N L;  4RC6 B;  3QHC A;  1BQ8 A;  2Z3Q B;  2PPT A;  4ISM A;  2BW1 A;  1YV1 A;  3GTK L;  3MSU A;  4LPN A;  3QHB A;  4ERU A;  4QUW A;  5DM7 1;  2M6O A;  1T9O A;  2CR8 A;  1IU5 A;  4A3K L;  3J7Z 1;  5J8W A;  2FZF A;  3VV9 A;  3RZO L;  3HOU L;  4A3L L;  2PSM C;  1IRO A;  1OWC A;  2H12 A;  1RCD A;  5C4J L;  4RC6 A;  2OC5 A;  3OGH A;  2KN9 A;  1QQT A;  3LWP B;  5FFB A;  3LWV B;  5M3F L;  3GTM L;  4G6B A;  4DYZ A;  2NYD A;  2M6P A;  1RB9 A;  2PMZ P;  2E2H L;  1BFR A;  3U90 A;  3ERZ A;  4LQJ A;  3SS2 A;  2FHA A;  5IYD L;  3J7Y 1;  2R7Z L;  4RXN A;  3PW8 A;  1SMM A;  3BT5 A;  5GU0 X;  1Y1V L;  4RC8 A;  3C21 A;  4Z5S A;  5JDO B;  1LKO A;  3PIO 1;  2GS4 A;  1BFY A;  1LKP A;  5GAD c;  1QGH A;  3H0G L;  2FKZ A;  2KKD A;  3H3V M;  3Q4O A;  3E1O A;  3RZT A;  5GN8 B;  3HL1 A;  2CIH A;  3FRS A;  3S14 L;  3GHQ A;  3PZA A;  3KA4 A;  3BVK A;  4ZL6 A;  5IY0 A;  4POG A;  2AUS B;  3PIP 1;  4W4L B;  1VEQ A;  5CZU A;  3PKJ A;  3DBY A;  1JKU A;  2DSX A;  3VNX A;  3WVU A;  3E1J A;  8RXN A;  3HOY L;  2Z5Q A;  5JVG 1;  4A3C L;  2ZA6 A;  5M5Y L;  3PVR B;  1H7V A;  5J93 A;  1SMU A;  2CN6 A;  4V19 6;  2V2P A;  1YUZ A;  5D8R A;  3PVT B;  2IB0 A;  2L0Z A;  1ODH A;  3HOV L;  1KRQ A;  1TWC L;  4AI1 A;  1BRF A;  3KA9 A;  4JAE A;  4AHW A;  3R2H A;  2PYB A;  5GN8 A;  3A44 A;  3HOW L;  4Y52 L;  5D8P A;  5HQO A;  3AJQ A;  1JKV A;  4ZKX A;  4X6A L;  2GYQ A;  4MN9 A;  5FFD A;  1F4L A;  3BVE A;  4E6Y A;  2V0F A;  5HJH A;  4RC5 A;  3ISF A;  3S2H L;  5MGN A;  2CKA A;  2V2O A;  3GTJ L;  3S1M L;  5D8X A;  2BJY A;  2Z3R B;  3R2M A;  5J9V A;  2VZB A;  2MGY A;  2WLA A;  4WJG 4;  3E1N A;  2V2N A;  4ZN1 B;  3LKD A;  1VJX A;  5MF6 A;  2CWL A;  3UOF A;  3ZG6 A;  5K52 A;  5GU2 X;  1VLG A;  2PYA A;  5FFA A;  3HAX C;  3F32 A;  5FLM L;  2EY4 E;  3R2S A;  3KYY A;  3RAV A;  5GAE c;  4KVS A;  2NVQ L;  4PGK A;  4C3I L;  3KA8 A;  2J9U B;  3PKI A;  3EZ0 A;  3S15 L;  3PWF A;  5C3E L;  1VZI A;  1MFR A;  1B2J A;  3PO2 L;  4PGI A;  3F39 A;  3AK9 A;  3C23 A;  5C44 L;  2QQY A;  4DI0 A;  2FFX J;  1R0F A;  