5FFDA

Copm in the ag-bound form (by co-crystallization)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
153
structure length
137
Chain Sequence
QWTDQSFIEMMTPHHQDAIDMAEMALQKAEHPELKKLARNIIRDQEREIKEMKTWYQQWFKRPVPAAMDLDALATAQNFDREFIRQMIPHHQMAVMMASNLKTNTERPEMDKLMDDIIRSQSAEIKQMKQWYQNWYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords CopM
publication title Structural basis for copper/silver binding by the Synechocystis metallochaperone CopM
doi rcsb
source organism Synechocystis sp. pcc 6803
total genus 59
structure length 137
sequence length 153
ec nomenclature
pdb deposition date 2015-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03713 DUF305 Domain of unknown function (DUF305)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 5ffdA00
1NF6A 2ZA8A 3R2MA 5GU0X 3WVUA 1BG7A 4DYYA 3E6RA 3R2OA 3OJ5A 4MUDA 5HJFA 4ZJKA 4ZKWA 2VXIA 4DZ0A 1JYBA 4CYAA 3SHXA 4PGKA 2Y3QA 2XJMA 1TKPA 4A25A 3AF8X 5LBHA 4Z3BA 3TA8A 2BKCA 4PG0A 4M33A 3R2RA 4PG1A 5IX6A 2YJKA 4EVDA 4IXKA 1XZ1A 3F36A 5FEJA 2UX1A 2QQYA 1S2ZA 1H96A 2FFXJ 4AM4A 4MY7A 4DE6A 4E6KA 1IERA 1JREA 3F33A 5HJHA 2CF7A 2CN6A 3ERZA 4Z5SA 1SOFA 4TOFA 3AK9A 2HR5A 2C2JA 5GN8B 3PW8C 2ZA6A 3SH6A 3A68A 4RC5A 4TODA 2C6RA 2ZURX 3AJOA 3PW8A 1JKUA 5JKLA 3QVDA 1UMNA 4RC6B 4AM5A 2Z6MA 4MN9A 2PYBA 3QD8A 2GYQA 2D5KA 1B71A 4ZKXA 1S30A 2C2UA 5D8PA 5AXSA 5E2DA 1IESA 5I4JA 3QHBA 4XGSA 2JD60 3BVKA 2Z5QA 3KA9A 2G4HA 2QF9A 3E1NA 3F39A 3EZ0A 3T9JA 2ZA7A 1RCIA 1Z6OM 1DATA 4XKUA 3R2KA 1GWGA 2V2NA 1TKOA 4KVRA 3H7GA 1Z4AA 3GHQA 2VZBA 1NF4A 4QUWA 2WLAA 2X170 2IU2A 2FHAA 1YUZA 3Q4QA 5JKLG 4CVRA 5GU3X 1YUXA 4CYBA 3PWFA 1JKVA 1TK6A 3Q4OA 2ITBA 2BK6A 2BW1A 3F38A 2FZFA 5K53A 5CMQA 3QB9A 4TOCA 4U3GA 1Z6OA 3IS8A 2ZG9X 1VEIA 5FFCA 3RAVA 2Z90A 4M34A 3AK8A 5FFDA 4CMYA 2WTLA 4RC8A 3KA6A 1QGHA 4KVSA 5JACA 3UNOA 3AJQA 3PVYA 2V2OA 2ZG8X 2V2PA 4ZL6A 4YKHA 3NP2X 3RBCA 1UVHA 4TOEA 5C6FA 2CIHA 5CMRA 5HQOA 2FJCA 3UOFA 4PGIA 4ERUA 2HTNA 4TOAA 3E2CA 2Z5PA 4ITTA 2XJOA 5LG2A 5D8YA 2WLUA 3BT5A 3FI6A 1LKPA 1JTSA 3F35A 3GVYA 4EVBA 3E1PA 4DASA 3KWOA 3RGDA 1JIGA 3RE7A 2C41A 3IQ1A 1NFVA 2BJYA 2RBDA 2C2FA 3E1OA 4RC5B 4LPJA 3Q4NA 2CLUA 3BKNA 3WVWA 2V15A 4REUA 2V2SA 4LQJA 1RCGA 3KA8A 1RYTA 2OH3A 3BVLA 3BVEA 3SE1A 1R03A 3KA3A 4II4A 4DYXA 2JD70 2W0OA 3O7RA 2V2RA 1OTKA 3E1JA 3QZ3A 4M32A 2VXXA 2XGWA 3NOZX 4ZKHA 4ZTTA 4CMYV 1FHAA 3R2LA 4LQNA 1BFRA 1RCDA 3OGHA 3F34A 1L8IA 5ERKA 2IB0A 3F37A 5GU2X 4EVCA 4II4B 1KRQA 2Z5RA 1F33A 2ZG7X 4RC7A 4Y08A 4R42A 5J8WA 3PVTA 4LYXA 5JKMA 4ZL5A 2CLBA 5LG8A 3QHCA 1XZ3A 2V2JA 3F32A 4CY9A 3R2SA 4MKUA 1HRSA 4RC7B 3R2HA 1L8HA 1F30A 3O7SA 3BVIA 2FG4A 3PVRA 3PVTB 3ES3A 4TW3A 4DI0A 4ETRA 3AJPA 5E1UA 2V2MA 4ZMCA 2YW7A 1VELA 3MPSA 2V2LA 1QYBA 4TOGA 3PVRB 3E1QA 2CEIA 4CVSA 1SQ3A 2OC5A 3BVFA 1VLGA 2FKZA 1VJXA 5FFEA 3EGMA 3PZAA 3EZUA 1J30A 5D8RA 1JI5A 4DYUA 5FFAA 1N1QA 4M35A 1RCCA 4ISPA 1AEWA 5JKMG 4OYNA 3PVYB 2IY4A 1S3QA 