3AK8A

Crystal structure of the sep22 dodecamer, a dps-like protein from salmonella enterica subsp. enterica serovar enteritidis
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
154
structure length
154
Chain Sequence
LLYTRNDVSESDKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALTDHLDTMAERAVQLGGVALGTTQVINSKTPLKSYPLDIHNVQDHLKELADRYAVVANDVRKAIGEAKDEDTADIFTAASRDLDKFLWFIESNIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein, oxidoreductase
molecule keywords DNA protection during starvation protein
publication title Structures of the SEp22 dodecamer, a Dps-like protein from Salmonella enterica subsp. enterica serovar Enteritidis
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar kentucky
total genus 68
structure length 154
sequence length 154
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.16.-.-:
pdb deposition date 2010-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3ak8A00
3R2OA 2ZURX 4EVEA 4LPMA 4TOEA 3UNOA 4ZKXA 4TW3A 1OTKA 2V2PA 2C2UA 3BVFA 1VLGA 2G4HA 2CF7A 4LPNA 1Z6OM 4ISMA 3F35A 3R2MA 4DYXA 1TJOA 1JYBA 1Z4AA 3E1MA 4LYXA 3R2RA 3PWQA 3F38A 2CIHA 5CMQA 1MFRA 3ES3A 3BVEA 4M32A 1LB3A 4ML5A 2F7NA 5LG2A 4RC7B 3KWOA 2XKQA 3WVUA 4P18A 2IB0A 3FVBA 3MPSA 5K52A 1FHAA 2FKZA 2UX1A 4CYBA 1JREA 4Z5SA 1ZS3A 2V2IA 2IU2A 4IXKA 4II4A 3AK8A 2Z5PA 2V2NA 4AM2A 4Y08A 2FFXJ 4EVDA 3Q4NA 2HR5A 4ZKHA 3TA8A 3AF7X 1UVHA 5D8PA 5HJHA 4R42A 3NP2X 4PGKA 4CVSA 1JI4A 4CVTA 3E6RA 4DZ0A 4MN9A 1LKOA 1O9IA 3OJ5A 3O7RA 4AM5A 4ZJKA 3QB9A 5I4JA 2WTLA 2RBDA 4CMYV 1F33A 3PW1A 1SOFA 4MJYA 3U90A 3BKNA 4CVPA 3IQ1A 1JKUA 2YJJA 5GN8A 2BJYA 5K53A 1VELA 4TOBA 5D8OA 5GOUA 2OC5A 1L8HA 5GU0X 4CMYA 4IWKA 4LYUA 3WNWA 2W0OA 5FEJA 2V2OA 2VZBA 2GYDA 2CN7A 5JKMA 1NF6A 4LPJA 5AXSA 4MY7A 4ERUA 3KA9A 3NP0X 3H7GA 3RE7A 5GU2X 1L8IA 2Z6MA 3R2SA 3EGMA 1NNQA 5LBHA 4ETRA 4PGIA 4OYNA 1DVBA 2WLUA 1QYBA 4YKHA 2V2LA 1S3QA 4XKTA 1XZ1A 3E1OA 4U3GA 5D8XA 5JACA 3NOZX 3HL1A 4ZMCA 3IS8A 1NFVA 3FSEA 4PG1A 1JIGA 4CY9A 5ERKA 3FI6A 4RC7A 3SH6A 4TOHA 4ZL5A 1LKMA 5JKLG 3E1PA 3OGHA 4MUDA 3E1NA 2ZA8A 2JD60 1VJXA 3A68A 5ERJA 4DYYA 4M33A 4Z3BA 5J93A 4TOCA 2FG8A 4RC5A 4ISPA 3R2KA 4E6KA 1NF4A 3BVLA 3RAVA 1JI5A 3ERZA 5C6FA 4CYAA 4LQNA 3QHBA 1YV1A 3RD0A 5D8SA 2FG4A 2FJCA 3T9JA 2V2MA 3AF8X 4MKUA 5D8YA 3A9QA 3F37A 5HQOA 2ZG9X 1UMNA 3KA6A 2GYQA 2OH3A 3Q4RA 1IERA 3PWFA 4RC6A 1RCEA 2YW6A 5J8WA 4ITTA 1HRSA 4RC8A 3BVKA 2ZG8X 4AM4A 3F32A 5J9VA 5GU1X 2Z5RA 3F33A 3GHQA 2Z90A 1TKPA 3WVVA 1RCIA 1YUXA 2QF9A 1SQ3A 3PVYB 3F34A 3SHXA 2PYBA 3EZ0A 3BVIA 2X170 2Y3QA 1IESA 2GS4A 4LQHA 5LS9A 2CHIA 3AK9A 2VXXA 3E2CA 4TOAA 2C41A 2D5KA 5D8RA 3RBCA 4A25A 3R2HA 1QGHA 2C2JA 4DYUA 1GWGA 3PW8C 4TO9A 3QD8A 1RCGA 2YJKA 4EVCA 4XKSA 4ZL6A 4IWJA 1JGCA 5FFBA 2XJMA 4KVSA 4KVQA 4EVBA 2CHPA 4DE6A 3GE4A 3SE1A 3AJQA 2ZG7X 2FL0A 1BFRA 3IS7A 3QVDA 1EUMA 3PVRB 4ZKWA 4TODA 1B71A 3PW1B 3BT5A 3RGDA 2XJNA 3KXUA 3AJPA 2CN6A 5JKLA 4DASA 1S2ZA 3HIUA 2V15A 