4CMYV

Chlorobium tepidum ferritin
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
163
structure length
163
Chain Sequence
MLSKTILDKLNHQVNFEAASAHLYLQMSAWLLTQSLDSTAAFFRAHAEEEKAHMMKLFDYINETGSLALIGEVATPAPEWKSHIELLEAAYNHELAITQSINDLVDTALREKDYSTFQFLQWYVAEQHEEEYLFSSMLHKARIIDTMDGRALFRFDEEVRKSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERRITIN
publication title The Crystal Structure of Ferritin from Chlorobium Tepidum Reveals a New Conformation of the 4-Fold Channel for This Protein Family.
pubmed doi rcsb
source organism Chlorobaculum tepidum
molecule tags Metal transport
total genus 75
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2014-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4cmyV00
4RC8A 2G4HA 1YUXA 4TOHA 2JD70 1RCIA 4A25A 2VXIA 2FJCA 1NF4A 3ERZA 1H96A 3RD0A 3PVRB 2Z5QA 3E6RA 4CYAA 5IX6A 4ZTTA 3SHXA 2F7NA 3ISEA 2C2UA 2Y3QA 1YUZA 2HR5A 4ITWA 3PVYA 3Q4RA 1ZUJA 1XZ3A 5JACA 1IESA 3E1JA 4MN9A 4EVBA 4RC6A 4EVDA 3U90A 4CMYA 3IQ1A 1JIGA 3ISFA 3AJPA 3KA3A 3BVIA 5JKLG 2YJKA 4DYZA 3SE1A 3TA8A 4LPJA 5FEJA 3E1QA 4OYNA 4ZL6A 5LS9A 3H7GA 3WNWA 5J8WA 4DYXA 4TOFA 3OGHA 3RBCA 4MKUA 4KVRA 4M35A 4MJYA 2IY4A 2WLAA 3KXUA 5D8OA 3BKNA 4Z3BA 2GYDA 2XJNA 1L8IA 3R2KA 4Z5SA 2FL0A 4EVCA 3F32A 4M34A 2IU2A 1Z4AA 2FHAA 3NP0X 4PG0A 4CVPA 1TJOA 3F34A 2XJOA 3PWQA 1NFVA 3QHCA 1F30A 3GHQA 1JTSA 5JKMG 4ITTA 5D8PA 3KA4A 2CHIA 1SOFA 4RC7B 2CN6A 2PYBA 5D8SA 1RCCA 3QB9A 2YW6A 2ZA8A 1BG7A 3HIUA 1LB3A 4KVQA 3EZ0A 5GU2X 3AJQA 3BVLA 3NP2X 1TKOA 2ZA7A 5D8RA 1R03A 4M32A 5I4JA 2XKQA 4LQNA 1JI4A 3KA6A 1Z6OM 3O7SA 4DASA 3F36A 2XGWA 4ZL5A 2FG4A 4XGSA 2CN7A 3KA8A 5LG2A 2V2SA 4AM2A 5FFBA 3A68A 5GU0X 1RCDA 1J30A 4LQVA 1LKMA 5AXSA 4ZJKA 3E2CA 4ZKHA 4CVTA 3PVTB 5LBHA 3PW1A 5CMRA 4ISMA 3O7RA 2FG8A 3PWFA 3GVYA 2FZFA 1RYTA 4CY9A 5D8QA 3RGDA 2WLUA 1DATA 2CIHA 