3KX9A 3FSEA 3ISFA 5D8XA 2XKQA 1BCFA 4TO9A 3Q4RA 4DYZA 4P18A 3AF9X 4ITWA 2JD80 3ISEA 2CHPA 5GN8A 1O9RA 1NNQA 5LS9A 3GE4A 3WVVA 1O9IA 3SIDA 3FVBA 4RC6A 4MJYA 2GYDA 3E6SA 2V2IA 2CHIA 2FL0A 3RD0A 1JGCA 4TOBA 4ISMA 4XKTA 3UOIA 3AF7X 4IWJA 4ML5A 4ZLWA 3E1LA 5D8OA 3PW1A 3IS7A 4KVQA 3U90A 4CVPA 2F7NA 2YW6A 1VEQA 5K52A 1YV1A 1TJOA 1ZS3A 1MOJA 3A9QA 2CN7A 3HIUA 4LQVA 3KA4A 4LPNA 1ZUJA 4LPMA 5J9VA 3VNXA 3NP0X 5GU1X 3PW1B 4XKSA 5J93A 1LKMA 4LYUA 2GS4A 4CVTA 1LB3A 1RCEA 3E1MA 2FG8A 3KXUA 5J8SA 5FFBA 1LKOA 4TOHA 5D8QA 1JI4A 1DPSA 5GOUA 2YJJA 5ERJA 1DVBA 4EVEA 1MFRA 2XJNA 4LQHA 5CZUA 4IWKA 3WNWA 3PWQC 1EUMA 3HL1A 4AM2A 3PWQA 5D8SA
chains in the Genus database with same CATH superfamily
1NF6A 2CWLA 3VVAA 2ZA8A 3R2MA 5GU0X 4WJG4 3WVUA 1BG7A 2Y44A 4DYYA 3E6RA 3R2OA 3OJ5A 4MUDA 5HJFA 4ZJKA 4ZKWA 2VXIA 4DZ0A 1JYBA 4CYAA 3SHXA 4PGKA 2Y3QA 2XJMA 1TKPA 4A25A 3AF8X 5LBHA 4Z3BA 3TA8A 2BKCA 4PG0A 4M33A 3R2RA 4PG1A 5IX6A 2YJKA 4EVDA 4IXKA 1XZ1A 3F36A 5FEJA 3KDQA 4X0JA 2UX1A 2QQYA 1S2ZA 1H96A 2FFXJ 4AM4A 4MY7A 4DE6A 4E6KA 1IERA 1JREA 3F33A 5HJHA 2CF7A 2CN6A 3ERZA 4Z5SA 1SOFA 4TOFA 3AK9A 2HR5A 2C2JA 5GN8B 3PW8C 2ZA6A 3SH6A 3A68A 4RC5A 4TODA 2C6RA 2ZURX 3AJOA 3PW8A 1JKUA 5JKLA 3QVDA 1UMNA 4RC6B 3GGZA 4AM5A 2Z6MA 4MN9A 2PYBA 3QD8A 2GYQA 2D5KA 1B71A 4ZKXA 1S30A 4E40A 2C2UA 5D8PA 5AXSA 5E2DA 1IESA 5I4JA 3QHBA 4XGSA 2JD60 3BVKA 2Z5QA 3KA9A 2G4HA 2QF9A 3E1NA 3F39A 3EZ0A 3T9JA 2ZA7A 1RCIA 1Z6OM 1DATA 4XKUA 3R2KA 1GWGA 3FRRA 4KXRB 2V2NA 1TKOA 4KVRA 3H7GA 1Z4AA 3GGYA 3GHQA 2VZBA 1NF4A 3N6OA 4QUWA 2WLAA 3UFBA 2X170 2IU2A 2FHAA 1YUZA 3Q4QA 5JKLG 4CVRA 5GU3X 1YUXA 4CYBA 3PWFA 2N02A 1JKVA 1TK6A 3Q4OA 2ITBA 2BK6A 2BW1A 3F38A 2FZFA 5K53A 5CMQA 3C23A 3QB9A 4TOCA 4U3GA 1Z6OA 3IS8A 2ZG9X 1VEIA 5FFCA 3L0MA 3RAVA 2Z90A 4M34A 3AK8A 5FFDA 3LKDA 4CMYA 2WTLA 4RC8A 3KA6A 1QGHA 4KVSA 5JACA 3UNOA 3AJQA 3PVYA 2V2OA 2ZG8X 2V2PA 4ZL6A 4YKHA 3NP2X 3RBCA 1UVHA 4TOEA 3FRSA 5C6FA 2CIHA 5CMRA 5HQOA 2FJCA 3UOFA 4PGIA 4YVZA 4W4KB 4ERUA 2HTNA 4TOAA 3E2CA 2Z5PA 4ITTA 2XJOA 5LG2A 5D8YA 2WLUA 3BT5A 3FI6A 1LKPA 1JTSA 3F35A 3GVYA 3C1YA 4EVBA 3E1PA 4DASA 3KWOA 3RGDA 1JIGA 3RE7A 2C41A 3IQ1A 1NFVA 2BJYA 2RBDA 2WWXB 2AR0A 2C2FA 3E1OA 4RC5B 4LPJA 3Q4NA 3C21A 2CLUA 3BKNA 3WVWA 2V15A 4REUA 2V2SA 4LQJA 1RCGA 3KA8A 1RYTA 2OH3A 3BVLA 3BVEA 3SE1A 1R03A 3KA3A 3W54A 4II4A 4DYXA 2JD70 2W0OA 3O7RA 2V2RA 1OTKA 3E1JA 3QZ3A 3VV9A 4M32A 2VXXA 2XGWA 3NOZX 4ZKHA 4ZTTA 4CMYV 1FHAA 3R2LA 4LQNA 1BFRA 1RCDA 3OGHA 3F34A 5JDOA 1L8IA 5ERKA 2IB0A 3F37A 5GU2X 4EVCA 4II4B 3C1ZA 1KRQA 2Z5RA 1F33A 2ZG7X 4RC7A 4Y08A 4R42A 5J8WA 3PVTA 4LYXA 5JKMA 3M6JA 4ZL5A 2CLBA 5LG8A 5JDOB 3QHCA 1XZ3A 2V2JA 3F32A 4CY9A 3R2SA 4W4LB 4MKUA 1HRSA 4RC7B 3R2HA 1L8HA 1F30A 3O7SA 3BVIA 2V8UA 2FG4A 3PVRA 3PVTB 3ES3A 4TW3A 4DI0A 4ETRA 3AJPA 5E1UA 2V2MA 4ZMCA 2YW7A 1VELA 3MPSA 2V2LA 1QYBA 4TOGA 3PVRB 3E1QA 2CEIA 4CVSA 2G38B 1SQ3A 2OC5A 3BVFA 1VLGA 2FKZA 1VJXA 5FFEA 