3E6SA 4LQVA 3ISFA 3GVYA 3ISEA 3UOIA 2V2JA 4DI0A 3Q4QA 5GU3X 3F39A 2ZA6A 3AF9X 3EZUA 2Z5QA 2HTNA 4XGSA 3PVTB 1VEIA 3F36A 4REUA 1O9RA 5J8SA 1J30A 1DATA 2IY4A 2ITBA 2JD70 5FFEA 1TKOA 1AEWA 5LG8A 3PVYA 2CEIA 3E1JA 3PWQC 5E2DA 1XZ3A 2CLBA 2CLUA 1Z6OA 2JD80 1TK6A 2BKCA 2XGWA 3PZAA 4ITWA 4LQJA 3WVWA 4TOFA 1S30A 1DPSA 3QZ3A 1LKPA 2FZFA 3UOFA 5CMRA 5D8QA 4RC5B 5HJFA 3PW8A 2C2FA 3E1LA 4KVRA 2VXIA 1N1QA 3KX9A 3QHCA 4TOGA 3KA4A 1MOJA 4II4B 1JTSA 1BG7A 3PVRA 5IX6A 3KA8A 3AJOA 5FFDA 4QUWA 2YW7A 2ZA7A 1BCFA 2V2SA 4DYZA 4ZLWA 4M34A 4XKUA 4PG0A 4RC6B 2WLAA 1ZUJA 4CVRA 1YUZA 3O7SA 2FHAA 5E1UA 1RCDA 2V2RA 1R03A 4ZTTA 2BK6A 3E1QA 2XJOA 1F30A 1RCCA 1JKVA 5GN8B 2QQYA 4M35A 1RYTA 2BW1A 5CZUA 1KRQA 3SIDA 2C6RA 3PVTA 5FFCA 5JKMG 3R2LA 3VNXA 1H96A 1VEQA 5FFAA 3KA3A 3Q4OA
chains in the Genus database with same CATH superfamily
3C1YA 3R2OA 2ZURX 4EVEA 4LPMA 4TOEA 3UNOA 4ZKXA 4TW3A 1OTKA 2V2PA 2C2UA 3BVFA 1VLGA 2G4HA 2CF7A 4LPNA 1Z6OM 4ISMA 3F35A 3R2MA 4DYXA 1TJOA 3V3KB 1JYBA 1Z4AA 3E1MA 4LYXA 3R2RA 3PWQA 3F38A 2CIHA 5CMQA 4WJG4 1MFRA 3ES3A 3BVEA 4M32A 3C1ZA 1LB3A 4ML5A 2F7NA 5LG2A 4RC7B 3KWOA 2XKQA 3WVUA 4P18A 2IB0A 3FVBA 3FRSA 3MPSA 5K52A 1FHAA 2FKZA 2UX1A 4CYBA 1JREA 4Z5SA 1ZS3A 2V2IA 2IU2A 4IXKA 4II4A 3AK8A 2Z5PA 2Y44A 2V2NA 4AM2A 4Y08A 2FFXJ 4EVDA 3Q4NA 2HR5A 3GGZA 4ZKHA 3TA8A 3AF7X 1UVHA 5D8PA 5HJHA 4R42A 3NP2X 4PGKA 4CVSA 1JI4A 4CVTA 3E6RA 4DZ0A 4MN9A 1LKOA 1O9IA 3OJ5A 3O7RA 4AM5A 4ZJKA 3QB9A 5I4JA 2WTLA 2RBDA 3M6JA 4CMYV 1F33A 3PW1A 1SOFA 4MJYA 3U90A 3BKNA 4CVPA 3IQ1A 1JKUA 2YJJA 5GN8A 2BJYA 5K53A 1VELA 4MXPA 4TOBA 5D8OA 5GOUA 2OC5A 1L8HA 5GU0X 4CMYA 4IWKA 4LYUA 3WNWA 2W0OA 2WWXB 5FEJA 3D19A 2V2OA 2VZBA 2GYDA 2CN7A 5JKMA 1NF6A 3DBYA 4LPJA 3W54A 5AXSA 4MY7A 4ERUA 3KA9A 3NP0X 3H7GA 3RE7A 2OKCA 2V8TA 5GU2X 2G38B 1L8IA 2AR0A 2Z6MA 3EGMA 3R2SA 1NNQA 5LBHA 4ETRA 4PGIA 4OYNA 1DVBA 2WLUA 1QYBA 4YKHA 5HU6D 2V2LA 1S3QA 4XKTA 1XZ1A 3E1OA 4U3GA 5D8XA 4KXRB 5JACA 3NOZX 3HL1A 4ZMCA 3IS8A 1NFVA 4X0JA 3FSEA 4PG1A 1JIGA 4CY9A 5ERKA 3FI6A 4RC7A 3SH6A 4TOHA 4ZL5A 1LKMA 5JKLG 3E1PA 3OGHA 4MUDA 3E1NA 2ZA8A 2JD60 1VJXA 3A68A 5ERJA 2N02A 4DYYA 3C23A 4M33A 4Z3BA 5J93A 4TOCA 2FG8A 2CWLA 4RC5A 4ISPA 3R2KA 4E6KA 1NF4A 3BVLA 3RAVA 1JI5A 3ERZA 5C6FA 4CYAA 4LQNA 3QHBA 1YV1A 3RD0A 5D8SA 2FG4A 2FJCA 3T9JA 2V2MA 3AF8X 4MKUA 5D8YA 3A9QA 3F37A 5HQOA 2ZG9X 1UMNA 3KA6A 2GYQA 2OH3A 3Q4RA 1IERA 3PWFA 4RC6A 1RCEA 2YW6A 5J8WA 4ITTA 5JDOB 1HRSA 4RC8A 3BVKA 2ZG8X 4AM4A 3F32A 5J9VA 5GU1X 2Z5RA 3F33A 2V8UA 3GHQA 2Z90A 1TKPA 3WVVA 1RCIA 1YUXA 2QF9A 1SQ3A 3PVYB 3F34A 3SHXA 2PYBA 3EZ0A 3KHKA 3BVIA 2X170 2Y3QA 1IESA 2GS4A 4LQHA 5LS9A 2CHIA 3AK9A 3VVAA 2VXXA 3E2CA 4TOAA 2C41A 2D5KA 5D8RA 3RBCA 4A25A 3R2HA 1QGHA 2C2JA 4DYUA 1GWGA 3PW8C 4TO9A 4YXMA 3QD8A 1RCGA 2YJKA 4EVCA 4XKSA 4ZL6A 4IWJA 1JGCA 5FFBA 2XJMA 4KVSA 4KVQA 4EVBA 2CHPA 3L0MA 4DE6A 3GE4A 3SE1A 3AJQA 2ZG7X 2FL0A 3N6OA 1BFRA 3IS7A 3QVDA 1EUMA 3PVRB 4ZKWA 4TODA 4E40A 