3PVRA 2V2RA 3Q4QA 4IWJA 3OJ5A 4MY7A 3PVYB 3AF7X 1Z6OA 3AK8A 4TOEA 4RC6B 1RCEA 1QYBA 3QD8A 4II4A 2OH3A 4TW3A 3HL1A 4EVEA 5GOUA 3MPSA 4ZKWA 2Z5PA 3R2RA 5FFCA 4TO9A 3UOIA 3F38A 1TKPA 4XKSA 1JKUA 5ERJA 4ERUA 1DPSA 5J8SA 5GU1X 2V2MA 2ITBA 2XJMA 1NF6A 3EGMA 4LQHA 5HJHA 4IXKA 5D8YA 2UX1A 1ZS3A 3UOFA 2GYQA 2C2JA 3QZ3A 2OC5A 2BKCA 3WVUA 1O9RA 2V2IA 3UNOA 3QHBA 2YJJA 3BVFA 2V2LA 3SH6A 2CHPA 1O9IA 1AEWA 4DYUA 4RC7A 5E1UA 3R2HA 1S2ZA 3F39A 3AF9X 3PW8C 2ZURX 4LPNA 4YKHA 3QVDA 3F35A 4RC5A 3A9QA 2WTLA 4ETRA 1VEIA 4CVSA 5HQOA 4DE6A 3Q4NA 1B71A 3E6SA 4M33A 5CZUA 4DI0A 2ZG8X 5FFEA 1EUMA 2X170 4LQJA 3E1MA 5D8XA 1MFRA 3R2OA 3IS8A 3SIDA 1S3QA 2JD80 1JI5A 2V15A 3T9JA 5GU3X 4ML5A 4U3GA 3AK9A 4CMYV 5J93A 5K52A 5HJFA 5GN8A 1UMNA 4Y08A 1GWGA 1MOJA 3RAVA 3PW1B 2CLBA 1QGHA 4PGKA 4ISPA 2VZBA 2V2NA 2ZG7X 3E1OA 2V2JA 4LPMA 4E6KA 4LYXA 4DYYA 1BCFA 3EZUA 2YW7A 4TOGA 3BVKA 4AM5A 2Z6MA 5J9VA 3AF8X 1BFRA 5JKMA 4DZ0A 3FVBA 5E2DA 4II4B 4ZKXA 4ZLWA 3BT5A 3R2SA 3WVVA 2C2FA 3PZAA 5K53A 2JD60 4LYUA 4R42A 1RCGA 5FFDA 2CEIA 1YV1A 3FI6A 1VEQA 5LG8A 1LKPA 3F33A 3PWQC 3AJOA 4PG1A 2C41A 1VJXA 3E1NA 2V2PA 3FSEA 4AM4A 3ES3A 2ZG9X 4QUWA 3GE4A 1JKVA 3NOZX 2QF9A 2Z90A 2W0OA 2VXXA 3IS7A 5C6FA 4TOBA 2IB0A 4KVSA 2BW1A 5CMQA 4TODA 2FFXJ 2GS4A 2Z5RA 4TOAA 1VLGA 1DVBA 1L8HA 3RE7A 2CLUA 5ERKA 4REUA 2HTNA 4MUDA 4P18A 1JREA 1SQ3A 3VNXA 2BK6A 3KWOA 1NNQA 5FFAA 1F33A 1HRSA 1IERA 3R2LA 2CF7A 1XZ1A 4RC5B 4TOCA 3E1PA 2FKZA 1FHAA 3F37A 4XKTA 1N1QA 1OTKA 1JYBA 2D5KA 3R2MA 4IWKA 5JKLA 2RBDA 3KA9A 4CVRA 1UVHA 3PW8A 3E1LA 2BJYA 2QQYA 1JGCA 3KX9A 2V2OA 1VELA 4ZMCA 1LKOA 4XKUA 4PGIA 3PVTA 2C6RA 3BVEA 1S30A 1TK6A 1KRQA 3Q4OA 2ZA6A 5GN8B 4CYBA 3WVWA
chains in the Genus database with same CATH superfamily