3EGMA 3PZAA 3EZUA 1J30A 5D8RA 1JI5A 4DYUA 5FFAA 1N1QA 4M35A 1RCCA 4ISPA 1AEWA 5JKMG 4OYNA 4MXPA 3PVYB 2IY4A 1S3QA 3KX9A 3FSEA 3ISFA 5D8XA 2XKQA 1BCFA 4TO9A 3V3KB 4YXMA 3Q4RA 4DYZA 4P18A 3AF9X 4ITWA 3JZ9A 2JD80 3ISEA 2MGYA 2V8TA 2CHPA 5GN8A 1O9RA 1NNQA 5LS9A 3GE4A 4YXJA 3WVVA 1O9IA 3SIDA 3FVBA 4RC6A 4MJYA 2GYDA 3E6SA 2V2IA 2CHIA 2FL0A 3RD0A 1JGCA 4TOBA 4ISMA 3DBYA 4XKTA 3UOIA 3AF7X 4IWJA 4ML5A 4ZLWA 3E1LA 5D8OA 3PW1A 3IS7A 4KVQA 3U90A 4CVPA 2F7NA 2YW6A 1VEQA 5K52A 5HU6D 1YV1A 1TJOA 1ZS3A 1MOJA 3A9QA 2CN7A 3HIUA 4LQVA 3KA4A 4LPNA 1ZUJA 4LPMA 5J9VA 3VNXA 3NP0X 5GU1X 3KHKA 3PW1B 4XKSA 1LKMA 4LYUA 5J93A 2GS4A 4CVTA 1LB3A 1RCEA 3E1MA 2OKCA 2FG8A 3KXUA 5J8SA 5FFBA 1LKOA 4TOHA 5D8QA 3JZAB 1JI4A 1DPSA 5GOUA 2YJJA 5ERJA 1DVBA 4EVEA 1MFRA 2XJNA 4LQHA 5CZUA 4IWKA 3WNWA 3D19A 3PWQC 1EUMA 3HL1A 4AM2A 3PWQA 5D8SA
chains in the Genus database with same CATH topology
1NF6A 2CWLA 3VVAA 2ZA8A 3R2MA 5GU0X 4WJG4 3WVUA 1BG7A 2Y44A 4DYYA 3E6RA 3R2OA 3OJ5A 4MUDA 5HJFA 4ZJKA 4ZKWA 2VXIA 4DZ0A 1JYBA 4CYAA 3SHXA 4PGKA 2Y3QA 2XJMA 1TKPA 4A25A 3AF8X 5LBHA 4Z3BA 3TA8A 2BKCA 4PG0A 4M33A 3R2RA 4PG1A 5IX6A 2YJKA 4EVDA 4IXKA 1XZ1A 3F36A 5FEJA 3KDQA 4X0JA 2UX1A 2QQYA 1S2ZA 1H96A 2FFXJ 4AM4A 4MY7A 4DE6A 4E6KA 1IERA 1JREA 3F33A 5HJHA 2CF7A 2CN6A 3ERZA 4Z5SA 1SOFA 4TOFA 3AK9A 2HR5A 2C2JA 5GN8B 3PW8C 2ZA6A 3SH6A 3A68A 4RC5A 4TODA 2C6RA 2ZURX 3AJOA 3PW8A 1JKUA 5JKLA 3QVDA 1UMNA 4RC6B 3GGZA 4AM5A 2Z6MA 4MN9A 2PYBA 3QD8A 2GYQA 2D5KA 1B71A 4ZKXA 1S30A 4E40A 2C2UA 5D8PA 5AXSA 5E2DA 1IESA 5I4JA 3QHBA 4XGSA 2JD60 3BVKA 2Z5QA 3KA9A 2G4HA 2QF9A 3E1NA 3F39A 3EZ0A 3T9JA 2ZA7A 1RCIA 1Z6OM 1DATA 4XKUA 3R2KA 1GWGA 3FRRA 4KXRB 2V2NA 1TKOA 4KVRA 3H7GA 1Z4AA 3GGYA 3GHQA 2VZBA 1NF4A 3N6OA 4QUWA 2WLAA 3UFBA 2X170 2IU2A 2FHAA 1YUZA 3Q4QA 5JKLG 4CVRA 5GU3X 1YUXA 4CYBA 3PWFA 2N02A 1JKVA 1TK6A 3Q4OA 2ITBA 2BK6A 2BW1A 3F38A 2FZFA 5K53A 5CMQA 3C23A 3QB9A 4TOCA 4U3GA 1Z6OA 3IS8A 2ZG9X 1VEIA 5FFCA 3L0MA 3RAVA 2Z90A 4M34A 3AK8A 5FFDA 3LKDA 4CMYA 2WTLA 4RC8A 3KA6A 1QGHA 4KVSA 5JACA 3UNOA 3AJQA 3PVYA 2V2OA 2ZG8X 2V2PA 4ZL6A 4YKHA 3NP2X 3RBCA 1UVHA 4TOEA 3FRSA 5C6FA 2CIHA 5CMRA 5HQOA 2FJCA 3UOFA 4PGIA 4YVZA 4W4KB 4ERUA 2HTNA 4TOAA 3E2CA 2Z5PA 4ITTA 2XJOA 5LG2A 5D8YA 2WLUA 3BT5A 3FI6A 1LKPA 1JTSA 3F35A 3GVYA 3C1YA 4EVBA 3E1PA 4DASA 3KWOA 3RGDA 1JIGA 3RE7A 2C41A 3IQ1A 1NFVA 2BJYA 2RBDA 2WWXB 2AR0A 2C2FA 3E1OA 4RC5B 4LPJA 3Q4NA 3C21A 2CLUA 3BKNA 3WVWA 2V15A 4REUA 2V2SA 4LQJA 1RCGA 3KA8A 1RYTA 2OH3A 3BVLA 3BVEA 3SE1A 1R03A 3KA3A 3W54A 4II4A 4DYXA 2JD70 2W0OA 3O7RA 2V2RA 1OTKA 3E1JA 3QZ3A 3VV9A 4M32A 2VXXA 2XGWA 3NOZX 4ZKHA 4ZTTA 4CMYV 1FHAA 3R2LA 4LQNA 1BFRA 1RCDA 3OGHA 3F34A 5JDOA 1L8IA 5ERKA 2IB0A 3F37A 5GU2X 4EVCA 4II4B 3C1ZA 1KRQA 2Z5RA 1F33A 2ZG7X 4RC7A 4Y08A 4R42A 5J8WA 3PVTA 4LYXA 5JKMA 3M6JA 4ZL5A 2CLBA 5LG8A 5JDOB 3QHCA 1XZ3A 2V2JA 3F32A 4CY9A 3R2SA 4W4LB 4MKUA 1HRSA 4RC7B 3R2HA 1L8HA 1F30A 3O7SA 