1B71A 3PW1B 3BT5A 2MGYA 3RGDA 2XJNA 3KXUA 3AJPA 2CN6A 5JKLA 4DASA 3UFBA 1S2ZA 3HIUA 2V15A 3E6SA 4LQVA 3ISFA 3GVYA 3ISEA 3UOIA 2V2JA 4DI0A 3Q4QA 5GU3X 3F39A 2ZA6A 3AF9X 3EZUA 2Z5QA 2HTNA 3FRRA 4XGSA 3PVTB 1VEIA 3F36A 4REUA 1O9RA 5J8SA 5JDOA 1J30A 1DATA 2IY4A 2ITBA 2JD70 5FFEA 1TKOA 1AEWA 5LG8A 3PVYA 2CEIA 3E1JA 3VV9A 3PWQC 3GGYA 5E2DA 1XZ3A 2CLBA 2CLUA 1Z6OA 2JD80 1TK6A 2BKCA 2XGWA 3PZAA 4ITWA 4LQJA 3WVWA 4TOFA 1S30A 1DPSA 3QZ3A 1LKPA 2FZFA 3UOFA 3JZAB 5CMRA 5D8QA 4RC5B 4W4LB 5HJFA 3PW8A 2C2FA 3E1LA 4KVRA 2VXIA 3KDQA 1N1QA 3KX9A 3QHCA 4TOGA 3KA4A 1MOJA 4II4B 1JTSA 1BG7A 3PVRA 5IX6A 3KA8A 3AJOA 5FFDA 4QUWA 2YW7A 2ZA7A 1BCFA 2V2SA 4DYZA 4ZLWA 4M34A 4XKUA 4PG0A 4RC6B 4W4KB 2WLAA 1ZUJA 4YXJA 4CVRA 1YUZA 3O7SA 2FHAA 5E1UA 1RCDA 2V2RA 1R03A 4ZTTA 2BK6A 3LKDA 3E1QA 2XJOA 1F30A 1RCCA 1JKVA 5GN8B 2QQYA 4M35A 4YVZA 1RYTA 2BW1A 5CZUA 1KRQA 3SIDA 2C6RA 3PVTA 3JZ9A 5FFCA 5JKMG 3R2LA 3VNXA 1H96A 1VEQA 3C21A 5FFAA 3KA3A 3Q4OA
chains in the Genus database with same CATH topology
3C1YA 3R2OA 2ZURX 4EVEA 4LPMA 4TOEA 3UNOA 4ZKXA 4TW3A 1OTKA 2V2PA 2C2UA 3BVFA 1VLGA 2G4HA 2CF7A 4LPNA 1Z6OM 4ISMA 3F35A 3R2MA 4DYXA 1TJOA 3V3KB 1JYBA 1Z4AA 3E1MA 4LYXA 3R2RA 3PWQA 3F38A 2CIHA 5CMQA 4WJG4 1MFRA 3ES3A 3BVEA 4M32A 3C1ZA 1LB3A 4ML5A 2F7NA 5LG2A 4RC7B 3KWOA 2XKQA 3WVUA 4P18A 2IB0A 3FVBA 3FRSA 3MPSA 5K52A 1FHAA 2FKZA 2UX1A 4CYBA 1JREA 4Z5SA 1ZS3A 2V2IA 2IU2A 4IXKA 4II4A 3AK8A 2Z5PA 2Y44A 2V2NA 4AM2A 4Y08A 2FFXJ 4EVDA 3Q4NA 2HR5A 3GGZA 4ZKHA 3TA8A 3AF7X 1UVHA 5D8PA 5HJHA 4R42A 3NP2X 4PGKA 4CVSA 1JI4A 4CVTA 3E6RA 4DZ0A 4MN9A 1LKOA 1O9IA 3OJ5A 3O7RA 4AM5A 4ZJKA 3QB9A 5I4JA 2WTLA 2RBDA 3M6JA 4CMYV 1F33A 3PW1A 1SOFA 4MJYA 3U90A 3BKNA 4CVPA 3IQ1A 1JKUA 2YJJA 5GN8A 2BJYA 5K53A 1VELA 4MXPA 4TOBA 5D8OA 5GOUA 2OC5A 1L8HA 5GU0X 4CMYA 4IWKA 4LYUA 3WNWA 2W0OA 2WWXB 5FEJA 3D19A 2V2OA 2VZBA 2GYDA 2CN7A 5JKMA 1NF6A 3DBYA 4LPJA 3W54A 5AXSA 4MY7A 4ERUA 3KA9A 3NP0X 3H7GA 3RE7A 2OKCA 2V8TA 5GU2X 2G38B 1L8IA 2AR0A 2Z6MA 3EGMA 3R2SA 1NNQA 5LBHA 4ETRA 4PGIA 4OYNA 1DVBA 2WLUA 1QYBA 4YKHA 5HU6D 2V2LA 1S3QA 4XKTA 1XZ1A 3E1OA 4U3GA 5D8XA 4KXRB 5JACA 3NOZX 3HL1A 4ZMCA 3IS8A 1NFVA 4X0JA 3FSEA 4PG1A 1JIGA 4CY9A 5ERKA 3FI6A 4RC7A 3SH6A 4TOHA 4ZL5A 1LKMA 5JKLG 3E1PA 3OGHA 4MUDA 3E1NA 2ZA8A 2JD60 1VJXA 3A68A 5ERJA 2N02A 4DYYA 3C23A 4M33A 4Z3BA 5J93A 4TOCA 2FG8A 2CWLA 4RC5A 4ISPA 3R2KA 4E6KA 1NF4A 3BVLA 3RAVA 1JI5A 3ERZA 5C6FA 4CYAA 4LQNA 3QHBA 1YV1A 3RD0A 5D8SA 2FG4A 2FJCA 3T9JA 2V2MA 3AF8X 4MKUA 5D8YA 3A9QA 3F37A 5HQOA 2ZG9X 1UMNA 3KA6A 2GYQA 2OH3A 3Q4RA 1IERA 3PWFA 4RC6A 1RCEA 2YW6A 5J8WA 4ITTA 5JDOB 1HRSA 4RC8A 3BVKA 2ZG8X 4AM4A 3F32A 5J9VA 5GU1X 2Z5RA 3F33A 2V8UA 3GHQA 2Z90A 1TKPA 3WVVA 1RCIA 1YUXA 2QF9A 1SQ3A 3PVYB 3F34A 3SHXA 2PYBA 3EZ0A 3KHKA 3BVIA 2X170 2Y3QA 1IESA 2GS4A 4LQHA 5LS9A 2CHIA 3AK9A 3VVAA 2VXXA 3E2CA 4TOAA 2C41A 2D5KA 5D8RA 3RBCA 4A25A 3R2HA 1QGHA 2C2JA 4DYUA 1GWGA 3PW8C 4TO9A 4YXMA 3QD8A 1RCGA 