3AK8A

Crystal structure of the sep22 dodecamer, a dps-like protein from salmonella enterica subsp. enterica serovar enteritidis
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
154
structure length
154
Chain Sequence
LLYTRNDVSESDKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALTDHLDTMAERAVQLGGVALGTTQVINSKTPLKSYPLDIHNVQDHLKELADRYAVVANDVRKAIGEAKDEDTADIFTAASRDLDKFLWFIESNIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA protection during starvation protein
publication title Structures of the SEp22 dodecamer, a Dps-like protein from Salmonella enterica subsp. enterica serovar Enteritidis
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar kentucky
molecule tags Metal binding protein, oxidoreductase
total genus 68
structure length 154
sequence length 154
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.16.-.-:
pdb deposition date 2010-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3ak8A00
4EVDA 1HRSA 1Z4AA 1RCDA 3IS7A 2V2OA 4LPNA 4TW3A 4LYXA 1NF4A 3PZAA 1S3QA 4M32A 2CN6A 3QHBA 3VNXA 2ZG8X 5GOUA 1SQ3A 5GU3X 3TA8A 4AM2A 2XJMA 3BKNA 3NOZX 4E6KA 3H7GA 2V2PA 2HTNA 3QB9A 1VEIA 4LQNA 2WTLA 1XZ1A 4ETRA 3AK8A 1O9IA 1NF6A 3HL1A 4LPMA 1LB3A 4DI0A 4TOEA 3AJQA 4ZKWA 3KA9A 1JI5A 1UVHA 3KA4A 4CYAA 4OYNA 3RD0A 2X170 4M33A 3KA6A 2IU2A 2VXIA 2XJOA 3KXUA 2CN7A 1AEWA 3AF7X 4AM5A 4A25A 1F30A 3O7SA 5GU2X 3GVYA 2CHPA 3E1PA 3IS8A 2YW7A 1ZS3A 3PWQC 3PVTA 3F34A 3PW8A 2HR5A 4DZ0A 1DATA 5LS9A 2FKZA 3RE7A 2V2IA 5AXSA 5FFDA 3BVKA 2QQYA 1MFRA 3E1OA 1JREA 2ITBA 4LPJA 4LYUA 4ERUA 1OTKA 4TOFA 4ZJKA 1QYBA 5FFBA 1L8IA 2Z5QA 3E6SA 3U90A 5ERKA 5D8XA 5CZUA 3KA3A 4RC8A 2BKCA 4PGIA 4II4B 2C2FA 3F33A 3EZUA 4CMYA 3MPSA 1RCCA 5D8RA 4M35A 4PGKA 5LG2A 5D8OA 2G4HA 5LBHA 3Q4OA 4CVRA 1N1QA 4REUA 2VZBA 4XKUA 4LQJA 4MUDA 2ZG7X 2QF9A 1IERA 3E1JA 3RAVA 4XGSA 4MY7A 5LG8A 4U3GA 2BK6A 3FSEA 4ML5A 3BVIA 2CIHA 4DYZA 4RC5A 1H96A 3Q4QA 2C2JA 4ZL6A 3E2CA 4RC5B 1Z6OA 1RCIA 1LKOA 1GWGA 3SHXA 4ISMA 1DVBA 3AF9X 4TOGA 1VJXA 1LKMA 1EUMA 3GHQA 1VELA 5HQOA 2ZURX 5GU0X 4KVRA 4ZKHA 3SE1A 1ZUJA 4TOHA 1JKUA 3F32A 5GN8A 2UX1A 4M34A 4ZL5A 1LKPA 1QGHA 2V2SA 5J93A 2XGWA 4RC7A 2ZG9X 5GN8B 3R2KA 5GU1X 3A9QA 3HIUA 2IY4A 4EVBA 4ZLWA 4RC7B 5JACA 1RCGA 1VEQA 4QUWA 5IX6A 3GE4A 1JTSA 1TJOA 3F38A 3FVBA 4ITWA 3UOFA 5JKMG 2GYQA 1JYBA 2CEIA 1YUZA 3BVFA 1R03A 5FFAA 4IXKA 1S30A 2XJNA 3R2SA 3KA8A 4EVEA 4TOAA 2F7NA 1YUXA 2OC5A 1NFVA 5D8YA 2FZFA 2W0OA 5HJFA 3EGMA 5FEJA 1F33A 4AM4A 2JD60 3R2RA 4ISPA 1RCEA 4MKUA 2ZA7A 5JKMA 3PWFA 1TK6A 4CVTA 4DYXA 4II4A 3WVUA 5JKLG 3Q4NA 4YKHA 3RBCA 4RC6A 2ZA8A 2Z90A 3QZ3A 4IWKA 5J8SA 2FJCA 4RC6B 3QD8A 2ZA6A 3OJ5A 3F36A 2Z5PA 3PVYA 3ISFA 4DYUA 3PVYB 5JKLA 3ES3A 4DASA 2PYBA 2FG8A 1JIGA 2V2MA 3WVVA 5J9VA 3QHCA 5J8WA 1JI4A 3PW8C 3PW1A 4ITTA 3ISEA 2Z6MA 3F35A 3R2LA 1MOJA 1UMNA 3KWOA 5HJHA 2V2RA 3E1LA 4LQVA 5I4JA 3AF8X 5C6FA 3IQ1A 3F37A 3PW1B 4DE6A 4TOBA 4P18A 2CF7A 3AK9A 2YW6A 4Y08A 2FHAA 