3BVIA 2V8UA 2FG4A 3PVRA 3PVTB 3ES3A 4TW3A 4DI0A 4ETRA 3AJPA 5E1UA 2V2MA 4ZMCA 2YW7A 1VELA 3MPSA 2V2LA 1QYBA 4TOGA 3PVRB 3E1QA 2CEIA 4CVSA 2G38B 1SQ3A 2OC5A 3BVFA 1VLGA 2FKZA 1VJXA 5FFEA 3EGMA 3PZAA 3EZUA 1J30A 5D8RA 1JI5A 4DYUA 5FFAA 1N1QA 4M35A 1RCCA 4ISPA 1AEWA 5JKMG 4OYNA 4MXPA 3PVYB 2IY4A 1S3QA 3KX9A 3FSEA 3ISFA 5D8XA 2XKQA 1BCFA 4TO9A 3V3KB 4YXMA 3Q4RA 4DYZA 4P18A 3AF9X 4ITWA 3JZ9A 2JD80 3ISEA 2MGYA 2V8TA 2CHPA 5GN8A 1O9RA 1NNQA 5LS9A 3GE4A 4YXJA 3WVVA 1O9IA 3SIDA 3FVBA 4RC6A 4MJYA 2GYDA 3E6SA 2V2IA 2CHIA 2FL0A 3RD0A 1JGCA 4TOBA 4ISMA 3DBYA 4XKTA 3UOIA 3AF7X 4IWJA 4ML5A 4ZLWA 3E1LA 5D8OA 3PW1A 3IS7A 4KVQA 3U90A 4CVPA 2F7NA 2YW6A 1VEQA 5K52A 5HU6D 1YV1A 1TJOA 1ZS3A 1MOJA 3A9QA 2CN7A 3HIUA 4LQVA 3KA4A 4LPNA 1ZUJA 4LPMA 5J9VA 3VNXA 3NP0X 5GU1X 3KHKA 3PW1B 4XKSA 1LKMA 4LYUA 5J93A 2GS4A 4CVTA 1LB3A 1RCEA 3E1MA 2OKCA 2FG8A 3KXUA 5J8SA 5FFBA 1LKOA 4TOHA 5D8QA 3JZAB 1JI4A 1DPSA 5GOUA 2YJJA 5ERJA 1DVBA 4EVEA 1MFRA 2XJNA 4LQHA 5CZUA 4IWKA 3WNWA 3D19A 3PWQC 1EUMA 3HL1A 4AM2A 3PWQA 5D8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NF6 A;  2ZA8 A;  3R2M A;  5GU0 X;  3WVU A;  1BG7 A;  4DYY A;  3E6R A;  3R2O A;  3OJ5 A;  4MUD A;  5HJF A;  4ZJK A;  4ZKW A;  2VXI A;  4DZ0 A;  1JYB A;  4CYA A;  3SHX A;  4PGK A;  2Y3Q A;  2XJM A;  1TKP A;  4A25 A;  3AF8 X;  5LBH A;  4Z3B A;  3TA8 A;  2BKC A;  4PG0 A;  4M33 A;  3R2R A;  4PG1 A;  5IX6 A;  2YJK A;  4EVD A;  4IXK A;  1XZ1 A;  3F36 A;  5FEJ A;  2UX1 A;  2QQY A;  1S2Z A;  1H96 A;  2FFX J;  4AM4 A;  4MY7 A;  4DE6 A;  4E6K A;  1IER A;  1JRE A;  3F33 A;  5HJH A;  2CF7 A;  2CN6 A;  3ERZ A;  4Z5S A;  1SOF A;  4TOF A;  3AK9 A;  2HR5 A;  2C2J A;  5GN8 B;  3PW8 C;  2ZA6 A;  3SH6 A;  3A68 A;  4RC5 A;  4TOD A;  2C6R A;  2ZUR X;  3AJO A;  3PW8 A;  1JKU A;  5JKL A;  3QVD A;  1UMN A;  4RC6 B;  4AM5 A;  2Z6M A;  4MN9 A;  2PYB A;  3QD8 A;  2GYQ A;  2D5K A;  1B71 A;  4ZKX A;  1S30 A;  2C2U A;  5D8P A;  5AXS A;  5E2D A;  1IES A;  5I4J A;  3QHB A;  4XGS A;  2JD6 0;  3BVK A;  2Z5Q A;  3KA9 A;  2G4H A;  2QF9 A;  3E1N A;  3F39 A;  3EZ0 A;  3T9J A;  2ZA7 A;  1RCI A;  1Z6O M;  1DAT A;  4XKU A;  3R2K A;  1GWG A;  2V2N A;  1TKO A;  4KVR A;  3H7G A;  1Z4A A;  3GHQ A;  2VZB A;  1NF4 A;  4QUW A;  2WLA A;  2X17 0;  2IU2 A;  2FHA A;  1YUZ A;  3Q4Q A;  5JKL G;  4CVR A;  5GU3 X;  1YUX A;  4CYB A;  3PWF A;  1JKV A;  1TK6 A;  3Q4O A;  2ITB A;  2BK6 A;  2BW1 A;  3F38 A;  2FZF A;  5K53 A;  5CMQ A;  3QB9 A;  4TOC A;  4U3G A;  1Z6O A;  3IS8 A;  2ZG9 X;  1VEI A;  5FFC A;  3RAV A;  2Z90 A;  4M34 A;  3AK8 A;  5FFD A;  4CMY A;  2WTL A;  4RC8 A;  3KA6 A;  1QGH A;  4KVS A;  5JAC A;  3UNO A;  3AJQ A;  3PVY A;  2V2O A;  2ZG8 X;  2V2P A;  4ZL6 A;  4YKH A;  3NP2 X;  3RBC A;  1UVH A;  4TOE A;  5C6F A;  2CIH A;  5CMR A;  5HQO A;  2FJC A;  3UOF A;  4PGI A;  4ERU A;  2HTN A;  4TOA A;  3E2C A;  2Z5P A;  4ITT A;  2XJO A;  5LG2 A;  5D8Y A;  2WLU A;  