1QYB A;  4PG0 A;  4CMY A;  2V3B B;  4CVS A;  2FJC A;  4BY7 L;  1R9T L;  5MFP A;  2R92 L;  2YJJ A;  4YWL A;  1SQ3 A;  2JI2 A;  5JKL A;  4TW3 A;  1CAA A;  5LG8 A;  4YKH A;  1DAT A;  4TVM A;  3S16 L;  4LYU A;  4AM2 A;  5JKM A;  2QL0 A;  3LWQ B;  4REU A;  5E2D A;  2V2R A;  2O5J D;  4R42 A;  4RC7 B;  3LPE B;  1L8H A;  2ZUR X;  3GE4 A;  3M6J A;  1S3Q A;  3MQK B;  4II4 A;  1TKO A;  4ME3 A;  3FKI L;  3NFP I;  3LWR B;  3BVI A;  3K35 A;  4DYU A;  1UMN A;  3PW1 B;  1N1Q A;  1DPS A;  2ERJ A;  2K2D A;  2JA6 L;  1Z4A A;  1F33 A;  2VUM L;  2HTN A;  3HIU A;  3SID A;  4CVT A;  2ZA7 A;  7RXN A;  5D8Q A;  4LQN A;  4YXJ A;  2ZG8 X;  3F35 A;  5ERK A;  1OTK A;  5C4X L;  1TK6 A;  1P7P A;  5ERJ A;  3FDJ A;  2G4H A;  1C09 A;  1WJV A;  4RC7 A;  2V8T A;  3QB9 A;  4LHL A;  4WFN 1;  2V2S A;  4ZKH A;  4C3H L;  1T9P A;  4POF A;  5FJ8 L;  2C6A A;  3GTP L;  3QQC E;  3ES3 A;  2PVX A;  3UFB A;  4A3G L;  3PW1 A;  3SH6 A;  1JGC A;  2JI3 A;  2XJQ A;  3T9J A;  3WNW A;  1E8J A;  2Z5P A;  3S1R L;  4UY8 1;  2D5K A;  3FVB A;  3KYU A;  1Z6O A;  2XJV A;  3HOZ L;  2XJM A;  4M33 A;  4ZKW A;  2JA8 L;  2M4V A;  2ZIX A;  2WAQ P;  1FHH A;  4QIW P;  2CHI A;  2XJN A;  2CLU A;  3QZ3 A;  2GYD A;  1B71 A;  2FG4 A;  3BVL A;  1LKM A;  2JD6 0;  4TOF A;  4MUD A;  2RDV A;  5E1U A;  1RCE A;  2WLU A;  1NFV A;  5AXS A;  1NXG A;  2HR5 A;  2Z90 A;  2C2F A;  3KA3 A;  3HKZ P;  4M32 A;  1JRE A;  4XGS A;  2Z5R A;  1Z92 B;  1TWH L;  1S30 A;  3RBC A;  5C6F A;  4EVC A;  3JZA B;  4CMY V;  4IWK A;  5HU6 D;  3B0A B;  2IY4 A;  4TO9 A;  2CLB A;  3GGY A;  3SHX A;  3BKN A;  3PVY B;  2AQC A;  3QD8 A;  2A6E D;  2XGW A;  5JDO A;  2XJU A;  3EZU A;  4BY1 L;  4LPJ A;  4C2M 1;  1NXE A;  1TKP A;  1HRS A;  2FL0 A;  2BK6 A;  4W4K B;  2XJR A;  3KYX A;  2YJK A;  5FFC A;  3N6O A;  4X0J A;  5LG2 A;  1IRN A;  3NP0 X;  2AR0 A;  2YW7 A;  2JD8 0;  1LTL A;  4LQV A;  4JAG A;  3PWQ C;  2C6B A;  5JAC A;  3RZD L;  2Z6M A;  4A25 A;  4DE6 A;  2ZG9 X;  2Y3Q A;  4U3G A;  4DZ0 A;  1VCX A;  5JVH 1;  3PVY A;  3PVR A;  4TOA A;  1J30 A;  4Y7N