2YJKA 4EVCA 4XKSA 4ZL6A 4IWJA 1JGCA 5FFBA 2XJMA 4KVSA 4KVQA 4EVBA 2CHPA 3L0MA 4DE6A 3GE4A 3SE1A 3AJQA 2ZG7X 2FL0A 3N6OA 1BFRA 3IS7A 3QVDA 1EUMA 3PVRB 4ZKWA 4TODA 4E40A 1B71A 3PW1B 3BT5A 2MGYA 3RGDA 2XJNA 3KXUA 3AJPA 2CN6A 5JKLA 4DASA 3UFBA 1S2ZA 3HIUA 2V15A 3E6SA 4LQVA 3ISFA 3GVYA 3ISEA 3UOIA 2V2JA 4DI0A 3Q4QA 5GU3X 3F39A 2ZA6A 3AF9X 3EZUA 2Z5QA 2HTNA 3FRRA 4XGSA 3PVTB 1VEIA 3F36A 4REUA 1O9RA 5J8SA 5JDOA 1J30A 1DATA 2IY4A 2ITBA 2JD70 5FFEA 1TKOA 1AEWA 5LG8A 3PVYA 2CEIA 3E1JA 3VV9A 3PWQC 3GGYA 5E2DA 1XZ3A 2CLBA 2CLUA 1Z6OA 2JD80 1TK6A 2BKCA 2XGWA 3PZAA 4ITWA 4LQJA 3WVWA 4TOFA 1S30A 1DPSA 3QZ3A 1LKPA 2FZFA 3UOFA 3JZAB 5CMRA 5D8QA 4RC5B 4W4LB 5HJFA 3PW8A 2C2FA 3E1LA 4KVRA 2VXIA 3KDQA 1N1QA 3KX9A 3QHCA 4TOGA 3KA4A 1MOJA 4II4B 1JTSA 1BG7A 3PVRA 5IX6A 3KA8A 3AJOA 5FFDA 4QUWA 2YW7A 2ZA7A 1BCFA 2V2SA 4DYZA 4ZLWA 4M34A 4XKUA 4PG0A 4RC6B 4W4KB 2WLAA 1ZUJA 4YXJA 4CVRA 1YUZA 3O7SA 2FHAA 5E1UA 1RCDA 2V2RA 1R03A 4ZTTA 2BK6A 3LKDA 3E1QA 2XJOA 1F30A 1RCCA 1JKVA 5GN8B 2QQYA 4M35A 4YVZA 1RYTA 2BW1A 5CZUA 1KRQA 3SIDA 2C6RA 3PVTA 3JZ9A 5FFCA 5JKMG 3R2LA 3VNXA 1H96A 1VEQA 3C21A 5FFAA 3KA3A 3Q4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R2O A;  2ZUR X;  4EVE A;  4LPM A;  4TOE A;  3UNO A;  4ZKX A;  4TW3 A;  1OTK A;  2V2P A;  2C2U A;  3BVF A;  1VLG A;  2G4H A;  2CF7 A;  4LPN A;  1Z6O M;  4ISM A;  3F35 A;  3R2M A;  4DYX A;  1TJO A;  1JYB A;  1Z4A A;  3E1M A;  4LYX A;  3R2R A;  3PWQ A;  3F38 A;  2CIH A;  5CMQ A;  1MFR A;  3ES3 A;  3BVE A;  4M32 A;  1LB3 A;  4ML5 A;  2F7N A;  5LG2 A;  4RC7 B;  3KWO A;  2XKQ A;  3WVU A;  4P18 A;  2IB0 A;  3FVB A;  3MPS A;  5K52 A;  1FHA A;  2FKZ A;  2UX1 A;  4CYB A;  1JRE A;  4Z5S A;  1ZS3 A;  2V2I A;  2IU2 A;  4IXK A;  4II4 A;  3AK8 A;  2Z5P A;  2V2N A;  4AM2 A;  4Y08 A;  2FFX J;  4EVD A;  3Q4N A;  2HR5 A;  4ZKH A;  3TA8 A;  3AF7 X;  1UVH A;  5D8P A;  5HJH A;  4R42 A;  3NP2 X;  4PGK A;  4CVS A;  1JI4 A;  4CVT A;  3E6R A;  4DZ0 A;  4MN9 A;  1LKO A;  1O9I A;  3OJ5 A;  3O7R A;  4AM5 A;  4ZJK A;  3QB9 A;  5I4J A;  2WTL A;  2RBD A;  4CMY V;  1F33 A;  3PW1 A;  1SOF A;  4MJY A;  3U90 A;  3BKN A;  4CVP A;  3IQ1 A;  1JKU A;  2YJJ A;  5GN8 A;  2BJY A;  5K53 A;  1VEL A;  4TOB A;  5D8O A;  5GOU A;  2OC5 A;  1L8H A;  5GU0 X;  4CMY A;  4IWK A;  4LYU A;  3WNW A;  2W0O A;  5FEJ A;  2V2O A;  2VZB A;  2GYD A;  2CN7 A;  5JKM A;  1NF6 A;  4LPJ A;  5AXS A;  4MY7 A;  4ERU A;  3KA9 A;  3NP0 X;  3H7G A;  3RE7 A;  5GU2 X;  1L8I A;  2Z6M A;  3R2S A;  3EGM A;  1NNQ A;  5LBH A;  4ETR A;  4PGI A;  4OYN A;  1DVB A;  2WLU A;  1QYB A;  4YKH A;  2V2L A;  1S3Q A;  4XKT A;  1XZ1 A;  3E1O A;  4U3G A;  5D8X A;  5JAC A;  3NOZ X;  3HL1 A;  4ZMC A;  3IS8 A;  1NFV A;  3FSE A;  4PG1 A;  1JIG A;  4CY9 A;  5ERK A;  3FI6 A;  4RC7 A;  3SH6 A;  4TOH A;  4ZL5 A;  1LKM A;  5JKL G;  3E1P A;  3OGH A;  4MUD A;  3E1N A;  2ZA8 A;  2JD6 0;  1VJX A;  3A68 A;  5ERJ A;  4DYY A;  4M33 A;  4Z3B