3BT5 A;  3FI6 A;  1LKP A;  1JTS A;  3F35 A;  3GVY A;  4EVB A;  3E1P A;  4DAS A;  3KWO A;  3RGD A;  1JIG A;  3RE7 A;  2C41 A;  3IQ1 A;  1NFV A;  2BJY A;  2RBD A;  2C2F A;  3E1O A;  4RC5 B;  4LPJ A;  3Q4N A;  2CLU A;  3BKN A;  3WVW A;  2V15 A;  4REU A;  2V2S A;  4LQJ A;  1RCG A;  3KA8 A;  1RYT A;  2OH3 A;  3BVL A;  3BVE A;  3SE1 A;  1R03 A;  3KA3 A;  4II4 A;  4DYX A;  2JD7 0;  2W0O A;  3O7R A;  2V2R A;  1OTK A;  3E1J A;  3QZ3 A;  4M32 A;  2VXX A;  2XGW A;  3NOZ X;  4ZKH A;  4ZTT A;  4CMY V;  1FHA A;  3R2L A;  4LQN A;  1BFR A;  1RCD A;  3OGH A;  3F34 A;  1L8I A;  5ERK A;  2IB0 A;  3F37 A;  5GU2 X;  4EVC A;  4II4 B;  1KRQ A;  2Z5R A;  1F33 A;  2ZG7 X;  4RC7 A;  4Y08 A;  4R42 A;  5J8W A;  3PVT A;  4LYX A;  5JKM A;  4ZL5 A;  2CLB A;  5LG8 A;  3QHC A;  1XZ3 A;  2V2J A;  3F32 A;  4CY9 A;  3R2S A;  4MKU A;  1HRS A;  4RC7 B;  3R2H A;  1L8H A;  1F30 A;  3O7S A;  3BVI A;  2FG4 A;  3PVR A;  3PVT B;  3ES3 A;  4TW3 A;  4DI0 A;  4ETR A;  3AJP A;  5E1U A;  2V2M A;  4ZMC A;  2YW7 A;  1VEL A;  3MPS A;  2V2L A;  1QYB A;  4TOG A;  3PVR B;  3E1Q A;  2CEI A;  4CVS A;  1SQ3 A;  2OC5 A;  3BVF A;  1VLG A;  2FKZ A;  1VJX A;  5FFE A;  3EGM A;  3PZA A;  3EZU A;  1J30 A;  5D8R A;  1JI5 A;  4DYU A;  5FFA A;  1N1Q A;  4M35 A;  1RCC A;  4ISP A;  1AEW A;  5JKM G;  4OYN A;  3PVY B;  2IY4 A;  1S3Q A;  3KX9 A;  3FSE A;  3ISF A;  5D8X A;  2XKQ A;  1BCF A;  4TO9 A;  3Q4R A;  4DYZ A;  4P18 A;  3AF9 X;  4ITW A;  2JD8 0;  3ISE A;  2CHP A;  5GN8 A;  1O9R A;  1NNQ A;  5LS9 A;  3GE4 A;  3WVV A;  1O9I A;  3SID A;  3FVB A;  4RC6 A;  4MJY A;  2GYD A;  3E6S A;  2V2I A;  2CHI A;  2FL0 A;  3RD0 A;  1JGC A;  4TOB A;  4ISM A;  4XKT A;  3UOI A;  3AF7 X;  4IWJ A;  4ML5 A;  4ZLW A;  3E1L A;  5D8O A;  3PW1 A;  3IS7 A;  4KVQ A;  3U90 A;  4CVP A;  2F7N A;  2YW6 A;  1VEQ A;  5K52 A;  1YV1 A;  1TJO A;  1ZS3 A;  1MOJ A;  3A9Q A;  2CN7 A;  3HIU A;  4LQV A;  3KA4 A;  4LPN A;  1ZUJ A;  4LPM A;  5J9V A;  3VNX A;  3NP0 X;  5GU1 X;  3PW1 B;  4XKS A;  5J93 A;  1LKM A;  4LYU A;  2GS4 A;  4CVT A;  1LB3 A;  1RCE A;  3E1M A;  2FG8 A;  3KXU A;  5J8S A;  5FFB A;  1LKO A;  4TOH A;  5D8Q A;  1JI4 A;  1DPS A;  5GOU A;  2YJJ A;  5ERJ A;  1DVB A;  4EVE A;  1MFR A;  2XJN A;  4LQH A;  5CZU A;  4IWK A;  3WNW A;  3PWQ C;  1EUM A;  3HL1 A;  4AM2 A;  3PWQ A;  5D8S A; 
#chains in the Genus database with same CATH topology
 1NF6 A;  2CWL A;  3VVA A;  2ZA8 A;  3R2M A;  5GU0 X;  4WJG 4;  3WVU A;  1BG7 A;  2Y44 A;  4DYY A;  3E6R A;  3R2O A;  3OJ5 A;  4MUD A;  5HJF A;  4ZJK A;  4ZKW A;  2VXI A;  4DZ0 A;  1JYB A;  4CYA A;  3SHX A;  4PGK A;  2Y3Q A;  2XJM A;  1TKP A;  4A25 A;  3AF8 X;  5LBH A;  4Z3B A;  3TA8 A;  2BKC A;  4PG0 A;  4M33 A;  3R2R A;  4PG1 A;  5IX6 A;  2YJK A;  4EVD A;  4IXK A;  1XZ1 A;  3F36 A;  5FEJ A;  3KDQ A;  4X0J A;  2UX1 A;  2QQY A;  1S2Z A;  1H96 A;  2FFX J;  4AM4 A;  4MY7 A;  4DE6 A;  4E6K A;  1IER A;  