L;  3PVT A;  5IX6 A;  2LCQ A;  3S2D L;  4ZJK A;  3KYV A;  4AHY A;  1JI5 A;  1SOF A;  4B8C D;  2APO B;  2BE5 D;  2NVT L;  4LYX A;  2W0O A;  1F30 A;  3WWN B;  1RWD A;  5AI2 A;  1RYT A;  4A93 L;  3E2C A;  3M3Y L;  3EGM A;  3C1Z A;  4P18 A;  2ZG7 X;  5D8S A;  5LBH A;  2X17 0;  1PZX A;  3H9C A;  1YK4 A;  3F37 A;  2V2M A;  1Z6O M;  3FI6 A;  3GTL L;  2M4Y A;  4MY7 A;  1PFU A;  2XJS A;  1LB3 A;  1QCV A;  3H9B A;  1ZUJ A;  3KHK A;  1TWF L;  1IU6 A;  3E6S A;  4TOD A;  1TWA L;  1SFO L;  1DX8 A;  4XKT A;  3Q4R A;  3WVV A;  3F33 A;  5FEJ A;  6RXN A;  3V3K B;  1WCM L;  2NVY L;  2XJT A;  3R2L A;  3P8B A;  1CAD A;  1PFY A;  3C1Y A;  3AK8 A;  3W54 A;  4AR4 A;  1R03 A;  3RE7 A;  1PFV A;  3BVF A;  3KXU A;  2FG8 A;  1S2Z A;  1VEI A;  5GAH c;  4ITT A;  2RBD A;  5HJF A;  3I4M L;  2ITB A;  4EVE A;  5EIO C;  1K83 L;  2CHP A;  5IP7 L;  2JA7 L;  1RYQ A;  2RFK B;  3K7A L;  1NF4 A;  3GTQ L;  4LPM A;  4YXM A;  4ETR A;  1T9Q A;  3L0M A;  2YW6 A;  5K53 A;  4TOH A;  4CYA A;  1VZH A;  2OKC A;  3HJW B;  1H96 A;  1NF6 A;  3SE1 A;  4KVQ A;  2CF7 A;  3WVW A;  3F36 A;  2NVX L;  3FRR A;  3E1Q A;  3P2A A;  2JA5 L;  2XJO A;  2IU2 A;  2BKC A;  3MPS A;  5J8S A;  1L8I A;  4AI2 A;  3E1L A;  4Y08 A;  2MS3 A;  5IYB L;  4M34 A;  5H1S c;  5IYC L;  2CN7 A;  4A3J L;  3GTO L;  1VZG A;  4BBS L;  4ZMC A;  3D19 A;  3IU3 I;  2V2I A;  3GGZ A;  1XZ1 A;  4IWJ A;  1ZS3 A;  3NOZ X;  3UNO A;  4AI0 A;  4A3M L;  3TA8 A;  3PW8 C;  3AF9 X;  4C3J L;  4A3E L;  1R0H A;  2E2J L;  2WWX B;  3Q4Q A;  3H7G A;  5MFZ A;  3IS8 A;  3O7R A;  1I6H L;  1JYB A;  2V8U A;  2Y0S P;  1I3Q L;  3S17 L;  4TOE A;  4ML5 A;  3HJY B;  4MKU A;  5FFE A;  2CKC A;  1BE7 A;  4TOC A;  5MLC 3;  2WTL A;  1JTS A;  1TWG L;  5IP9 L;  1VEL A;  5K2M E;  2ZA8 A;  5LS9 A;  4ZN3 B;  4U67 1;  3OJ5 A;  4E6K A;  3NP2 X;  5GU3 X;  1O9R A;  3AF8 X;  4CVR A;  1I50 L;  3E1M A;  5GOU A;  2A68 D;  5CMQ A;  4A3F L;  1Y1W L;  1BCF A;  3KDQ A;  1BG7 A;  2V2L A;  3PO3 L;  5DM6 1;  4DYX A;  3B08 B;  3VVA A;  4A3B L;  4ZL5 A;  4XKS A;  3PL5 A;  1R0I