1BG7A 1BFRA 3WVWA 1TKPA 4PG0A 1FHAA 2FG4A 2V2LA 5D8PA 5ERJA 3UNOA 2CLBA 3O7RA 4TO9A 4CY9A 3PWQA 2FL0A 1JKVA 3PVRA 4MJYA 2BW1A 2CLUA 3E1QA 3PVRB 3UOIA 3R2OA 3OGHA 2VXXA 5CMQA 3AJPA 3R2MA 2FFXJ 2V15A 4MN9A 5E1UA 2XKQA 2V2JA 3EZ0A 5FFEA 2Y3QA 3E1NA 3AJOA 1XZ3A 1DPSA 3NP2X 5E2DA 2BJYA 4EVCA 3E6RA 4ZTTA 5CMRA 1SOFA 1L8HA 2GS4A 5D8QA 1O9RA 4KVQA 5K52A 3BVEA 2GYDA 2OH3A 4PG1A 4DYYA 4KVSA 5D8SA 4CMYV 4TODA 3R2HA 1B71A 2WLAA 3RGDA 2WLUA 2C2UA 2C41A 3BVLA 2CHIA 3PVTB 3A68A 4CVSA 4ZKXA 2C6RA 3F39A 2D5KA 1JGCA 1BCFA 4XKTA 3QVDA 3BT5A 4IWJA 4ZMCA 4XKSA 1IESA 3WNWA 2JD70 3T9JA 2Z5RA 5K53A 1KRQA 2RBDA 2YJJA 4Z3BA 3E1MA 5FFCA 1VLGA 4TOCA 2V2NA 1YV1A 2JD80 3ERZA 4Z5SA 4CYBA 1RYTA 3FI6A 3SIDA 4R42A 1J30A 2YJKA 4CVPA 1NNQA 1S2ZA 3SH6A 3Q4RA 4LQHA 1TKOA 3NP0X 2IB0A 1Z6OM 3KX9A
chains in the Genus database with same CATH superfamily
4EVDA 1HRSA 1Z4AA 1RCDA 3IS7A 4W4KB 2V2OA 4LPNA 4TW3A 4LYXA 1NF4A 3PZAA 1S3QA 4M32A 2CN6A 3QHBA 3VNXA 2ZG8X 3M6JA 5GOUA 1SQ3A 5GU3X 3TA8A 4AM2A 2XJMA 3BKNA 3NOZX 4E6KA 3H7GA 2V2PA 2HTNA 3QB9A 1VEIA 4LQNA 2WTLA 1XZ1A 4ETRA 3AK8A 1O9IA 1NF6A 3HL1A 4LPMA 1LB3A 4DI0A 4TOEA 3AJQA 4ZKWA 3KA9A 1JI5A 2N02A 1UVHA 3KA4A 4CYAA 4OYNA 3RD0A 2X170 4M33A 3KA6A 2IU2A 2VXIA 2XJOA 3KXUA 2CN7A 1AEWA 3AF7X 4AM5A 4A25A 1F30A 3KHKA 3O7SA 5GU2X 3GVYA 2CHPA 3E1PA 3IS8A 2YW7A 1ZS3A 3PWQC 5HU6D 3PVTA 3F34A 3N6OA 3PW8A 2HR5A 4DZ0A 1DATA 3D19A 5LS9A 2FKZA 3V3KB 3RE7A 2V2IA 5AXSA 5FFDA 3BVKA 2QQYA 1MFRA 3E1OA 1JREA 2ITBA 4LPJA 4LYUA 4ERUA 1OTKA 4TOFA 4ZJKA 1QYBA 4YVZA 5FFBA 4YXMA 1L8IA 2Z5QA 3E6SA 3U90A 5ERKA 5D8XA 5CZUA 3KA3A 4RC8A 3W54A 2BKCA 5JDOA 4PGIA 3KDQA 4II4B 2C2FA 3F33A 3EZUA 4CMYA 3MPSA 1RCCA 5D8RA 4M35A 3VV9A 4PGKA 5LG2A 5D8OA 2G4HA 5LBHA 5JDOB 3Q4OA 4CVRA 1N1QA 4REUA 2VZBA 3GGYA 4XKUA 4LQJA 4MUDA 2ZG7X 2QF9A 1IERA 3E1JA 3RAVA 4XGSA 4MY7A 5LG8A 4U3GA 2BK6A 3FSEA 4ML5A 3BVIA 2CIHA 4DYZA 4RC5A 1H96A 3JZ9A 3Q4QA 2C2JA 4ZL6A 3L0MA 3E2CA 2WWXB 4RC5B 1Z6OA 3C23A 1RCIA 1LKOA 1GWGA 3SHXA 4ISMA 1DVBA 3AF9X 4TOGA 4MXPA 1VJXA 1LKMA 1EUMA 3GHQA 1VELA 5HQOA 2ZURX 5GU0X 4KVRA 4ZKHA 2OKCA 3SE1A 1ZUJA 4TOHA 1JKUA 3F32A 5GN8A 3UFBA 2UX1A 4M34A 4ZL5A 1LKPA 1QGHA 2V2SA 5J93A 2XGWA 4RC7A 2ZG9X 5GN8B 3R2KA 5GU1X 3A9QA 3HIUA 2IY4A 4EVBA 4ZLWA 3DBYA 4RC7B 5JACA 1RCGA 1VEQA 4QUWA 2Y44A 5IX6A 3GE4A 1JTSA 1TJOA 3F38A 3FVBA 4ITWA 3UOFA 5JKMG 2GYQA 1JYBA 2CEIA 1YUZA 3BVFA 1R03A 5FFAA 4IXKA 1S30A 2XJNA 3R2SA 3KA8A 4EVEA 4TOAA 2F7NA 2MGYA 1YUXA 2OC5A 1NFVA 5D8YA 4W4LB 2FZFA 2AR0A 2W0OA 5HJFA 3EGMA 5FEJA 3C1ZA 1F33A 4AM4A 2JD60 3R2RA 4ISPA 1RCEA 4MKUA 2ZA7A 5JKMA 3PWFA 1TK6A 4CVTA 4DYXA 4II4A 3WVUA 2V8UA 5JKLG 3Q4NA 4YKHA 3RBCA 4RC6A 2ZA8A 2Z90A 4WJG4 3QZ3A 4IWKA 5J8SA 2FJCA 4RC6B 3QD8A 2ZA6A 3C21A 3F36A 2Z5PA 3OJ5A 3PVYA 3ISFA 3JZAB 4DYUA 3PVYB 5JKLA 3ES3A 4DASA 2PYBA 2FG8A 1JIGA 2V2MA 3WVVA 5J9VA 3QHCA 5J8WA 1JI4A 3PW8C 3PW1A 4ITTA 3ISEA 2Z6MA 3F35A 3R2LA 1MOJA 1UMNA 3KWOA 5HJHA 2V2RA 3E1LA 