1JRE A;  3F33 A;  5HJH A;  2CF7 A;  2CN6 A;  3ERZ A;  4Z5S A;  1SOF A;  4TOF A;  3AK9 A;  2HR5 A;  2C2J A;  5GN8 B;  3PW8 C;  2ZA6 A;  3SH6 A;  3A68 A;  4RC5 A;  4TOD A;  2C6R A;  2ZUR X;  3AJO A;  3PW8 A;  1JKU A;  5JKL A;  3QVD A;  1UMN A;  4RC6 B;  3GGZ A;  4AM5 A;  2Z6M A;  4MN9 A;  2PYB A;  3QD8 A;  2GYQ A;  2D5K A;  1B71 A;  4ZKX A;  1S30 A;  4E40 A;  2C2U A;  5D8P A;  5AXS A;  5E2D A;  1IES A;  5I4J A;  3QHB A;  4XGS A;  2JD6 0;  3BVK A;  2Z5Q A;  3KA9 A;  2G4H A;  2QF9 A;  3E1N A;  3F39 A;  3EZ0 A;  3T9J A;  2ZA7 A;  1RCI A;  1Z6O M;  1DAT A;  4XKU A;  3R2K A;  1GWG A;  3FRR A;  4KXR B;  2V2N A;  1TKO A;  4KVR A;  3H7G A;  1Z4A A;  3GGY A;  3GHQ A;  2VZB A;  1NF4 A;  3N6O A;  4QUW A;  2WLA A;  3UFB A;  2X17 0;  2IU2 A;  2FHA A;  1YUZ A;  3Q4Q A;  5JKL G;  4CVR A;  5GU3 X;  1YUX A;  4CYB A;  3PWF A;  2N02 A;  1JKV A;  1TK6 A;  3Q4O A;  2ITB A;  2BK6 A;  2BW1 A;  3F38 A;  2FZF A;  5K53 A;  5CMQ A;  3C23 A;  3QB9 A;  4TOC A;  4U3G A;  1Z6O A;  3IS8 A;  2ZG9 X;  1VEI A;  5FFC A;  3L0M A;  3RAV A;  2Z90 A;  4M34 A;  3AK8 A;  5FFD A;  3LKD A;  4CMY A;  2WTL A;  4RC8 A;  3KA6 A;  1QGH A;  4KVS A;  5JAC A;  3UNO A;  3AJQ A;  3PVY A;  2V2O A;  2ZG8 X;  2V2P A;  4ZL6 A;  4YKH A;  3NP2 X;  3RBC A;  1UVH A;  4TOE A;  3FRS A;  5C6F A;  2CIH A;  5CMR A;  5HQO A;  2FJC A;  3UOF A;  4PGI A;  4YVZ A;  4W4K B;  4ERU A;  2HTN A;  4TOA A;  3E2C A;  2Z5P A;  4ITT A;  2XJO A;  5LG2 A;  5D8Y A;  2WLU A;  3BT5 A;  3FI6 A;  1LKP A;  1JTS A;  3F35 A;  3GVY A;  3C1Y A;  4EVB A;  3E1P A;  4DAS A;  3KWO A;  3RGD A;  1JIG A;  3RE7 A;  2C41 A;  3IQ1 A;  1NFV A;  2BJY A;  2RBD A;  2WWX B;  2AR0 A;  2C2F A;  3E1O A;  4RC5 B;  4LPJ A;  3Q4N A;  3C21 A;  2CLU A;  3BKN A;  3WVW A;  2V15 A;  4REU A;  2V2S A;  4LQJ A;  1RCG A;  3KA8 A;  1RYT A;  2OH3 A;  3BVL A;  3BVE A;  3SE1 A;  1R03 A;  3KA3 A;  3W54 A;  4II4 A;  4DYX A;  2JD7 0;  2W0O A;  3O7R A;  2V2R A;  1OTK A;  3E1J A;  3QZ3 A;  3VV9 A;  4M32 A;  2VXX A;  2XGW A;  3NOZ X;  4ZKH A;  4ZTT A;  4CMY V;  1FHA A;  3R2L A;  4LQN A;  1BFR A;  1RCD A;  3OGH A;  3F34 A;  5JDO A;  1L8I A;  5ERK A;  2IB0 A;  3F37 A;  5GU2 X;  4EVC A;  4II4 B;  3C1Z A;  1KRQ A;  2Z5R A;  1F33 A;  2ZG7 X;  4RC7 A;  4Y08 A;  4R42 A;  5J8W A;  3PVT A;  4LYX A;  5JKM A;  3M6J A;  4ZL5 A;  2CLB A;  5LG8 A;  5JDO B;  3QHC A;  1XZ3 A;  2V2J A;  3F32 A;  4CY9 A;  3R2S A;  4W4L B;  4MKU A;  1HRS A;  4RC7 B;  3R2H A;  1L8H A;  1F30 A;  3O7S A;  3BVI A;  2V8U A;  2FG4 A;  3PVR A;  3PVT B;  3ES3 A;  4TW3 A;  4DI0 A;  4ETR A;  3AJP A;  5E1U A;  2V2M A;  4ZMC A;  2YW7 A;  1VEL A;  3MPS A;  2V2L A;  1QYB A;  4TOG A;  3PVR B;  3E1Q A;  2CEI A;  4CVS A;  2G38 B;  1SQ3 A;  2OC5 A;  3BVF A;  1VLG A;  2FKZ A;  1VJX A;  5FFE A;  3EGM A;  3PZA A;  3EZU A;  1J30 A;  5D8R A;  1JI5 A;  4DYU A;  5FFA A;  1N1Q A;  4M35 A;  1RCC A;  4ISP A;  1AEW A;  5JKM G;  