A;  5J93 A;  4TOC A;  2FG8 A;  4RC5 A;  4ISP A;  3R2K A;  4E6K A;  1NF4 A;  3BVL A;  3RAV A;  1JI5 A;  3ERZ A;  5C6F A;  4CYA A;  4LQN A;  3QHB A;  1YV1 A;  3RD0 A;  5D8S A;  2FG4 A;  2FJC A;  3T9J A;  2V2M A;  3AF8 X;  4MKU A;  5D8Y A;  3A9Q A;  3F37 A;  5HQO A;  2ZG9 X;  1UMN A;  3KA6 A;  2GYQ A;  2OH3 A;  3Q4R A;  1IER A;  3PWF A;  4RC6 A;  1RCE A;  2YW6 A;  5J8W A;  4ITT A;  1HRS A;  4RC8 A;  3BVK A;  2ZG8 X;  4AM4 A;  3F32 A;  5J9V A;  5GU1 X;  2Z5R A;  3F33 A;  3GHQ A;  2Z90 A;  1TKP A;  3WVV A;  1RCI A;  1YUX A;  2QF9 A;  1SQ3 A;  3PVY B;  3F34 A;  3SHX A;  2PYB A;  3EZ0 A;  3BVI A;  2X17 0;  2Y3Q A;  1IES A;  2GS4 A;  4LQH A;  5LS9 A;  2CHI A;  3AK9 A;  2VXX A;  3E2C A;  4TOA A;  2C41 A;  2D5K A;  5D8R A;  3RBC A;  4A25 A;  3R2H A;  1QGH A;  2C2J A;  4DYU A;  1GWG A;  3PW8 C;  4TO9 A;  3QD8 A;  1RCG A;  2YJK A;  4EVC A;  4XKS A;  4ZL6 A;  4IWJ A;  1JGC A;  5FFB A;  2XJM A;  4KVS A;  4KVQ A;  4EVB A;  2CHP A;  4DE6 A;  3GE4 A;  3SE1 A;  3AJQ A;  2ZG7 X;  2FL0 A;  1BFR A;  3IS7 A;  3QVD A;  1EUM A;  3PVR B;  4ZKW A;  4TOD A;  1B71 A;  3PW1 B;  3BT5 A;  3RGD A;  2XJN A;  3KXU A;  3AJP A;  2CN6 A;  5JKL A;  4DAS A;  1S2Z A;  3HIU A;  2V15 A;  3E6S A;  4LQV A;  3ISF A;  3GVY A;  3ISE A;  3UOI A;  2V2J A;  4DI0 A;  3Q4Q A;  5GU3 X;  3F39 A;  2ZA6 A;  3AF9 X;  3EZU A;  2Z5Q A;  2HTN A;  4XGS A;  3PVT B;  1VEI A;  3F36 A;  4REU A;  1O9R A;  5J8S A;  1J30 A;  1DAT A;  2IY4 A;  2ITB A;  2JD7 0;  5FFE A;  1TKO A;  1AEW A;  5LG8 A;  3PVY A;  2CEI A;  3E1J A;  3PWQ C;  5E2D A;  1XZ3 A;  2CLB A;  2CLU A;  1Z6O A;  2JD8 0;  1TK6 A;  2BKC A;  2XGW A;  3PZA A;  4ITW A;  4LQJ A;  3WVW A;  4TOF A;  1S30 A;  1DPS A;  3QZ3 A;  1LKP A;  2FZF A;  3UOF A;  5CMR A;  5D8Q A;  4RC5 B;  5HJF A;  3PW8 A;  2C2F A;  3E1L A;  4KVR A;  2VXI A;  1N1Q A;  3KX9 A;  3QHC A;  4TOG A;  3KA4 A;  1MOJ A;  4II4 B;  1JTS A;  1BG7 A;  3PVR A;  5IX6 A;  3KA8 A;  3AJO A;  5FFD A;  4QUW A;  2YW7 A;  2ZA7 A;  1BCF A;  2V2S A;  4DYZ A;  4ZLW A;  4M34 A;  4XKU A;  4PG0 A;  4RC6 B;  2WLA A;  1ZUJ A;  4CVR A;  1YUZ A;  3O7S A;  2FHA A;  5E1U A;  1RCD A;  2V2R A;  1R03 A;  4ZTT A;  2BK6 A;  3E1Q A;  2XJO A;  1F30 A;  1RCC A;  1JKV A;  5GN8 B;  2QQY A;  4M35 A;  1RYT A;  2BW1 A;  5CZU A;  1KRQ A;  3SID A;  2C6R A;  3PVT A;  5FFC A;  5JKM G;  3R2L A;  3VNX A;  1H96 A;  1VEQ A;  5FFA A;  3KA3 A;  3Q4O A; 
#chains in the Genus database with same CATH topology
 3C1Y A;  3R2O A;  2ZUR X;  4EVE A;  4LPM A;  4TOE A;  3UNO A;  4ZKX A;  4TW3 A;  1OTK A;  2V2P A;  2C2U A;  3BVF A;  1VLG A;  2G4H A;  2CF7 A;  4LPN A;  1Z6O M;  4ISM A;  3F35 A;  3R2M A;  4DYX A;  1TJO A;  3V3K B;  1JYB A;  1Z4A A;  3E1M A;  4LYX A;  3R2R A;  3PWQ A;  3F38 A;  2CIH A;  5CMQ A;  4WJG 4;  1MFR A;  3ES3 A;  3BVE A;  4M32 A;  3C1Z A;  1LB3 A;  4ML5 A;  2F7N A;  5LG2 A;  4RC7 B;  3KWO A;  2XKQ A;  3WVU A;  4P18 A;  2IB0 A;  3FVB