4LQVA 5I4JA 3AF8X 3LKDA 5C6FA 3IQ1A 3F37A 3PW1B 4DE6A 2V8TA 4TOBA 4P18A 2CF7A 3AK9A 2YW6A 3FRRA 4Y08A 2FHAA 1BG7A 1BFRA 3WVWA 1TKPA 4PG0A 1FHAA 2FG4A 2V2LA 5D8PA 5ERJA 3UNOA 2CLBA 3O7RA 4TO9A 4CY9A 3PWQA 2FL0A 1JKVA 3PVRA 4MJYA 2BW1A 2CLUA 3E1QA 3VVAA 3PVRB 3UOIA 3R2OA 3OGHA 2VXXA 5CMQA 3AJPA 4X0JA 3R2MA 2FFXJ 2V15A 4MN9A 5E1UA 2XKQA 2V2JA 3EZ0A 5FFEA 2Y3QA 3E1NA 3AJOA 1XZ3A 1DPSA 3NP2X 5E2DA 2BJYA 3GGZA 4EVCA 3E6RA 3C1YA 4ZTTA 5CMRA 1SOFA 1L8HA 2GS4A 5D8QA 3FRSA 1O9RA 4KVQA 5K52A 3BVEA 2GYDA 2OH3A 4PG1A 4DYYA 4KVSA 5D8SA 4KXRB 4CMYV 4YXJA 4TODA 3R2HA 1B71A 2WLAA 3RGDA 2WLUA 2C2UA 2C41A 3BVLA 2CHIA 3PVTB 4E40A 3A68A 4CVSA 4ZKXA 2C6RA 3F39A 2D5KA 1JGCA 1BCFA 4XKTA 3QVDA 3BT5A 4IWJA 4ZMCA 2G38B 4XKSA 1IESA 3WNWA 2JD70 3T9JA 2Z5RA 5K53A 1KRQA 2RBDA 2YJJA 4Z3BA 3E1MA 5FFCA 1VLGA 4TOCA 2V2NA 1YV1A 2JD80 3ERZA 4Z5SA 4CYBA 1RYTA 3FI6A 3SIDA 4R42A 1J30A 2YJKA 4CVPA 1NNQA 1S2ZA 3SH6A 3Q4RA 2CWLA 4LQHA 1TKOA 3NP0X 2IB0A 1Z6OM 3KX9A
chains in the Genus database with same CATH topology
4EVDA 1HRSA 1Z4AA 1RCDA 3IS7A 4W4KB 2V2OA 4LPNA 4TW3A 4LYXA 1NF4A 3PZAA 1S3QA 4M32A 2CN6A 3QHBA 3VNXA 2ZG8X 3M6JA 5GOUA 1SQ3A 5GU3X 3TA8A 4AM2A 2XJMA 3BKNA 3NOZX 4E6KA 3H7GA 2V2PA 2HTNA 3QB9A 1VEIA 4LQNA 2WTLA 1XZ1A 4ETRA 3AK8A 1O9IA 1NF6A 3HL1A 4LPMA 1LB3A 4DI0A 4TOEA 3AJQA 4ZKWA 3KA9A 1JI5A 2N02A 1UVHA 3KA4A 4CYAA 4OYNA 3RD0A 2X170 4M33A 3KA6A 2IU2A 2VXIA 2XJOA 3KXUA 2CN7A 1AEWA 3AF7X 4AM5A 4A25A 1F30A 3KHKA 3O7SA 5GU2X 3GVYA 2CHPA 3E1PA 3IS8A 2YW7A 1ZS3A 3PWQC 5HU6D 3PVTA 3F34A 3N6OA 3PW8A 2HR5A 4DZ0A 1DATA 3D19A 5LS9A 2FKZA 3V3KB 3RE7A 2V2IA 5AXSA 5FFDA 3BVKA 2QQYA 1MFRA 3E1OA 1JREA 2ITBA 4LPJA 4LYUA 4ERUA 1OTKA 4TOFA 4ZJKA 1QYBA 4YVZA 5FFBA 4YXMA 1L8IA 2Z5QA 3E6SA 3U90A 5ERKA 5D8XA 5CZUA 3KA3A 4RC8A 3W54A 2BKCA 5JDOA 4PGIA 3KDQA 4II4B 2C2FA 3F33A 3EZUA 4CMYA 3MPSA 1RCCA 5D8RA 4M35A 3VV9A 4PGKA 5LG2A 5D8OA 2G4HA 5LBHA 5JDOB 3Q4OA 4CVRA 1N1QA 4REUA 2VZBA 3GGYA 4XKUA 4LQJA 4MUDA 2ZG7X 2QF9A 1IERA 3E1JA 3RAVA 4XGSA 4MY7A 5LG8A 4U3GA 2BK6A 3FSEA 4ML5A 3BVIA 2CIHA 4DYZA 4RC5A 1H96A 3JZ9A 3Q4QA 2C2JA 4ZL6A 3L0MA 3E2CA 2WWXB 4RC5B 1Z6OA 3C23A 1RCIA 1LKOA 1GWGA 3SHXA 4ISMA 1DVBA 3AF9X 4TOGA 4MXPA 1VJXA 1LKMA 1EUMA 3GHQA 1VELA 5HQOA 2ZURX 5GU0X 4KVRA 4ZKHA 2OKCA 3SE1A 1ZUJA 4TOHA 1JKUA 3F32A 5GN8A 3UFBA 2UX1A 4M34A 4ZL5A 1LKPA 1QGHA 2V2SA 5J93A 2XGWA 4RC7A 2ZG9X 5GN8B 3R2KA 5GU1X 3A9QA 3HIUA 2IY4A 4EVBA 4ZLWA 3DBYA 4RC7B 5JACA 1RCGA 1VEQA 4QUWA 2Y44A 5IX6A 3GE4A 1JTSA 1TJOA 3F38A 3FVBA 4ITWA 3UOFA 5JKMG 2GYQA 1JYBA 2CEIA 1YUZA 3BVFA 1R03A 5FFAA 4IXKA 1S30A 2XJNA 3R2SA 3KA8A 4EVEA 4TOAA 2F7NA 2MGYA 1YUXA 2OC5A 1NFVA 5D8YA 4W4LB 2FZFA 2AR0A 2W0OA 5HJFA 3EGMA 5FEJA 3C1ZA 1F33A 4AM4A 2JD60 3R2RA 4ISPA 1RCEA 4MKUA 2ZA7A 5JKMA 3PWFA 1TK6A 4CVTA 4DYXA 4II4A 3WVUA 2V8UA 5JKLG 3Q4NA 4YKHA 3RBCA 4RC6A 2ZA8A 2Z90A 4WJG4 3QZ3A 4IWKA 5J8SA 2FJCA 4RC6B 3QD8A 2ZA6A 3C21A 3F36A 2Z5PA 3OJ5A 3PVYA 3ISFA 3JZAB 