4OYN A;  4MXP A;  3PVY B;  2IY4 A;  1S3Q A;  3KX9 A;  3FSE A;  3ISF A;  5D8X A;  2XKQ A;  1BCF A;  4TO9 A;  3V3K B;  4YXM A;  3Q4R A;  4DYZ A;  4P18 A;  3AF9 X;  4ITW A;  3JZ9 A;  2JD8 0;  3ISE A;  2MGY A;  2V8T A;  2CHP A;  5GN8 A;  1O9R A;  1NNQ A;  5LS9 A;  3GE4 A;  4YXJ A;  3WVV A;  1O9I A;  3SID A;  3FVB A;  4RC6 A;  4MJY A;  2GYD A;  3E6S A;  2V2I A;  2CHI A;  2FL0 A;  3RD0 A;  1JGC A;  4TOB A;  4ISM A;  3DBY A;  4XKT A;  3UOI A;  3AF7 X;  4IWJ A;  4ML5 A;  4ZLW A;  3E1L A;  5D8O A;  3PW1 A;  3IS7 A;  4KVQ A;  3U90 A;  4CVP A;  2F7N A;  2YW6 A;  1VEQ A;  5K52 A;  5HU6 D;  1YV1 A;  1TJO A;  1ZS3 A;  1MOJ A;  3A9Q A;  2CN7 A;  3HIU A;  4LQV A;  3KA4 A;  4LPN A;  1ZUJ A;  4LPM A;  5J9V A;  3VNX A;  3NP0 X;  5GU1 X;  3KHK A;  3PW1 B;  4XKS A;  1LKM A;  4LYU A;  5J93 A;  2GS4 A;  4CVT A;  1LB3 A;  1RCE A;  3E1M A;  2OKC A;  2FG8 A;  3KXU A;  5J8S A;  5FFB A;  1LKO A;  4TOH A;  5D8Q A;  3JZA B;  1JI4 A;  1DPS A;  5GOU A;  2YJJ A;  5ERJ A;  1DVB A;  4EVE A;  1MFR A;  2XJN A;  4LQH A;  5CZU A;  4IWK A;  3WNW A;  3D19 A;  3PWQ C;  1EUM A;  3HL1 A;  4AM2 A;  3PWQ A;  5D8S A; 
#chains in the Genus database with same CATH homology
 1NF6 A;  2CWL A;  3VVA A;  2ZA8 A;  3R2M A;  5GU0 X;  4WJG 4;  3WVU A;  1BG7 A;  2Y44 A;  4DYY A;  3E6R A;  3R2O A;  3OJ5 A;  4MUD A;  5HJF A;  4ZJK A;  4ZKW A;  2VXI A;  4DZ0 A;  1JYB A;  4CYA A;  3SHX A;  4PGK A;  2Y3Q A;  2XJM A;  1TKP A;  4A25 A;  3AF8 X;  5LBH A;  4Z3B A;  3TA8 A;  2BKC A;  4PG0 A;  4M33 A;  3R2R A;  4PG1 A;  5IX6 A;  2YJK A;  4EVD A;  4IXK A;  1XZ1 A;  3F36 A;  5FEJ A;  3KDQ A;  4X0J A;  2UX1 A;  2QQY A;  1S2Z A;  1H96 A;  2FFX J;  4AM4 A;  4MY7 A;  4DE6 A;  4E6K A;  1IER A;  1JRE A;  3F33 A;  5HJH A;  2CF7 A;  2CN6 A;  3ERZ A;  4Z5S A;  1SOF A;  4TOF A;  3AK9 A;  2HR5 A;  2C2J A;  5GN8 B;  3PW8 C;  2ZA6 A;  3SH6 A;  3A68 A;  4RC5 A;  4TOD A;  2C6R A;  2ZUR X;  3AJO A;  3PW8 A;  1JKU A;  5JKL A;  3QVD A;  1UMN A;  4RC6 B;  3GGZ A;  4AM5 A;  2Z6M A;  4MN9 A;  2PYB A;  3QD8 A;  2GYQ A;  2D5K A;  1B71 A;  4ZKX A;  1S30 A;  4E40 A;  2C2U A;  5D8P A;  5AXS A;  5E2D A;  1IES A;  5I4J A;  3QHB A;  4XGS A;  2JD6 0;  3BVK A;  2Z5Q A;  3KA9 A;  2G4H A;  2QF9 A;  3E1N A;  3F39 A;  3EZ0 A;  3T9J A;  2ZA7 A;  1RCI A;  1Z6O M;  1DAT A;  4XKU A;  3R2K A;  1GWG A;  3FRR A;  4KXR B;  2V2N A;  1TKO A;  4KVR A;  3H7G A;  1Z4A A;  3GGY A;  3GHQ A;  2VZB A;  1NF4 A;  3N6O A;  4QUW A;  2WLA A;  3UFB A;  2X17 0;  2IU2 A;  2FHA A;  1YUZ A;  3Q4Q A;  5JKL G;  4CVR A;  5GU3 X;  1YUX A;  4CYB A;  3PWF A;  2N02 A;  1JKV A;  1TK6 A;  3Q4O A;  2ITB A;  2BK6 A;  2BW1 A;  3F38 A;  2FZF A;  5K53 A;  5CMQ A;  3C23 A;  3QB9 A;  4TOC A;  4U3G A;  1Z6O A;  3IS8 A;  2ZG9 X;  1VEI A;  5FFC A;  3L0M A;  3RAV A;  2Z90 A;  4M34 A;  3AK8 A;  5FFD A;  3LKD A;  4CMY A;  2WTL A;  4RC8 A;  3KA6 A;  1QGH A;  4KVS A;  5JAC A;  3UNO A;  3AJQ A;  3PVY A;  2V2O A;  2ZG8 X;  2V2P A;  4ZL6 A;  4YKH A;  3NP2 X;  3RBC A;  1UVH A;  4TOE A;  3FRS A;  5C6F A;  2CIH A;  5CMR A;  5HQO A;  2FJC A;  3UOF A;  4PGI A;  4YVZ A;  4W4K B;  4ERU A;  2HTN A;  4TOA A;  3E2C A;  2Z5P A;  4ITT A;  2XJO A;  5LG2 A;  5D8Y A;  2WLU A;  3BT5 A;  3FI6 A;  1LKP A;  1JTS A;  3F35 A;  3GVY A;  3C1Y A;  4EVB A;  3E1P A;  4DAS A;  3KWO A;  3RGD A;  1JIG A;  3RE7 A;  2C41 A;  3IQ1 A;  1NFV A;  2BJY A;  2RBD A;  2WWX B;  2AR0 A;  2C2F A;  3E1O A;  4RC5 B;  4LPJ A;  3Q4N A;  3C21 A;  2CLU A;  3BKN A;  3WVW A;  2V15 A;  4REU A;  2V2S A;  4LQJ A;  1RCG A;  3KA8 A;  1RYT A;  2OH3 A;  3BVL A;  3BVE A;  3SE1 A;  1R03 A;  3KA3 A;  3W54 A;  4II4 A;  4DYX A;  2JD7 0;  2W0O A;  3O7R A;  2V2R A;  1OTK A;  3E1J A;  3QZ3 A;  3VV9 A;  4M32 A;  2VXX A;  2XGW A;  3NOZ X;  4ZKH A;  4ZTT A;  4CMY V;  1FHA A;  3R2L A;  4LQN A;  1BFR A;  1RCD A;  3OGH A;  3F34 A;  5JDO A;  1L8I A;  5ERK A;  2IB0 A;  3F37 A;  5GU2 X;  4EVC A;  4II4 B;  3C1Z A;  1KRQ A;  2Z5R A;  1F33 A;  2ZG7 X;  4RC7 A;  4Y08 A;  4R42 A;  5J8W A;  3PVT A;  4LYX A;  5JKM A;  3M6J A;  4ZL5 A;  2CLB A;  5LG8 A;  5JDO B;  3QHC A;  1XZ3 A;  2V2J A;  3F32 A;  4CY9 A;  3R2S A;  4W4L B;  4MKU A;  1HRS A;  4RC7 B;  3R2H A;  1L8H A;  1F30 A;  3O7S A;  3BVI A;  2V8U A;  2FG4 A;  3PVR A;  3PVT B;  3ES3 A;  4TW3 A;  4DI0 A;  4ETR A;  3AJP A;  5E1U A;  2V2M A;  4ZMC A;  2YW7 A;  1VEL A;  3MPS A;  2V2L A;  1QYB A;  4TOG A;  3PVR B;  3E1Q A;  2CEI A;  4CVS A;  2G38 B;  1SQ3 A;  2OC5 A;  3BVF A;  1VLG A;  2FKZ A;  1VJX A;  5FFE A;  3EGM A;  3PZA A;  3EZU A;  1J30 A;  5D8R A;  1JI5 A;  4DYU A;  5FFA A;  1N1Q A;  4M35 A;  1RCC A;  4ISP A;  1AEW A;  5JKM G;  4OYN A;  4MXP A;  3PVY B;  2IY4 A;  1S3Q A;  3KX9 A;  3FSE A;  3ISF A;  5D8X A;  2XKQ A;  1BCF A;  4TO9 A;  3V3K B;  4YXM A;  3Q4R A;  4DYZ A;  4P18 A;  3AF9 X;  4ITW A;  3JZ9 A;  2JD8 0;  3ISE A;  2MGY A;  2V8T A;  2CHP A;  5GN8 A;  1O9R A;  1NNQ A;  5LS9 A;  3GE4 A;  4YXJ A;  3WVV A;  1O9I A;  3SID A;  3FVB A;  4RC6 A;  4MJY A;  2GYD A;  3E6S A;  2V2I A;  2CHI A;  2FL0 A;  3RD0 A;  1JGC A;  4TOB A;  4ISM A;  3DBY A;  4XKT A;  3UOI A;  3AF7 X;  4IWJ A;  4ML5 A;  4ZLW A;  3E1L A;  5D8O A;  3PW1 A;  3IS7 A;  4KVQ A;  3U90 A;  4CVP A;  2F7N A;  2YW6 A;  1VEQ A;  5K52 A;  5HU6 D;  1YV1 A;  1TJO A;  1ZS3 A;  1MOJ A;  3A9Q A;  2CN7 A;  3HIU A;  4LQV A;  3KA4 A;  4LPN A;  1ZUJ A;  4LPM A;  5J9V A;  3VNX A;  3NP0 X;  5GU1 X;  3KHK A;  3PW1 B;  4XKS A;  1LKM A;  4LYU A;  5J93 A;  2GS4 A;  4CVT A;  1LB3 A;  1RCE A;  3E1M A;  2OKC A;  2FG8 A;  3KXU A;  5J8S A;  5FFB A;  1LKO A;  4TOH A;  5D8Q A;  3JZA B;  1JI4 A;  1DPS A;  5GOU A;  2YJJ A;  5ERJ A;  1DVB A;  4EVE A;  1MFR A;  2XJN A;  4LQH A;  5CZU A;  4IWK A;  3WNW A;  3D19 A;  3PWQ C;  1EUM A;  3HL1 A;  4AM2 A;  3PWQ A;  5D8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...