4RC8A 2G4HA 1YUXA 4TOHA 2JD70 1RCIA 4A25A 2VXIA 2FJCA 1NF4A 3ERZA 1H96A 3RD0A 3PVRB 2Z5QA 3E6RA 4CYAA 5IX6A 3FRSA 3FRRA 4ZTTA 3SHXA 2F7NA 3ISEA 2C2UA 2Y3QA 1YUZA 2HR5A 4ITWA 3PVYA 3Q4RA 1ZUJA 1XZ3A 3DBYA 5JACA 1IESA 3E1JA 4MN9A 4EVBA 4RC6A 4EVDA 3U90A 4CMYA 3IQ1A 1JIGA 3ISFA 3AJPA 3KA3A 3BVIA 4MXPA 5JKLG 2YJKA 4DYZA 3SE1A 2MGYA 3TA8A 4LPJA 5FEJA 3E1QA 4OYNA 3D19A 4ZL6A 5LS9A 3H7GA 3WNWA 5J8WA 4DYXA 4TOFA 3OGHA 3RBCA 4MKUA 4KVRA 4M35A 4MJYA 2V8UA 2IY4A 2WLAA 3KXUA 5D8OA 3BKNA 4Z3BA 2GYDA 2XJNA 1L8IA 3R2KA 4Z5SA 2FL0A 4EVCA 3F32A 4M34A 2IU2A 1Z4AA 2FHAA 3NP0X 4PG0A 3W54A 2N02A 2V8TA 4CVPA 1TJOA 3F34A 2XJOA 3PWQA 1NFVA 3QHCA 1F30A 3GHQA 1JTSA 5JKMG 5HU6D 4ITTA 5D8PA 3KA4A 3N6OA 2CHIA 1SOFA 4RC7B 2CN6A 2PYBA 5D8SA 1RCCA 3LKDA 3QB9A 2YW6A 2ZA8A 1BG7A 3HIUA 1LB3A 4KVQA 3EZ0A 5GU2X 3AJQA 3BVLA 3NP2X 1TKOA 2ZA7A 5D8RA 3UFBA 1R03A 4M32A 5I4JA 2XKQA 4LQNA 1JI4A 3KA6A 1Z6OM 3O7SA 4DASA 3F36A 2XGWA 4ZL5A 2FG4A 4XGSA 2CN7A 3KA8A 5LG2A 2V2SA 4AM2A 5FFBA 3A68A 5GU0X 1RCDA 1J30A 4LQVA 1LKMA 5AXSA 4ZJKA 3E2CA 4ZKHA 4CVTA 3PVTB 5LBHA 3PW1A 5CMRA 4ISMA 3O7RA 2FG8A 3PWFA 3GVYA 2FZFA 1RYTA 4CY9A 5D8QA 3RGDA 3C21A 2WLUA 1DATA 2CIHA 3PVRA 2V2RA 3Q4QA 4IWJA 3OJ5A 4MY7A 3PVYB 3AF7X 3VVAA 1Z6OA 3AK8A 4TOEA 5JDOA 4RC6B 1RCEA 1QYBA 3QD8A 4II4A 2OH3A 4TW3A 3HL1A 4EVEA 5GOUA 3MPSA 4ZKWA 2Z5PA 3R2RA 5FFCA 4TO9A 3L0MA 3UOIA 3F38A 1TKPA 4XKSA 1JKUA 5ERJA 4ERUA 1DPSA 4KXRB 5J8SA 4W4LB 3V3KB 5GU1X 2V2MA 2ITBA 2XJMA 4YXMA 1NF6A 3EGMA 4LQHA 5HJHA 4IXKA 3C1ZA 5D8YA 2UX1A 1ZS3A 3UOFA 2GYQA 2C2JA 3QZ3A 2OC5A 2BKCA 3WVUA 1O9RA 2V2IA 3UNOA 3JZAB 3QHBA 2YJJA 4YVZA 3BVFA 2V2LA 3SH6A 2CHPA 1O9IA 1AEWA 4DYUA 4RC7A 5E1UA 3R2HA 1S2ZA 3F39A 3AF9X 3PW8C 2ZURX 2WWXB 4LPNA 4YKHA 3QVDA 3F35A 4RC5A 3A9QA 2WTLA 4ETRA 1VEIA 4CVSA 5HQOA 4DE6A 3Q4NA 1B71A 3E6SA 4M33A 5CZUA 4DI0A 2ZG8X 5FFEA 1EUMA 2X170 4LQJA 3E1MA 5D8XA 1MFRA 3R2OA 3IS8A 3SIDA 1S3QA 2JD80 1JI5A 2V15A 3T9JA 2AR0A 5GU3X 4ML5A 4U3GA 3AK9A 4CMYV 5J93A 5K52A 5HJFA 5GN8A 1UMNA 4Y08A 1GWGA 1MOJA 3RAVA 3PW1B 2CLBA 1QGHA 4PGKA 4ISPA 2VZBA 2V2NA 2Y44A 2ZG7X 3E1OA 2V2JA 4LPMA 4E6KA 4LYXA 4DYYA 1BCFA 3EZUA 3M6JA 2YW7A 4TOGA 3BVKA 4W4KB 2G38B 4AM5A 2Z6MA 4E40A 5J9VA 3GGZA 3AF8X 5JDOB 1BFRA 5JKMA 4DZ0A 3FVBA 5E2DA 4II4B 4ZKXA 4ZLWA 3BT5A 3R2SA 3WVVA 2C2FA 3C1YA 3KDQA 3PZAA 5K53A 2JD60 4LYUA 4R42A 1RCGA 4X0JA 5FFDA 2CEIA 1YV1A 3FI6A 1VEQA 5LG8A 1LKPA 3F33A 3PWQC 3AJOA 4PG1A 2CWLA 2C41A 1VJXA 3E1NA 2OKCA 2V2PA 3FSEA 4AM4A 3KHKA 3ES3A 2ZG9X 4QUWA 3GE4A 1JKVA 3NOZX 2QF9A 2Z90A 3JZ9A 2W0OA 2VXXA 3IS7A 4WJG4 5C6FA 4TOBA 2IB0A 4KVSA 2BW1A 5CMQA 4TODA 2FFXJ 2GS4A 2Z5RA 4TOAA 1VLGA 1DVBA 1L8HA 3RE7A 2CLUA 5ERKA 4REUA 2HTNA 4MUDA 4P18A 1JREA 1SQ3A 3VNXA 2BK6A 3KWOA 1NNQA 5FFAA 1F33A 1HRSA 1IERA 3R2LA 2CF7A 1XZ1A 4RC5B 4TOCA 3E1PA 2FKZA 1FHAA 3F37A 4XKTA 1N1QA 1OTKA 1JYBA 2D5KA 3R2MA 4IWKA 5JKLA 2RBDA 3KA9A 4CVRA 3VV9A 1UVHA 3PW8A 3E1LA 2BJYA 2QQYA 1JGCA 3KX9A 2V2OA 1VELA 4YXJA 4ZMCA 1LKOA 4XKUA 4PGIA 3PVTA 2C6RA 3BVEA 1S30A 1TK6A 1KRQA 3C23A 3Q4OA 2ZA6A 5GN8B 4CYBA 3GGYA 3WVWA
chains in the Genus database with same CATH topology
4RC8A 2G4HA 1YUXA 4TOHA 2JD70 1RCIA 4A25A 2VXIA 2FJCA 1NF4A 3ERZA 1H96A 3RD0A 3PVRB 2Z5QA 3E6RA 4CYAA 5IX6A 3FRSA 3FRRA 4ZTTA 3SHXA 2F7NA 3ISEA 2C2UA 2Y3QA 1YUZA 2HR5A 4ITWA 3PVYA 3Q4RA 1ZUJA 1XZ3A 3DBYA 5JACA 1IESA 3E1JA 4MN9A 4EVBA 4RC6A 4EVDA 3U90A 4CMYA 3IQ1A 1JIGA 3ISFA 3AJPA 3KA3A 3BVIA 4MXPA 5JKLG 2YJKA 4DYZA 3SE1A 2MGYA 3TA8A 4LPJA 5FEJA 3E1QA 4OYNA 3D19A 4ZL6A 5LS9A 3H7GA 3WNWA 5J8WA 4DYXA 4TOFA 3OGHA 3RBCA 4MKUA 4KVRA 4M35A 4MJYA 2V8UA 2IY4A 2WLAA 3KXUA 5D8OA 3BKNA 4Z3BA 2GYDA 2XJNA 1L8IA 3R2KA 4Z5SA 2FL0A 4EVCA 3F32A 4M34A 2IU2A 1Z4AA 2FHAA 3NP0X 4PG0A 3W54A 2N02A 2V8TA 4CVPA 1TJOA 3F34A 2XJOA 3PWQA 1NFVA 3QHCA 1F30A 3GHQA 1JTSA 5JKMG 