A;  2GMG A;  4XXB B;  4BXX L;  2C6R A;  4DAS A;  1DVB A;  1RCG A;  1ZRP A;  1RDV A;  4KVR A;  3KX9 A;  4EVD A;  3A68 A;  2OH3 A;  2B5I D;  2V0E A;  2QF9 A;  1O9I A;  3H97 A;  2UX1 A;  3KYW A;  3LWO B;  1XZ3 A;  4YVZ A;  5RXN A;  3RYG A;  4PG1 A;  4AR3 A;  3R2O A;  5D8Y A;  3LNL A;  4AHZ A;  4BBR L;  5I4J A;  1B2O A;  4AR5 A;  1IER A;  4MXP A;  1UVH A;  4E40 A;  2A69 D;  4TPU A;  4CYB A;  2B63 L;  4CVP A;  4K9F A;  4RC5 B;  3WWL A;  3Q4N A;  4XGH A;  5AN9 H;  4MJY A;  4LHN A;  4JAF A;  2JD7 0;  4ISP A;  5CMR A;  1JI4 A;  2VXX A;  1JIG A;  2C41 A;  3E1P A;  2WB1 P;  2AYJ A;  4AI3 A;  3KWO A;  4TOG A;  4XKU A;  2E2I L;  2PVE A;  1R0G A;  3RGD A;  1TJO A;  4CY9 A;  2XJP A;  3R2R A;  4AYB P;  2HVY C;  3PWQ A;  1YK5 A;  5GU1 X;  1PFW A;  2JI1 A;  3H99 A;  2C2J A;  1AEW A;  1RCI A;  3KA6 A;  3IQ1 A;  5D8O A;  3JR7 A;  3JZ9 A;  2VXI A;  1GWG A;  4YWM A;  4JAD A;  1YUX A;  2ERS A;  5M5X L;  2C2U A;  2A6H D;  2V2J A;  3VPB E;  5EIN C;  1BQ9 A;  4M35 A;  1SMW A;  3CQZ L;  1RDG A;  4LQH A;  4ZLW A;  2XKQ A;  4EVB A;  5GAG c;  3QVD A;  1OWB A;  3GVY A;  3AJP A;  1RCC A;  5M5W L;  4OYN A;  1FHA A;  4AHX A;  3R2K A;  4ZTT A;  1FHM A;  3UOI A;  1IES A;  5JKL G;  1R0J A;  4GS7 D;  1IW7 D;  4Z3B A;  3AJO A;  3E6R A;  3F38 A;  4IXK A;  4KXR B;  2F7N A;  4DYY A;  1B13 A;  5M3M L;  5JKM G;  2Y44 A;  2VL6 A;  4AR6 A;  3S1Q L;  1EUM A;  3RD0 A;  2R93 L;  3HOX L;  4II4 B;  3IS7 A;  2N02 A;  3F34 A;  4A3D L;  1NNQ A;  2V15 A;  4AM5 A;  3A9Q A;  5AI3 A;  2G38 B;  3RZ6 A;  2CEI A;  3AF7 X;  1S24 A;  3O7S A;  3M4O L;  4A3I L;  3I4N L;  4AM4 A;  2YU9 L;  4TOB A; 
#chains in the Genus database with same CATH homology
 3FSE A;  3ISE A;  4ITW A;  1MOJ A;  4RC6 B;  3QHC A;  1BQ8 A;  2Z3Q B;  2PPT A;  4ISM A;  2BW1 A;  1YV1 A;  3MSU A;  4LPN A;  3QHB A;  4ERU A;  4QUW A;  5DM7 1;  2M6O A;  1T9O A;  2CR8 A;  1IU5 A;  3J7Z 1;  5J8W A;  2FZF A;  3VV9 A;  2PSM C;  1IRO A;  1OWC A;  2H12 A;  1RCD A;  4RC6 A;  2OC5 A;  3OGH A;  2KN9 A;  5FFB A;  4G6B A;  4DYZ A;  2NYD A;  