4DYUA 3PVYB 5JKLA 3ES3A 4DASA 2PYBA 2FG8A 1JIGA 2V2MA 3WVVA 5J9VA 3QHCA 5J8WA 1JI4A 3PW8C 3PW1A 4ITTA 3ISEA 2Z6MA 3F35A 3R2LA 1MOJA 1UMNA 3KWOA 5HJHA 2V2RA 3E1LA 4LQVA 5I4JA 3AF8X 3LKDA 5C6FA 3IQ1A 3F37A 3PW1B 4DE6A 2V8TA 4TOBA 4P18A 2CF7A 3AK9A 2YW6A 3FRRA 4Y08A 2FHAA 1BG7A 1BFRA 3WVWA 1TKPA 4PG0A 1FHAA 2FG4A 2V2LA 5D8PA 5ERJA 3UNOA 2CLBA 3O7RA 4TO9A 4CY9A 3PWQA 2FL0A 1JKVA 3PVRA 4MJYA 2BW1A 2CLUA 3E1QA 3VVAA 3PVRB 3UOIA 3R2OA 3OGHA 2VXXA 5CMQA 3AJPA 4X0JA 3R2MA 2FFXJ 2V15A 4MN9A 5E1UA 2XKQA 2V2JA 3EZ0A 5FFEA 2Y3QA 3E1NA 3AJOA 1XZ3A 1DPSA 3NP2X 5E2DA 2BJYA 3GGZA 4EVCA 3E6RA 3C1YA 4ZTTA 5CMRA 1SOFA 1L8HA 2GS4A 5D8QA 3FRSA 1O9RA 4KVQA 5K52A 3BVEA 2GYDA 2OH3A 4PG1A 4DYYA 4KVSA 5D8SA 4KXRB 4CMYV 4YXJA 4TODA 3R2HA 1B71A 2WLAA 3RGDA 2WLUA 2C2UA 2C41A 3BVLA 2CHIA 3PVTB 4E40A 3A68A 4CVSA 4ZKXA 2C6RA 3F39A 2D5KA 1JGCA 1BCFA 4XKTA 3QVDA 3BT5A 4IWJA 4ZMCA 2G38B 4XKSA 1IESA 3WNWA 2JD70 3T9JA 2Z5RA 5K53A 1KRQA 2RBDA 2YJJA 4Z3BA 3E1MA 5FFCA 1VLGA 4TOCA 2V2NA 1YV1A 2JD80 3ERZA 4Z5SA 4CYBA 1RYTA 3FI6A 3SIDA 4R42A 1J30A 2YJKA 4CVPA 1NNQA 1S2ZA 3SH6A 3Q4RA 2CWLA 4LQHA 1TKOA 3NP0X 2IB0A 1Z6OM 3KX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EVD A;  1HRS A;  1Z4A A;  1RCD A;  3IS7 A;  2V2O A;  4LPN A;  4TW3 A;  4LYX A;  1NF4 A;  3PZA A;  1S3Q A;  4M32 A;  2CN6 A;  3QHB A;  3VNX A;  2ZG8 X;  5GOU A;  1SQ3 A;  5GU3 X;  3TA8 A;  4AM2 A;  2XJM A;  3BKN A;  3NOZ X;  4E6K A;  3H7G A;  2V2P A;  2HTN A;  3QB9 A;  1VEI A;  4LQN A;  2WTL A;  1XZ1 A;  4ETR A;  3AK8 A;  1O9I A;  1NF6 A;  3HL1 A;  4LPM A;  1LB3 A;  4DI0 A;  4TOE A;  3AJQ A;  4ZKW A;  3KA9 A;  1JI5 A;  1UVH A;  3KA4 A;  4CYA A;  4OYN A;  3RD0 A;  2X17 0;  4M33 A;  3KA6 A;  2IU2 A;  2VXI A;  2XJO A;  3KXU A;  2CN7 A;  1AEW A;  3AF7 X;  4AM5 A;  4A25 A;  1F30 A;  3O7S A;  5GU2 X;  3GVY A;  2CHP A;  3E1P A;  3IS8 A;  2YW7 A;  1ZS3 A;  3PWQ C;  3PVT A;  3F34 A;  3PW8 A;  2HR5 A;  4DZ0 A;  1DAT A;  5LS9 A;  2FKZ A;  3RE7 A;  2V2I A;  5AXS A;  5FFD A;  3BVK A;  2QQY A;  1MFR A;  3E1O A;  1JRE A;  2ITB A;  4LPJ A;  4LYU A;  4ERU A;  1OTK A;  4TOF A;  4ZJK A;  1QYB A;  5FFB A;  1L8I A;  2Z5Q A;  3E6S A;  3U90 A;  5ERK A;  5D8X A;  5CZU A;  3KA3 A;  4RC8 A;  2BKC A;  4PGI A;  4II4 B;  2C2F A;  3F33 A;  3EZU A;  4CMY A;  3MPS A;  1RCC A;  5D8R A;  4M35 A;  4PGK A;  5LG2 A;  5D8O A;  2G4H A;  5LBH A;  3Q4O A;  4CVR A;  1N1Q A;  4REU A;  2VZB A;  4XKU A;  4LQJ A;  4MUD A;  2ZG7 X;  2QF9 A;  1IER A;  3E1J A;  3RAV A;  4XGS A;  4MY7 A;  5LG8 A;  4U3G A;  2BK6 A;  3FSE A;  4ML5 A;  3BVI A;  2CIH A;  4DYZ A;  4RC5 A;  1H96 A;  3Q4Q A;  2C2J A;  4ZL6 A;  3E2C A;  4RC5 B;  1Z6O A;  1RCI A;  1LKO A;  1GWG A;  3SHX A;  4ISM A;  1DVB A;  3AF9 X;  4TOG A;  1VJX A;  1LKM A;  1EUM A;  3GHQ A;  1VEL A;  5HQO A;  2ZUR X;  5GU0 X;  4KVR A;  4ZKH A;  3SE1 A;  1ZUJ A;  4TOH A;  1JKU A;  3F32 A;  5GN8 A;  2UX1 A;  4M34 A;  4ZL5 A;  1LKP