A;  3FRS A;  3MPS A;  5K52 A;  1FHA A;  2FKZ A;  2UX1 A;  4CYB A;  1JRE A;  4Z5S A;  1ZS3 A;  2V2I A;  2IU2 A;  4IXK A;  4II4 A;  3AK8 A;  2Z5P A;  2Y44 A;  2V2N A;  4AM2 A;  4Y08 A;  2FFX J;  4EVD A;  3Q4N A;  2HR5 A;  3GGZ A;  4ZKH A;  3TA8 A;  3AF7 X;  1UVH A;  5D8P A;  5HJH A;  4R42 A;  3NP2 X;  4PGK A;  4CVS A;  1JI4 A;  4CVT A;  3E6R A;  4DZ0 A;  4MN9 A;  1LKO A;  1O9I A;  3OJ5 A;  3O7R A;  4AM5 A;  4ZJK A;  3QB9 A;  5I4J A;  2WTL A;  2RBD A;  3M6J A;  4CMY V;  1F33 A;  3PW1 A;  1SOF A;  4MJY A;  3U90 A;  3BKN A;  4CVP A;  3IQ1 A;  1JKU A;  2YJJ A;  5GN8 A;  2BJY A;  5K53 A;  1VEL A;  4MXP A;  4TOB A;  5D8O A;  5GOU A;  2OC5 A;  1L8H A;  5GU0 X;  4CMY A;  4IWK A;  4LYU A;  3WNW A;  2W0O A;  2WWX B;  5FEJ A;  3D19 A;  2V2O A;  2VZB A;  2GYD A;  2CN7 A;  5JKM A;  1NF6 A;  3DBY A;  4LPJ A;  3W54 A;  5AXS A;  4MY7 A;  4ERU A;  3KA9 A;  3NP0 X;  3H7G A;  3RE7 A;  2OKC A;  2V8T A;  5GU2 X;  2G38 B;  1L8I A;  2AR0 A;  2Z6M A;  3EGM A;  3R2S A;  1NNQ A;  5LBH A;  4ETR A;  4PGI A;  4OYN A;  1DVB A;  2WLU A;  1QYB A;  4YKH A;  5HU6 D;  2V2L A;  1S3Q A;  4XKT A;  1XZ1 A;  3E1O A;  4U3G A;  5D8X A;  4KXR B;  5JAC A;  3NOZ X;  3HL1 A;  4ZMC A;  3IS8 A;  1NFV A;  4X0J A;  3FSE A;  4PG1 A;  1JIG A;  4CY9 A;  5ERK A;  3FI6 A;  4RC7 A;  3SH6 A;  4TOH A;  4ZL5 A;  1LKM A;  5JKL G;  3E1P A;  3OGH A;  4MUD A;  3E1N A;  2ZA8 A;  2JD6 0;  1VJX A;  3A68 A;  5ERJ A;  2N02 A;  4DYY A;  3C23 A;  4M33 A;  4Z3B A;  5J93 A;  4TOC A;  2FG8 A;  2CWL A;  4RC5 A;  4ISP A;  3R2K A;  4E6K A;  1NF4 A;  3BVL A;  3RAV A;  1JI5 A;  3ERZ A;  5C6F A;  4CYA A;  4LQN A;  3QHB A;  1YV1 A;  3RD0 A;  5D8S A;  2FG4 A;  2FJC A;  3T9J A;  2V2M A;  3AF8 X;  4MKU A;  5D8Y A;  3A9Q A;  3F37 A;  5HQO A;  2ZG9 X;  1UMN A;  3KA6 A;  2GYQ A;  2OH3 A;  3Q4R A;  1IER A;  3PWF A;  4RC6 A;  1RCE A;  2YW6 A;  5J8W A;  4ITT A;  5JDO B;  1HRS A;  4RC8 A;  3BVK A;  2ZG8 X;  4AM4 A;  3F32 A;  5J9V A;  5GU1 X;  2Z5R A;  3F33 A;  2V8U A;  3GHQ A;  2Z90 A;  1TKP A;  3WVV A;  1RCI A;  1YUX A;  2QF9 A;  1SQ3 A;  3PVY B;  3F34 A;  3SHX A;  2PYB A;  3EZ0 A;  3KHK A;  3BVI A;  2X17 0;  2Y3Q A;  1IES A;  2GS4 A;  4LQH A;  5LS9 A;  2CHI A;  3AK9 A;  3VVA A;  2VXX A;  3E2C A;  4TOA A;  2C41 A;  2D5K A;  5D8R A;  3RBC A;  4A25 A;  3R2H A;  1QGH A;  2C2J A;  4DYU A;  1GWG A;  3PW8 C;  4TO9 A;  4YXM A;  3QD8 A;  1RCG A;  2YJK A;  4EVC A;  4XKS A;  4ZL6 A;  4IWJ A;  1JGC A;  5FFB A;  2XJM A;  4KVS A;  4KVQ A;  4EVB A;  2CHP A;  3L0M A;  4DE6 A;  3GE4 A;  3SE1 A;  3AJQ A;  2ZG7 X;  2FL0 A;  3N6O A;  1BFR A;  3IS7 A;  3QVD A;  1EUM A;  3PVR B;  4ZKW A;  4TOD A;  4E40 A;  1B71 A;  3PW1 B;  3BT5 A;  2MGY A;  3RGD A;  2XJN A;  3KXU A;  3AJP A;  2CN6 A;  5JKL A;  4DAS A;  3UFB A;  1S2Z A;  3HIU A;  2V15 A;  3E6S A;  4LQV A;  3ISF A;  3GVY A;  3ISE A;  3UOI A;  2V2J A;  4DI0 A;  3Q4Q A;  5GU3 X;  3F39 A;  2ZA6 A;  3AF9 X;  3EZU A;  