5HU6D 4ITTA 5D8PA 3KA4A 3N6OA 2CHIA 1SOFA 4RC7B 2CN6A 2PYBA 5D8SA 1RCCA 3LKDA 3QB9A 2YW6A 2ZA8A 1BG7A 3HIUA 1LB3A 4KVQA 3EZ0A 5GU2X 3AJQA 3BVLA 3NP2X 1TKOA 2ZA7A 5D8RA 3UFBA 1R03A 4M32A 5I4JA 2XKQA 4LQNA 1JI4A 3KA6A 1Z6OM 3O7SA 4DASA 3F36A 2XGWA 4ZL5A 2FG4A 4XGSA 2CN7A 3KA8A 5LG2A 2V2SA 4AM2A 5FFBA 3A68A 5GU0X 1RCDA 1J30A 4LQVA 1LKMA 5AXSA 4ZJKA 3E2CA 4ZKHA 4CVTA 3PVTB 5LBHA 3PW1A 5CMRA 4ISMA 3O7RA 2FG8A 3PWFA 3GVYA 2FZFA 1RYTA 4CY9A 5D8QA 3RGDA 3C21A 2WLUA 1DATA 2CIHA 3PVRA 2V2RA 3Q4QA 4IWJA 3OJ5A 4MY7A 3PVYB 3AF7X 3VVAA 1Z6OA 3AK8A 4TOEA 5JDOA 4RC6B 1RCEA 1QYBA 3QD8A 4II4A 2OH3A 4TW3A 3HL1A 4EVEA 5GOUA 3MPSA 4ZKWA 2Z5PA 3R2RA 5FFCA 4TO9A 3L0MA 3UOIA 3F38A 1TKPA 4XKSA 1JKUA 5ERJA 4ERUA 1DPSA 4KXRB 5J8SA 4W4LB 3V3KB 5GU1X 2V2MA 2ITBA 2XJMA 4YXMA 1NF6A 3EGMA 4LQHA 5HJHA 4IXKA 3C1ZA 5D8YA 2UX1A 1ZS3A 3UOFA 2GYQA 2C2JA 3QZ3A 2OC5A 2BKCA 3WVUA 1O9RA 2V2IA 3UNOA 3JZAB 3QHBA 2YJJA 4YVZA 3BVFA 2V2LA 3SH6A 2CHPA 1O9IA 1AEWA 4DYUA 4RC7A 5E1UA 3R2HA 1S2ZA 3F39A 3AF9X 3PW8C 2ZURX 2WWXB 4LPNA 4YKHA 3QVDA 3F35A 4RC5A 3A9QA 2WTLA 4ETRA 1VEIA 4CVSA 5HQOA 4DE6A 3Q4NA 1B71A 3E6SA 4M33A 5CZUA 4DI0A 2ZG8X 5FFEA 1EUMA 2X170 4LQJA 3E1MA 5D8XA 1MFRA 3R2OA 3IS8A 3SIDA 1S3QA 2JD80 1JI5A 2V15A 3T9JA 2AR0A 5GU3X 4ML5A 4U3GA 3AK9A 4CMYV 5J93A 5K52A 5HJFA 5GN8A 1UMNA 4Y08A 1GWGA 1MOJA 3RAVA 3PW1B 2CLBA 1QGHA 4PGKA 4ISPA 2VZBA 2V2NA 2Y44A 2ZG7X 3E1OA 2V2JA 4LPMA 4E6KA 4LYXA 4DYYA 1BCFA 3EZUA 3M6JA 2YW7A 4TOGA 3BVKA 4W4KB 2G38B 4AM5A 2Z6MA 4E40A 5J9VA 3GGZA 3AF8X 5JDOB 1BFRA 5JKMA 4DZ0A 3FVBA 5E2DA 4II4B 4ZKXA 4ZLWA 3BT5A 3R2SA 3WVVA 2C2FA 3C1YA 3KDQA 3PZAA 5K53A 2JD60 4LYUA 4R42A 1RCGA 4X0JA 5FFDA 2CEIA 1YV1A 3FI6A 1VEQA 5LG8A 1LKPA 3F33A 3PWQC 3AJOA 4PG1A 2CWLA 2C41A 1VJXA 3E1NA 2OKCA 2V2PA 3FSEA 4AM4A 3KHKA 3ES3A 2ZG9X 4QUWA 3GE4A 1JKVA 3NOZX 2QF9A 2Z90A 