A;  1QGH A;  2V2S A;  5J93 A;  2XGW A;  4RC7 A;  2ZG9 X;  5GN8 B;  3R2K A;  5GU1 X;  3A9Q A;  3HIU A;  2IY4 A;  4EVB A;  4ZLW A;  4RC7 B;  5JAC A;  1RCG A;  1VEQ A;  4QUW A;  5IX6 A;  3GE4 A;  1JTS A;  1TJO A;  3F38 A;  3FVB A;  4ITW A;  3UOF A;  5JKM G;  2GYQ A;  1JYB A;  2CEI A;  1YUZ A;  3BVF A;  1R03 A;  5FFA A;  4IXK A;  1S30 A;  2XJN A;  3R2S A;  3KA8 A;  4EVE A;  4TOA A;  2F7N A;  1YUX A;  2OC5 A;  1NFV A;  5D8Y A;  2FZF A;  2W0O A;  5HJF A;  3EGM A;  5FEJ A;  1F33 A;  4AM4 A;  2JD6 0;  3R2R A;  4ISP A;  1RCE A;  4MKU A;  2ZA7 A;  5JKM A;  3PWF A;  1TK6 A;  4CVT A;  4DYX A;  4II4 A;  3WVU A;  5JKL G;  3Q4N A;  4YKH A;  3RBC A;  4RC6 A;  2ZA8 A;  2Z90 A;  3QZ3 A;  4IWK A;  5J8S A;  2FJC A;  4RC6 B;  3QD8 A;  2ZA6 A;  3OJ5 A;  3F36 A;  2Z5P A;  3PVY A;  3ISF A;  4DYU A;  3PVY B;  5JKL A;  3ES3 A;  4DAS A;  2PYB A;  2FG8 A;  1JIG A;  2V2M A;  3WVV A;  5J9V A;  3QHC A;  5J8W A;  1JI4 A;  3PW8 C;  3PW1 A;  4ITT A;  3ISE A;  2Z6M A;  3F35 A;  3R2L A;  1MOJ A;  1UMN A;  3KWO A;  5HJH A;  2V2R A;  3E1L A;  4LQV A;  5I4J A;  3AF8 X;  5C6F A;  3IQ1 A;  3F37 A;  3PW1 B;  4DE6 A;  4TOB A;  4P18 A;  2CF7 A;  3AK9 A;  2YW6 A;  4Y08 A;  2FHA A;  1BG7 A;  1BFR A;  3WVW A;  1TKP A;  4PG0 A;  1FHA A;  2FG4 A;  2V2L A;  5D8P A;  5ERJ A;  3UNO A;  2CLB A;  3O7R A;  4TO9 A;  4CY9 A;  3PWQ A;  2FL0 A;  1JKV A;  3PVR A;  4MJY A;  2BW1 A;  2CLU A;  3E1Q A;  3PVR B;  3UOI A;  3R2O A;  3OGH A;  2VXX A;  5CMQ A;  3AJP A;  3R2M A;  2FFX J;  2V15 A;  4MN9 A;  5E1U A;  2XKQ A;  2V2J A;  3EZ0 A;  5FFE A;  2Y3Q A;  3E1N A;  3AJO A;  1XZ3 A;  1DPS A;  3NP2 X;  5E2D A;  2BJY A;  4EVC A;  3E6R A;  4ZTT A;  5CMR A;  1SOF A;  1L8H A;  2GS4 A;  5D8Q A;  1O9R A;  4KVQ A;  5K52 A;  3BVE A;  2GYD A;  2OH3 A;  4PG1 A;  4DYY A;  4KVS A;  5D8S A;  4CMY V;  4TOD A;  3R2H A;  1B71 A;  2WLA A;  3RGD A;  2WLU A;  2C2U A;  2C41 A;  3BVL A;  2CHI A;  3PVT B;  3A68 A;  4CVS A;  4ZKX A;  2C6R A;  3F39 A;  2D5K A;  1JGC A;  1BCF A;  4XKT A;  3QVD A;  3BT5 A;  4IWJ A;  4ZMC A;  4XKS A;  1IES A;  3WNW A;  2JD7 0;  3T9J A;  2Z5R A;  5K53 A;  1KRQ A;  2RBD A;  2YJJ A;  4Z3B A;  3E1M A;  5FFC A;  1VLG A;  4TOC A;  2V2N A;  1YV1 A;  2JD8 0;  3ERZ A;  4Z5S A;  4CYB A;  1RYT A;  3FI6 A;  3SID A;  4R42 A;  1J30 A;  2YJK A;  4CVP A;  1NNQ A;  1S2Z A;  3SH6 A;  3Q4R A;  4LQH A;  1TKO A;  3NP0 X;  2IB0 A;  1Z6O M;  3KX9 A; 
#chains in the Genus database with same CATH topology
 4EVD A;  1HRS A;  1Z4A A;  1RCD A;  3IS7 A;  4W4K B;  2V2O A;  4LPN A;  4TW3 A;  4LYX A;  1NF4 A;  3PZA A;  1S3Q A;  4M32 A;  2CN6 A;  3QHB A;  3VNX A;  2ZG8 X;  3M6J A;  5GOU A;  1SQ3 A;  5GU3 X;  3TA8 A;  4AM2 A;  2XJM A;  3BKN A;  3NOZ X;  4E6K A;  3H7G A;  2V2P A;  2HTN A;  3QB9 A;  1VEI A;  4LQN A;  2WTL A;  1XZ1 A;  4ETR A;  3AK8 A;  1O9I A;  1NF6 A;  3HL1 A;  4LPM A;  1LB3 A;  4DI0 A;  4TOE A;  3AJQ A;  4ZKW A;  3KA9 A;  1JI5 A;  