2Z5Q A;  2HTN A;  3FRR A;  4XGS A;  3PVT B;  1VEI A;  3F36 A;  4REU A;  1O9R A;  5J8S A;  5JDO A;  1J30 A;  1DAT A;  2IY4 A;  2ITB A;  2JD7 0;  5FFE A;  1TKO A;  1AEW A;  5LG8 A;  3PVY A;  2CEI A;  3E1J A;  3VV9 A;  3PWQ C;  3GGY A;  5E2D A;  1XZ3 A;  2CLB A;  2CLU A;  1Z6O A;  2JD8 0;  1TK6 A;  2BKC A;  2XGW A;  3PZA A;  4ITW A;  4LQJ A;  3WVW A;  4TOF A;  1S30 A;  1DPS A;  3QZ3 A;  1LKP A;  2FZF A;  3UOF A;  3JZA B;  5CMR A;  5D8Q A;  4RC5 B;  4W4L B;  5HJF A;  3PW8 A;  2C2F A;  3E1L A;  4KVR A;  2VXI A;  3KDQ A;  1N1Q A;  3KX9 A;  3QHC A;  4TOG A;  3KA4 A;  1MOJ A;  4II4 B;  1JTS A;  1BG7 A;  3PVR A;  5IX6 A;  3KA8 A;  3AJO A;  5FFD A;  4QUW A;  2YW7 A;  2ZA7 A;  1BCF A;  2V2S A;  4DYZ A;  4ZLW A;  4M34 A;  4XKU A;  4PG0 A;  4RC6 B;  4W4K B;  2WLA A;  1ZUJ A;  4YXJ A;  4CVR A;  1YUZ A;  3O7S A;  2FHA A;  5E1U A;  1RCD A;  2V2R A;  1R03 A;  4ZTT A;  2BK6 A;  3LKD A;  3E1Q A;  2XJO A;  1F30 A;  1RCC A;  1JKV A;  5GN8 B;  2QQY A;  4M35 A;  4YVZ A;  1RYT A;  2BW1 A;  5CZU A;  1KRQ A;  3SID A;  2C6R A;  3PVT A;  3JZ9 A;  5FFC A;  5JKM G;  3R2L A;  3VNX A;  1H96 A;  1VEQ A;  3C21 A;  5FFA A;  3KA3 A;  3Q4O A; 
#chains in the Genus database with same CATH homology
 3C1Y A;  3R2O A;  2ZUR X;  4EVE A;  4LPM A;  4TOE A;  3UNO A;  4ZKX A;  4TW3 A;  1OTK A;  2V2P A;  2C2U A;  3BVF A;  1VLG A;  2G4H A;  2CF7 A;  4LPN A;  1Z6O M;  4ISM A;  3F35 A;  3R2M A;  4DYX A;  1TJO A;  3V3K B;  1JYB A;  1Z4A A;  3E1M A;  4LYX A;  3R2R A;  3PWQ A;  3F38 A;  2CIH A;  5CMQ A;  4WJG 4;  1MFR A;  3ES3 A;  3BVE A;  4M32 A;  3C1Z A;  1LB3 A;  4ML5 A;  2F7N A;  5LG2 A;  4RC7 B;  3KWO A;  2XKQ A;  3WVU A;  4P18 A;  2IB0 A;  3FVB A;  3FRS A;  3MPS A;  5K52 A;  1FHA A;  2FKZ A;  2UX1 A;  4CYB A;  1JRE A;  4Z5S A;  1ZS3 A;  2V2I A;  2IU2 A;  4IXK A;  4II4 A;  3AK8 A;  2Z5P A;  2Y44 A;  2V2N A;  4AM2 A;  4Y08 A;  2FFX J;  4EVD A;  3Q4N A;  2HR5 A;  3GGZ A;  4ZKH A;  3TA8 A;  3AF7 X;  1UVH A;  5D8P A;  5HJH A;  4R42 A;  3NP2 X;  4PGK A;  4CVS A;  1JI4 A;  4CVT A;  3E6R A;  4DZ0 A;  4MN9 A;  1LKO A;  1O9I A;  3OJ5 A;  3O7R A;  4AM5 A;  4ZJK A;  3QB9 A;  5I4J A;  2WTL A;  2RBD A;  3M6J A;  4CMY V;  1F33 A;  3PW1 A;  1SOF A;  4MJY A;  3U90 A;  3BKN A;  4CVP A;  3IQ1 A;  1JKU A;  2YJJ A;  5GN8 A;  2BJY A;  5K53 A;  1VEL A;  4MXP A;  4TOB A;  5D8O A;  5GOU A;  2OC5 A;  1L8H A;  5GU0 X;  4CMY A;  4IWK A;  4LYU A;  3WNW A;  2W0O A;  2WWX B;  5FEJ A;  3D19 A;  2V2O A;  2VZB A;  2GYD A;  2CN7 A;  5JKM A;  1NF6 A;  3DBY A;  4LPJ A;  3W54 A;  5AXS A;  4MY7 A;  4ERU A;  3KA9 A;  3NP0 X;  3H7G A;  3RE7 A;  2OKC A;  2V8T A;  5GU2 X;  2G38 B;  1L8I A;  2AR0 A;  2Z6M A;  3EGM A;  3R2S A;  1NNQ A;  5LBH A;  4ETR A;  4PGI A;  4OYN A;  1DVB A;  2WLU A;  1QYB A;  4YKH A;  5HU6 D;  2V2L A;  1S3Q A;  4XKT A;  1XZ1 A;  3E1O A;  4U3G A;  5D8X A;  4KXR B;  5JAC A;  3NOZ X;  3HL1 A;  4ZMC A;  3IS8 A;  1NFV A;  