2M6P A;  1RB9 A;  1BFR A;  3U90 A;  3ERZ A;  4LQJ A;  3SS2 A;  2FHA A;  3J7Y 1;  4RXN A;  3PW8 A;  1SMM A;  3BT5 A;  5GU0 X;  4RC8 A;  3C21 A;  4Z5S A;  5JDO B;  1LKO A;  3PIO 1;  2GS4 A;  1BFY A;  1LKP A;  5GAD c;  1QGH A;  2FKZ A;  2KKD A;  3Q4O A;  3E1O A;  3RZT A;  5GN8 B;  3HL1 A;  2CIH A;  3FRS A;  3GHQ A;  3PZA A;  3KA4 A;  3BVK A;  4ZL6 A;  5IY0 A;  4POG A;  3PIP 1;  4W4L B;  1VEQ A;  5CZU A;  3PKJ A;  3DBY A;  1JKU A;  2DSX A;  3VNX A;  3WVU A;  3E1J A;  8RXN A;  2Z5Q A;  5JVG 1;  2ZA6 A;  3PVR B;  1H7V A;  5J93 A;  1SMU A;  2CN6 A;  4V19 6;  2V2P A;  1YUZ A;  5D8R A;  3PVT B;  2IB0 A;  2L0Z A;  1ODH A;  1KRQ A;  4AI1 A;  1BRF A;  3KA9 A;  4JAE A;  4AHW A;  3R2H A;  2PYB A;  5GN8 A;  3A44 A;  5D8P A;  5HQO A;  3AJQ A;  1JKV A;  4ZKX A;  2GYQ A;  4MN9 A;  5FFD A;  3BVE A;  4E6Y A;  2V0F A;  5HJH A;  4RC5 A;  3ISF A;  5MGN A;  2CKA A;  2V2O A;  5D8X A;  2BJY A;  2Z3R B;  3R2M A;  5J9V A;  2VZB A;  2MGY A;  2WLA A;  4WJG 4;  3E1N A;  2V2N A;  4ZN1 B;  3LKD A;  1VJX A;  5MF6 A;  2CWL A;  3UOF A;  3ZG6 A;  5K52 A;  5GU2 X;  1VLG A;  2PYA A;  5FFA A;  3F32 A;  3R2S A;  3KYY A;  3RAV A;  5GAE c;  4KVS A;  4PGK A;  3KA8 A;  2J9U B;  3PKI A;  3EZ0 A;  3PWF A;  1VZI A;  1MFR A;  1B2J A;  4PGI A;  3F39 A;  3AK9 A;  3C23 A;  2QQY A;  4DI0 A;  2FFX J;  1R0F A;  1QYB A;  4PG0 A;  4CMY A;  2V3B B;  4CVS A;  2FJC A;  5MFP A;  2YJJ A;  4YWL A;  1SQ3 A;  2JI2 A;  5JKL A;  4TW3 A;  1CAA A;  5LG8 A;  4YKH A;  1DAT A;  4TVM A;  4LYU A;  4AM2 A;  5JKM A;  2QL0 A;  4REU A;  5E2D A;  2V2R A;  2O5J D;  4R42 A;  4RC7 B;  3LPE B;  1L8H A;  2ZUR X;  3GE4 A;  3M6J A;  1S3Q A;  4II4 A;  1TKO A;  4ME3 A;  3NFP I;  3BVI A;  3K35 A;  4DYU A;  1UMN A;  3PW1 B;  1N1Q A;  1DPS A;  2ERJ A;  2K2D A;  1Z4A A;  1F33 A;  2HTN A;  3HIU A;  3SID A;  4CVT A;  2ZA7 A;  7RXN A;  5D8Q A;  4LQN A;  4YXJ A;  2ZG8 X;  3F35 A;  5ERK A;  1OTK A;  1TK6 A;  5ERJ A;  2G4H A;  1C09 A;  1WJV A;  4RC7 A;  2V8T A;  3QB9 A;  4LHL A;  4WFN 1;  2V2S A;  4ZKH A;  1T9P A;  4POF A;  2C6A