2N02 A;  1UVH A;  3KA4 A;  4CYA A;  4OYN A;  3RD0 A;  2X17 0;  4M33 A;  3KA6 A;  2IU2 A;  2VXI A;  2XJO A;  3KXU A;  2CN7 A;  1AEW A;  3AF7 X;  4AM5 A;  4A25 A;  1F30 A;  3KHK A;  3O7S A;  5GU2 X;  3GVY A;  2CHP A;  3E1P A;  3IS8 A;  2YW7 A;  1ZS3 A;  3PWQ C;  5HU6 D;  3PVT A;  3F34 A;  3N6O A;  3PW8 A;  2HR5 A;  4DZ0 A;  1DAT A;  3D19 A;  5LS9 A;  2FKZ A;  3V3K B;  3RE7 A;  2V2I A;  5AXS A;  5FFD A;  3BVK A;  2QQY A;  1MFR A;  3E1O A;  1JRE A;  2ITB A;  4LPJ A;  4LYU A;  4ERU A;  1OTK A;  4TOF A;  4ZJK A;  1QYB A;  4YVZ A;  5FFB A;  4YXM A;  1L8I A;  2Z5Q A;  3E6S A;  3U90 A;  5ERK A;  5D8X A;  5CZU A;  3KA3 A;  4RC8 A;  3W54 A;  2BKC A;  5JDO A;  4PGI A;  3KDQ A;  4II4 B;  2C2F A;  3F33 A;  3EZU A;  4CMY A;  3MPS A;  1RCC A;  5D8R A;  4M35 A;  3VV9 A;  4PGK A;  5LG2 A;  5D8O A;  2G4H A;  5LBH A;  5JDO B;  3Q4O A;  4CVR A;  1N1Q A;  4REU A;  2VZB A;  3GGY A;  4XKU A;  4LQJ A;  4MUD A;  2ZG7 X;  2QF9 A;  1IER A;  3E1J A;  3RAV A;  4XGS A;  4MY7 A;  5LG8 A;  4U3G A;  2BK6 A;  3FSE A;  4ML5 A;  3BVI A;  2CIH A;  4DYZ A;  4RC5 A;  1H96 A;  3JZ9 A;  3Q4Q A;  2C2J A;  4ZL6 A;  3L0M A;  3E2C A;  2WWX B;  4RC5 B;  1Z6O A;  3C23 A;  1RCI A;  1LKO A;  1GWG A;  3SHX A;  4ISM A;  1DVB A;  3AF9 X;  4TOG A;  4MXP A;  1VJX A;  1LKM A;  1EUM A;  3GHQ A;  1VEL A;  5HQO A;  2ZUR X;  5GU0 X;  4KVR A;  4ZKH A;  2OKC A;  3SE1 A;  1ZUJ A;  4TOH A;  1JKU A;  3F32 A;  5GN8 A;  3UFB A;  2UX1 A;  4M34 A;  4ZL5 A;  1LKP A;  1QGH A;  2V2S A;  5J93 A;  2XGW A;  4RC7 A;  2ZG9 X;  5GN8 B;  3R2K A;  5GU1 X;  3A9Q A;  3HIU A;  2IY4 A;  4EVB A;  4ZLW A;  3DBY A;  4RC7 B;  5JAC A;  1RCG A;  1VEQ A;  4QUW A;  2Y44 A;  5IX6 A;  3GE4 A;  1JTS A;  1TJO A;  3F38 A;  3FVB A;  4ITW A;  3UOF A;  5JKM G;  2GYQ A;  1JYB A;  2CEI A;  1YUZ A;  3BVF A;  1R03 A;  5FFA A;  4IXK A;  1S30 A;  2XJN A;  3R2S A;  3KA8 A;  4EVE A;  4TOA A;  2F7N A;  2MGY A;  1YUX A;  2OC5 A;  1NFV A;  5D8Y A;  4W4L B;  2FZF A;  2AR0 A;  2W0O A;  5HJF A;  3EGM A;  5FEJ A;  3C1Z A;  1F33 A;  4AM4 A;  2JD6 0;  3R2R A;  4ISP A;  1RCE A;  4MKU A;  2ZA7 A;  5JKM A;  3PWF A;  1TK6 A;  4CVT A;  4DYX A;  4II4 A;  3WVU A;  2V8U A;  5JKL G;  3Q4N A;  4YKH A;  3RBC A;  4RC6 A;  2ZA8 A;  2Z90 A;  4WJG 4;  3QZ3 A;  4IWK A;  5J8S A;  2FJC A;  4RC6 B;  3QD8 A;  2ZA6 A;  3C21 A;  3F36 A;  2Z5P A;  3OJ5 A;  3PVY A;  3ISF A;  3JZA B;  4DYU A;  3PVY B;  5JKL A;  3ES3 A;  4DAS A;  2PYB A;  2FG8 A;  1JIG A;  2V2M A;  3WVV A;  5J9V A;  3QHC A;  5J8W A;  1JI4 A;  3PW8 C;  3PW1 A;  4ITT A;  3ISE A;  2Z6M A;  3F35 A;  3R2L A;  1MOJ A;  1UMN A;  3KWO A;  5HJH A;  2V2R A;  3E1L A;  4LQV A;  5I4J A;  3AF8 X;  3LKD A;  5C6F A;  3IQ1 A;  3F37 A;  3PW1 B;  4DE6 A;  2V8T A;  4TOB A;  4P18 A;  2CF7 A;  3AK9 A;  2YW6 A;  3FRR A;  4Y08 A;  2FHA A;  1BG7 A;  1BFR A;  3WVW A;  1TKP A;  4PG0 A;  1FHA A;  2FG4 A;  2V2L A;  5D8P A;  5ERJ A;  3UNO A;  2CLB A;  3O7R