3JZ9A 2W0OA 2VXXA 3IS7A 4WJG4 5C6FA 4TOBA 2IB0A 4KVSA 2BW1A 5CMQA 4TODA 2FFXJ 2GS4A 2Z5RA 4TOAA 1VLGA 1DVBA 1L8HA 3RE7A 2CLUA 5ERKA 4REUA 2HTNA 4MUDA 4P18A 1JREA 1SQ3A 3VNXA 2BK6A 3KWOA 1NNQA 5FFAA 1F33A 1HRSA 1IERA 3R2LA 2CF7A 1XZ1A 4RC5B 4TOCA 3E1PA 2FKZA 1FHAA 3F37A 4XKTA 1N1QA 1OTKA 1JYBA 2D5KA 3R2MA 4IWKA 5JKLA 2RBDA 3KA9A 4CVRA 3VV9A 1UVHA 3PW8A 3E1LA 2BJYA 2QQYA 1JGCA 3KX9A 2V2OA 1VELA 4YXJA 4ZMCA 1LKOA 4XKUA 4PGIA 3PVTA 2C6RA 3BVEA 1S30A 1TK6A 1KRQA 3C23A 3Q4OA 2ZA6A 5GN8B 4CYBA 3GGYA 3WVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RC8 A;  2G4H A;  1YUX A;  4TOH A;  2JD7 0;  1RCI A;  4A25 A;  2VXI A;  2FJC A;  1NF4 A;  3ERZ A;  1H96 A;  3RD0 A;  3PVR B;  2Z5Q A;  3E6R A;  4CYA A;  5IX6 A;  4ZTT A;  3SHX A;  2F7N A;  3ISE A;  2C2U A;  2Y3Q A;  1YUZ A;  2HR5 A;  4ITW A;  3PVY A;  3Q4R A;  1ZUJ A;  1XZ3 A;  5JAC A;  1IES A;  3E1J A;  4MN9 A;  4EVB A;  4RC6 A;  4EVD A;  3U90 A;  4CMY A;  3IQ1 A;  1JIG A;  3ISF A;  3AJP A;  3KA3 A;  3BVI A;  5JKL G;  2YJK A;  4DYZ A;  3SE1 A;  3TA8 A;  4LPJ A;  5FEJ A;  3E1Q A;  4OYN A;  4ZL6 A;  5LS9 A;  3H7G A;  3WNW A;  5J8W A;  4DYX A;  4TOF A;  3OGH A;  3RBC A;  4MKU A;  4KVR A;  4M35 A;  4MJY A;  2IY4 A;  2WLA A;  3KXU A;  5D8O A;  3BKN A;  4Z3B A;  2GYD A;  2XJN A;  1L8I A;  3R2K A;  4Z5S A;  2FL0 A;  4EVC A;  3F32 A;  4M34 A;  2IU2 A;  1Z4A A;  2FHA A;  3NP0 X;  4PG0 A;  4CVP A;  1TJO A;  3F34 A;  2XJO A;  3PWQ A;  1NFV A;  3QHC A;  1F30 A;  3GHQ A;  1JTS A;  5JKM G;  4ITT A;  5D8P A;  3KA4 A;  2CHI A;  1SOF A;  4RC7 B;  2CN6 A;  2PYB A;  5D8S A;  1RCC A;  3QB9 A;  2YW6 A;  2ZA8 A;  1BG7 A;  3HIU A;  1LB3 A;  4KVQ A;  3EZ0 A;  5GU2 X;  3AJQ A;  3BVL A;  3NP2 X;  1TKO A;  2ZA7 A;  5D8R A;  1R03 A;  4M32 A;  5I4J A;  2XKQ A;  4LQN A;  1JI4 A;  3KA6 A;  1Z6O M;  3O7S A;  4DAS A;  