A;  3QQC E;  3ES3 A;  2PVX A;  3UFB A;  3PW1 A;  3SH6 A;  1JGC A;  2JI3 A;  2XJQ A;  3T9J A;  3WNW A;  1E8J A;  2Z5P A;  4UY8 1;  2D5K A;  3FVB A;  3KYU A;  1Z6O A;  2XJV A;  2XJM A;  4M33 A;  4ZKW A;  2M4V A;  2ZIX A;  1FHH A;  2CHI A;  2XJN A;  2CLU A;  3QZ3 A;  2GYD A;  1B71 A;  2FG4 A;  3BVL A;  1LKM A;  2JD6 0;  4TOF A;  4MUD A;  2RDV A;  5E1U A;  1RCE A;  2WLU A;  1NFV A;  5AXS A;  1NXG A;  2HR5 A;  2Z90 A;  2C2F A;  3KA3 A;  4M32 A;  1JRE A;  4XGS A;  2Z5R A;  1Z92 B;  1S30 A;  3RBC A;  5C6F A;  4EVC A;  3JZA B;  4CMY V;  4IWK A;  5HU6 D;  3B0A B;  2IY4 A;  4TO9 A;  2CLB A;  3GGY A;  3SHX A;  3BKN A;  3PVY B;  2A6E D;  3QD8 A;  2XJU A;  2XGW A;  5JDO A;  3EZU A;  4LPJ A;  1NXE A;  1TKP A;  1HRS A;  2FL0 A;  2BK6 A;  4W4K B;  2XJR A;  3KYX A;  2YJK A;  5FFC A;  3N6O A;  4X0J A;  5LG2 A;  1IRN A;  3NP0 X;  2AR0 A;  2YW7 A;  2JD8 0;  1LTL A;  4LQV A;  4JAG A;  3PWQ C;  2C6B A;  5JAC A;  2Z6M A;  4A25 A;  4DE6 A;  2ZG9 X;  2Y3Q A;  4U3G A;  4DZ0 A;  1VCX A;  5JVH 1;  3PVY A;  3PVR A;  4TOA A;  1J30 A;  3PVT A;  5IX6 A;  2LCQ A;  4ZJK A;  3KYV A;  4AHY A;  1JI5 A;  1SOF A;  4B8C D;  2BE5 D;  4LYX A;  2W0O A;  1F30 A;  3WWN B;  1RWD A;  5AI2 A;  1RYT A;  3E2C A;  3EGM A;  3C1Z A;  4P18 A;  2ZG7 X;  5D8S A;  5LBH A;  2X17 0;  1YK4 A;  3F37 A;  2V2M A;  1Z6O M;  3FI6 A;  2M4Y A;  4MY7 A;  2XJS A;  1LB3 A;  1QCV A;  1ZUJ A;  3KHK A;  1IU6 A;  3E6S A;  4TOD A;  1DX8 A;  4XKT A;  3Q4R A;  3WVV A;  3F33 A;  5FEJ A;  6RXN A;  3V3K B;  2XJT A;  3R2L A;  3P8B A;  1CAD A;  3C1Y A;  3AK8 A;  3W54 A;  4AR4 A;  1R03 A;  3RE7 A;  3BVF A;  3KXU A;  2FG8 A;  1S2Z A;  1VEI A;  5GAH c;  4ITT A;  2RBD A;  5HJF A;  2ITB A;  4EVE A;  5EIO C;  2CHP A;  1RYQ A;  1NF4 A;  4LPM A;  4YXM A;  4ETR A;  1T9Q A;  3L0M A;  2YW6 A;  5K53 A;  4TOH A;  4CYA A;  1VZH A;  2OKC A;  1H96 A;  1NF6 A;  3SE1 A;  4KVQ A;  2CF7 A;  3WVW A;  3F36 A;  3FRR A;  3E1Q A;  3P2A A;  2XJO A;  2IU2 A;  2BKC A;  3MPS A;  5J8S A;  1L8I A;  4AI2 A;  3E1L A;  4Y08 A;  2MS3 A;  5H1S c;  