A;  4TO9 A;  4CY9 A;  3PWQ A;  2FL0 A;  1JKV A;  3PVR A;  4MJY A;  2BW1 A;  2CLU A;  3E1Q A;  3VVA A;  3PVR B;  3UOI A;  3R2O A;  3OGH A;  2VXX A;  5CMQ A;  3AJP A;  4X0J A;  3R2M A;  2FFX J;  2V15 A;  4MN9 A;  5E1U A;  2XKQ A;  2V2J A;  3EZ0 A;  5FFE A;  2Y3Q A;  3E1N A;  3AJO A;  1XZ3 A;  1DPS A;  3NP2 X;  5E2D A;  2BJY A;  3GGZ A;  4EVC A;  3E6R A;  3C1Y A;  4ZTT A;  5CMR A;  1SOF A;  1L8H A;  2GS4 A;  5D8Q A;  3FRS A;  1O9R A;  4KVQ A;  5K52 A;  3BVE A;  2GYD A;  2OH3 A;  4PG1 A;  4DYY A;  4KVS A;  5D8S A;  4KXR B;  4CMY V;  4YXJ A;  4TOD A;  3R2H A;  1B71 A;  2WLA A;  3RGD A;  2WLU A;  2C2U A;  2C41 A;  3BVL A;  2CHI A;  3PVT B;  4E40 A;  3A68 A;  4CVS A;  4ZKX A;  2C6R A;  3F39 A;  2D5K A;  1JGC A;  1BCF A;  4XKT A;  3QVD A;  3BT5 A;  4IWJ A;  4ZMC A;  2G38 B;  4XKS A;  1IES A;  3WNW A;  2JD7 0;  3T9J A;  2Z5R A;  5K53 A;  1KRQ A;  2RBD A;  2YJJ A;  4Z3B A;  3E1M A;  5FFC A;  1VLG A;  4TOC A;  2V2N A;  1YV1 A;  2JD8 0;  3ERZ A;  4Z5S A;  4CYB A;  1RYT A;  3FI6 A;  3SID A;  4R42 A;  1J30 A;  2YJK A;  4CVP A;  1NNQ A;  1S2Z A;  3SH6 A;  3Q4R A;  2CWL A;  4LQH A;  1TKO A;  3NP0 X;  2IB0 A;  1Z6O M;  3KX9 A; 
#chains in the Genus database with same CATH homology
 4EVD A;  1HRS A;  1Z4A A;  1RCD A;  3IS7 A;  4W4K B;  2V2O A;  4LPN A;  4TW3 A;  4LYX A;  1NF4 A;  3PZA A;  1S3Q A;  4M32 A;  2CN6 A;  3QHB A;  3VNX A;  2ZG8 X;  3M6J A;  5GOU A;  1SQ3 A;  5GU3 X;  3TA8 A;  4AM2 A;  2XJM A;  3BKN A;  3NOZ X;  4E6K A;  3H7G A;  2V2P A;  2HTN A;  3QB9 A;  1VEI A;  4LQN A;  2WTL A;  1XZ1 A;  4ETR A;  3AK8 A;  1O9I A;  1NF6 A;  3HL1 A;  4LPM A;  1LB3 A;  4DI0 A;  4TOE A;  3AJQ A;  4ZKW A;  3KA9 A;  1JI5 A;  2N02 A;  1UVH A;  3KA4 A;  4CYA A;  4OYN A;  3RD0 A;  2X17 0;  4M33 A;  3KA6 A;  2IU2 A;  2VXI A;  2XJO A;  3KXU A;  2CN7 A;  1AEW A;  3AF7 X;  4AM5 A;  4A25 A;  1F30 A;  3KHK A;  3O7S A;  5GU2 X;  3GVY A;  2CHP A;  3E1P A;  3IS8 A;  2YW7 A;  1ZS3 A;  3PWQ C;  5HU6 D;  3PVT A;  3F34 A;  3N6O A;  3PW8 A;  2HR5 A;  4DZ0 A;  1DAT A;  3D19 A;  5LS9 A;  2FKZ A;  3V3K B;  3RE7 A;  2V2I A;  5AXS A;  5FFD A;  3BVK A;  2QQY A;  1MFR A;  3E1O A;  1JRE A;  2ITB A;  4LPJ A;  4LYU A;  4ERU A;  1OTK A;  4TOF A;  4ZJK A;  1QYB A;  4YVZ A;  5FFB A;  4YXM A;  1L8I A;  2Z5Q A;  3E6S A;  3U90 A;  5ERK A;  5D8X A;  5CZU A;  3KA3 A;  4RC8 A;  3W54 A;  2BKC A;  5JDO A;  4PGI A;  3KDQ A;  4II4 B;  2C2F A;  3F33 A;  3EZU A;  4CMY A;  3MPS A;  1RCC A;  5D8R A;  4M35 A;  3VV9 A;  4PGK A;  5LG2 A;  5D8O A;  2G4H A;  5LBH A;  5JDO B;  3Q4O A;  4CVR A;  1N1Q A;  4REU A;  2VZB A;  3GGY A;  4XKU A;  4LQJ A;  4MUD A;  2ZG7 X;  2QF9 A;  1IER A;  3E1J A;  3RAV A;  4XGS A;  4MY7 A;  5LG8 A;  4U3G A;  2BK6 A;  3FSE A;  4ML5 A;  3BVI A;  2CIH A;  4DYZ A;  4RC5 A;  1H96 A;  3JZ9 A;  3Q4Q A;  2C2J A;  4ZL6 A;  3L0M A;  3E2C A;  2WWX B;  4RC5 B;  1Z6O A;  3C23 A;  1RCI A;  1LKO A;  1GWG A;  3SHX A;  