4X0J A;  3FSE A;  4PG1 A;  1JIG A;  4CY9 A;  5ERK A;  3FI6 A;  4RC7 A;  3SH6 A;  4TOH A;  4ZL5 A;  1LKM A;  5JKL G;  3E1P A;  3OGH A;  4MUD A;  3E1N A;  2ZA8 A;  2JD6 0;  1VJX A;  3A68 A;  5ERJ A;  2N02 A;  4DYY A;  3C23 A;  4M33 A;  4Z3B A;  5J93 A;  4TOC A;  2FG8 A;  2CWL A;  4RC5 A;  4ISP A;  3R2K A;  4E6K A;  1NF4 A;  3BVL A;  3RAV A;  1JI5 A;  3ERZ A;  5C6F A;  4CYA A;  4LQN A;  3QHB A;  1YV1 A;  3RD0 A;  5D8S A;  2FG4 A;  2FJC A;  3T9J A;  2V2M A;  3AF8 X;  4MKU A;  5D8Y A;  3A9Q A;  3F37 A;  5HQO A;  2ZG9 X;  1UMN A;  3KA6 A;  2GYQ A;  2OH3 A;  3Q4R A;  1IER A;  3PWF A;  4RC6 A;  1RCE A;  2YW6 A;  5J8W A;  4ITT A;  5JDO B;  1HRS A;  4RC8 A;  3BVK A;  2ZG8 X;  4AM4 A;  3F32 A;  5J9V A;  5GU1 X;  2Z5R A;  3F33 A;  2V8U A;  3GHQ A;  2Z90 A;  1TKP A;  3WVV A;  1RCI A;  1YUX A;  2QF9 A;  1SQ3 A;  3PVY B;  3F34 A;  3SHX A;  2PYB A;  3EZ0 A;  3KHK A;  3BVI A;  2X17 0;  2Y3Q A;  1IES A;  2GS4 A;  4LQH A;  5LS9 A;  2CHI A;  3AK9 A;  3VVA A;  2VXX A;  3E2C A;  4TOA A;  2C41 A;  2D5K A;  5D8R A;  3RBC A;  4A25 A;  3R2H A;  1QGH A;  2C2J A;  4DYU A;  1GWG A;  3PW8 C;  4TO9 A;  4YXM A;  3QD8 A;  1RCG A;  2YJK A;  4EVC A;  4XKS A;  4ZL6 A;  4IWJ A;  1JGC A;  5FFB A;  2XJM A;  4KVS A;  4KVQ A;  4EVB A;  2CHP A;  3L0M A;  4DE6 A;  3GE4 A;  3SE1 A;  3AJQ A;  2ZG7 X;  2FL0 A;  3N6O A;  1BFR A;  3IS7 A;  3QVD A;  1EUM A;  3PVR B;  4ZKW A;  4TOD A;  4E40 A;  1B71 A;  3PW1 B;  3BT5 A;  2MGY A;  3RGD A;  2XJN A;  3KXU A;  3AJP A;  2CN6 A;  5JKL A;  4DAS A;  3UFB A;  1S2Z A;  3HIU A;  2V15 A;  3E6S A;  4LQV A;  3ISF A;  3GVY A;  3ISE A;  3UOI A;  2V2J A;  4DI0 A;  3Q4Q A;  5GU3 X;  3F39 A;  2ZA6 A;  3AF9 X;  3EZU A;  2Z5Q A;  2HTN A;  3FRR A;  4XGS A;  3PVT B;  1VEI A;  3F36 A;  4REU A;  1O9R A;  5J8S A;  5JDO A;  1J30 A;  1DAT A;  2IY4 A;  2ITB A;  2JD7 0;  5FFE A;  1TKO A;  1AEW A;  5LG8 A;  3PVY A;  2CEI A;  3E1J A;  3VV9 A;  3PWQ C;  3GGY A;  5E2D A;  1XZ3 A;  2CLB A;  2CLU A;  1Z6O A;  2JD8 0;  1TK6 A;  2BKC A;  2XGW A;  3PZA A;  4ITW A;  4LQJ A;  3WVW A;  4TOF A;  1S30 A;  1DPS A;  3QZ3 A;  1LKP A;  2FZF A;  3UOF A;  3JZA B;  5CMR A;  5D8Q A;  4RC5 B;  4W4L B;  5HJF A;  3PW8 A;  2C2F A;  3E1L A;  4KVR A;  2VXI A;  3KDQ A;  1N1Q A;  3KX9 A;  3QHC A;  4TOG A;  3KA4 A;  1MOJ A;  4II4 B;  1JTS A;  1BG7 A;  3PVR A;  5IX6 A;  3KA8 A;  3AJO A;  5FFD A;  4QUW A;  2YW7 A;  2ZA7 A;  1BCF A;  2V2S A;  4DYZ A;  4ZLW A;  4M34 A;  4XKU A;  4PG0 A;  4RC6 B;  4W4K B;  2WLA A;  1ZUJ A;  4YXJ A;  4CVR A;  1YUZ A;  3O7S A;  2FHA A;  5E1U A;  1RCD A;  2V2R A;  1R03 A;  4ZTT A;  2BK6 A;  3LKD A;  3E1Q A;  2XJO A;  1F30 A;  1RCC A;  1JKV A;  5GN8 B;  2QQY A;  4M35 A;  4YVZ A;  1RYT A;  2BW1 A;  5CZU A;  1KRQ A;  3SID A;  2C6R A;  3PVT A;  3JZ9 A;  5FFC A;  5JKM G;  3R2L A;  3VNX A;  1H96 A;  1VEQ A;  3C21 A;  5FFA A;  3KA3 A;  3Q4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...