3F36 A;  2XGW A;  4ZL5 A;  2FG4 A;  4XGS A;  2CN7 A;  3KA8 A;  5LG2 A;  2V2S A;  4AM2 A;  5FFB A;  3A68 A;  5GU0 X;  1RCD A;  1J30 A;  4LQV A;  1LKM A;  5AXS A;  4ZJK A;  3E2C A;  4ZKH A;  4CVT A;  3PVT B;  5LBH A;  3PW1 A;  5CMR A;  4ISM A;  3O7R A;  2FG8 A;  3PWF A;  3GVY A;  2FZF A;  1RYT A;  4CY9 A;  5D8Q A;  3RGD A;  2WLU A;  1DAT A;  2CIH A;  3PVR A;  2V2R A;  3Q4Q A;  4IWJ A;  3OJ5 A;  4MY7 A;  3PVY B;  3AF7 X;  1Z6O A;  3AK8 A;  4TOE A;  4RC6 B;  1RCE A;  1QYB A;  3QD8 A;  4II4 A;  2OH3 A;  4TW3 A;  3HL1 A;  4EVE A;  5GOU A;  3MPS A;  4ZKW A;  2Z5P A;  3R2R A;  5FFC A;  4TO9 A;  3UOI A;  3F38 A;  1TKP A;  4XKS A;  1JKU A;  5ERJ A;  4ERU A;  1DPS A;  5J8S A;  5GU1 X;  2V2M A;  2ITB A;  2XJM A;  1NF6 A;  3EGM A;  4LQH A;  5HJH A;  4IXK A;  5D8Y A;  2UX1 A;  1ZS3 A;  3UOF A;  2GYQ A;  2C2J A;  3QZ3 A;  2OC5 A;  2BKC A;  3WVU A;  1O9R A;  2V2I A;  3UNO A;  3QHB A;  2YJJ A;  3BVF A;  2V2L A;  3SH6 A;  2CHP A;  1O9I A;  1AEW A;  4DYU A;  4RC7 A;  5E1U A;  3R2H A;  1S2Z A;  3F39 A;  3AF9 X;  3PW8 C;  2ZUR X;  4LPN A;  4YKH A;  3QVD A;  3F35 A;  4RC5 A;  3A9Q A;  2WTL A;  4ETR A;  1VEI A;  4CVS A;  5HQO A;  4DE6 A;  3Q4N A;  1B71 A;  3E6S A;  4M33 A;  5CZU A;  4DI0 A;  2ZG8 X;  5FFE A;  1EUM A;  2X17 0;  4LQJ A;  3E1M A;  5D8X A;  1MFR A;  3R2O A;  3IS8 A;  3SID A;  1S3Q A;  2JD8 0;  1JI5 A;  2V15 A;  3T9J A;  5GU3 X;  4ML5 A;  4U3G A;  3AK9 A;  4CMY V;  5J93 A;  5K52 A;  5HJF A;  5GN8 A;  1UMN A;  4Y08 A;  1GWG A;  1MOJ A;  3RAV A;  3PW1 B;  2CLB A;  1QGH A;  4PGK A;  4ISP A;  2VZB A;  2V2N A;  2ZG7 X;  3E1O A;  2V2J A;  4LPM A;  4E6K A;  4LYX A;  4DYY A;  1BCF A;  3EZU A;  2YW7 A;  4TOG A;  3BVK A;  4AM5 A;  2Z6M A;  5J9V A;  3AF8 X;  1BFR A;  5JKM A;  4DZ0 A;  3FVB A;  5E2D A;  4II4 B;  4ZKX A;  4ZLW A;  3BT5 A;  3R2S A;  3WVV