4ISM A;  1DVB A;  3AF9 X;  4TOG A;  4MXP A;  1VJX A;  1LKM A;  1EUM A;  3GHQ A;  1VEL A;  5HQO A;  2ZUR X;  5GU0 X;  4KVR A;  4ZKH A;  2OKC A;  3SE1 A;  1ZUJ A;  4TOH A;  1JKU A;  3F32 A;  5GN8 A;  3UFB A;  2UX1 A;  4M34 A;  4ZL5 A;  1LKP A;  1QGH A;  2V2S A;  5J93 A;  2XGW A;  4RC7 A;  2ZG9 X;  5GN8 B;  3R2K A;  5GU1 X;  3A9Q A;  3HIU A;  2IY4 A;  4EVB A;  4ZLW A;  3DBY A;  4RC7 B;  5JAC A;  1RCG A;  1VEQ A;  4QUW A;  2Y44 A;  5IX6 A;  3GE4 A;  1JTS A;  1TJO A;  3F38 A;  3FVB A;  4ITW A;  3UOF A;  5JKM G;  2GYQ A;  1JYB A;  2CEI A;  1YUZ A;  3BVF A;  1R03 A;  5FFA A;  4IXK A;  1S30 A;  2XJN A;  3R2S A;  3KA8 A;  4EVE A;  4TOA A;  2F7N A;  2MGY A;  1YUX A;  2OC5 A;  1NFV A;  5D8Y A;  4W4L B;  2FZF A;  2AR0 A;  2W0O A;  5HJF A;  3EGM A;  5FEJ A;  3C1Z A;  1F33 A;  4AM4 A;  2JD6 0;  3R2R A;  4ISP A;  1RCE A;  4MKU A;  2ZA7 A;  5JKM A;  3PWF A;  1TK6 A;  4CVT A;  4DYX A;  4II4 A;  3WVU A;  2V8U A;  5JKL G;  3Q4N A;  4YKH A;  3RBC A;  4RC6 A;  2ZA8 A;  2Z90 A;  4WJG 4;  3QZ3 A;  4IWK A;  5J8S A;  2FJC A;  4RC6 B;  3QD8 A;  2ZA6 A;  3C21 A;  3F36 A;  2Z5P A;  3OJ5 A;  3PVY A;  3ISF A;  3JZA B;  4DYU A;  3PVY B;  5JKL A;  3ES3 A;  4DAS A;  2PYB A;  2FG8 A;  1JIG A;  2V2M A;  3WVV A;  5J9V A;  3QHC A;  5J8W A;  1JI4 A;  3PW8 C;  3PW1 A;  4ITT A;  3ISE A;  2Z6M A;  3F35 A;  3R2L A;  1MOJ A;  1UMN A;  3KWO A;  5HJH A;  2V2R A;  3E1L A;  4LQV A;  5I4J A;  3AF8 X;  3LKD A;  5C6F A;  3IQ1 A;  3F37 A;  3PW1 B;  4DE6 A;  2V8T A;  4TOB A;  4P18 A;  2CF7 A;  3AK9 A;  2YW6 A;  3FRR A;  4Y08 A;  2FHA A;  1BG7 A;  1BFR A;  3WVW A;  1TKP A;  4PG0 A;  1FHA A;  2FG4 A;  2V2L A;  5D8P A;  5ERJ A;  3UNO A;  2CLB A;  3O7R A;  4TO9 A;  4CY9 A;  3PWQ A;  2FL0 A;  1JKV A;  3PVR A;  4MJY A;  2BW1 A;  2CLU A;  3E1Q A;  3VVA A;  3PVR B;  3UOI A;  3R2O A;  3OGH A;  2VXX A;  5CMQ A;  3AJP A;  4X0J A;  3R2M A;  2FFX J;  2V15 A;  4MN9 A;  5E1U A;  2XKQ A;  2V2J A;  3EZ0 A;  5FFE A;  2Y3Q A;  3E1N A;  3AJO A;  1XZ3 A;  1DPS A;  3NP2 X;  5E2D A;  2BJY A;  3GGZ A;  4EVC A;  3E6R A;  3C1Y A;  4ZTT A;  5CMR A;  1SOF A;  1L8H A;  2GS4 A;  5D8Q A;  3FRS A;  1O9R A;  4KVQ A;  5K52 A;  3BVE A;  2GYD A;  2OH3 A;  4PG1 A;  4DYY A;  4KVS A;  5D8S A;  4KXR B;  4CMY V;  4YXJ A;  4TOD A;  3R2H A;  1B71 A;  2WLA A;  3RGD A;  2WLU A;  2C2U A;  2C41 A;  3BVL A;  2CHI A;  3PVT B;  4E40 A;  3A68 A;  4CVS A;  4ZKX A;  2C6R A;  3F39 A;  2D5K A;  1JGC A;  1BCF A;  4XKT A;  3QVD A;  3BT5 A;  4IWJ A;  4ZMC A;  2G38 B;  4XKS A;  1IES A;  3WNW A;  2JD7 0;  3T9J A;  2Z5R A;  5K53 A;  1KRQ A;  2RBD A;  2YJJ A;  4Z3B A;  3E1M A;  5FFC A;  1VLG A;  4TOC A;  2V2N A;  1YV1 A;  2JD8 0;  3ERZ A;  4Z5S A;  4CYB A;  1RYT A;  3FI6 A;  3SID A;  4R42 A;  1J30 A;  2YJK A;  4CVP A;  1NNQ A;  1S2Z A;  3SH6 A;  3Q4R A;  2CWL A;  4LQH A;  1TKO A;  3NP0 X;  2IB0 A;  1Z6O M;  3KX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...