4M34 A;  2CN7 A;  1VZG A;  4ZMC A;  3D19 A;  3IU3 I;  2V2I A;  3GGZ A;  1XZ1 A;  4IWJ A;  1ZS3 A;  3NOZ X;  3UNO A;  4AI0 A;  3TA8 A;  3PW8 C;  3AF9 X;  1R0H A;  2WWX B;  3Q4Q A;  3H7G A;  5MFZ A;  3IS8 A;  3O7R A;  1JYB A;  2V8U A;  4TOE A;  4ML5 A;  4MKU A;  5FFE A;  2CKC A;  1BE7 A;  4TOC A;  5MLC 3;  2WTL A;  1JTS A;  4U67 1;  1VEL A;  5K2M E;  2ZA8 A;  5LS9 A;  4ZN3 B;  3OJ5 A;  4E6K A;  3NP2 X;  5GU3 X;  1O9R A;  3AF8 X;  4CVR A;  3E1M A;  5GOU A;  2A68 D;  5CMQ A;  1BCF A;  3KDQ A;  1BG7 A;  2V2L A;  5DM6 1;  4DYX A;  3B08 B;  3VVA A;  4ZL5 A;  4XKS A;  1R0I A;  2GMG A;  4XXB B;  2C6R A;  4DAS A;  1DVB A;  1RCG A;  1ZRP A;  1RDV A;  4KVR A;  3KX9 A;  4EVD A;  3A68 A;  2OH3 A;  2B5I D;  2V0E A;  2QF9 A;  1O9I A;  3KYW A;  2UX1 A;  1XZ3 A;  4YVZ A;  5RXN A;  3RYG A;  4PG1 A;  4AR3 A;  3R2O A;  5D8Y A;  3LNL A;  4AHZ A;  5I4J A;  1B2O A;  4AR5 A;  1IER A;  4MXP A;  1UVH A;  4E40 A;  2A69 D;  4TPU A;  4CYB A;  4CVP A;  4K9F A;  4RC5 B;  3WWL A;  3Q4N A;  4XGH A;  5AN9 H;  4MJY A;  4LHN A;  4JAF A;  2JD7 0;  4ISP A;  5CMR A;  1JI4 A;  2VXX A;  1JIG A;  2C41 A;  3E1P A;  2AYJ A;  4AI3 A;  3KWO A;  4TOG A;  4XKU A;  2PVE A;  1R0G A;  3RGD A;  1TJO A;  4CY9 A;  2XJP A;  3R2R A;  3PWQ A;  1YK5 A;  5GU1 X;  2JI1 A;  2C2J A;  1AEW A;  1RCI A;  3KA6 A;  3IQ1 A;  5D8O A;  3JZ9 A;  2VXI A;  1GWG A;  4YWM A;  4JAD A;  1YUX A;  2ERS A;  2C2U A;  2A6H D;  2V2J A;  3VPB E;  5EIN C;  1BQ9 A;  4M35 A;  1SMW A;  1RDG A;  4LQH A;  4ZLW A;  2XKQ A;  4EVB A;  5GAG c;  3QVD A;  1OWB A;  3GVY A;  3AJP A;  1RCC A;  4OYN A;  1FHA A;  4AHX A;  3R2K A;  4ZTT A;  1FHM A;  3UOI A;  1IES A;  5JKL G;  1R0J A;  4GS7 D;  1IW7 D;  4Z3B A;  3AJO A;  3E6R A;  3F38 A;  4IXK A;  4KXR B;  2F7N A;  4DYY A;  1B13 A;  5JKM G;  2Y44 A;  2VL6 A;  4AR6 A;  1EUM A;  3RD0 A;  4II4 B;  3IS7 A;  2N02 A;  3F34 A;  1NNQ A;  2V15 A;  4AM5 A;  3A9Q A;  5AI3 A;  2G38 B;  3RZ6 A;  2CEI A;  3AF7 X;  1S24 A;  3O7S A;  4AM4 A;  4TOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...