A;  2C2F A;  3PZA A;  5K53 A;  2JD6 0;  4LYU A;  4R42 A;  1RCG A;  5FFD A;  2CEI A;  1YV1 A;  3FI6 A;  1VEQ A;  5LG8 A;  1LKP A;  3F33 A;  3PWQ C;  3AJO A;  4PG1 A;  2C41 A;  1VJX A;  3E1N A;  2V2P A;  3FSE A;  4AM4 A;  3ES3 A;  2ZG9 X;  4QUW A;  3GE4 A;  1JKV A;  3NOZ X;  2QF9 A;  2Z90 A;  2W0O A;  2VXX A;  3IS7 A;  5C6F A;  4TOB A;  2IB0 A;  4KVS A;  2BW1 A;  5CMQ A;  4TOD A;  2FFX J;  2GS4 A;  2Z5R A;  4TOA A;  1VLG A;  1DVB A;  1L8H A;  3RE7 A;  2CLU A;  5ERK A;  4REU A;  2HTN A;  4MUD A;  4P18 A;  1JRE A;  1SQ3 A;  3VNX A;  2BK6 A;  3KWO A;  1NNQ A;  5FFA A;  1F33 A;  1HRS A;  1IER A;  3R2L A;  2CF7 A;  1XZ1 A;  4RC5 B;  4TOC A;  3E1P A;  2FKZ A;  1FHA A;  3F37 A;  4XKT A;  1N1Q A;  1OTK A;  1JYB A;  2D5K A;  3R2M A;  4IWK A;  5JKL A;  2RBD A;  3KA9 A;  4CVR A;  1UVH A;  3PW8 A;  3E1L A;  2BJY A;  2QQY A;  1JGC A;  3KX9 A;  2V2O A;  1VEL A;  4ZMC A;  1LKO A;  4XKU A;  4PGI A;  3PVT A;  2C6R A;  3BVE A;  1S30 A;  1TK6 A;  1KRQ A;  3Q4O A;  2ZA6 A;  5GN8 B;  4CYB A;  3WVW A; 
#chains in the Genus database with same CATH topology
 4RC8 A;  2G4H A;  1YUX A;  4TOH A;  2JD7 0;  1RCI A;  4A25 A;  2VXI A;  2FJC A;  1NF4 A;  3ERZ A;  1H96 A;  3RD0 A;  3PVR B;  2Z5Q A;  3E6R A;  4CYA A;  5IX6 A;  3FRS A;  3FRR A;  4ZTT A;  3SHX A;  2F7N A;  3ISE A;  2C2U A;  2Y3Q A;  1YUZ A;  2HR5 A;  4ITW A;  3PVY A;  3Q4R A;  1ZUJ A;  1XZ3 A;  3DBY A;  5JAC A;  1IES A;  3E1J A;  4MN9 A;  4EVB A;  4RC6 A;  4EVD A;  3U90 A;  4CMY A;  3IQ1 A;  1JIG A;  3ISF A;  3AJP A;  3KA3 A;  3BVI A;  4MXP A;  5JKL G;  2YJK A;  4DYZ A;  3SE1 A;  2MGY A;  3TA8 A;  4LPJ A;  5FEJ A;  3E1Q A;  4OYN A;  3D19 A;  4ZL6 A;  5LS9 A;  3H7G A;  3WNW A;  5J8W A;  4DYX A;  4TOF A;  3OGH A;  3RBC A;  4MKU A;  4KVR A;  4M35 A;  4MJY A;  2V8U A;  2IY4 A;  2WLA A;  3KXU A;  5D8O A;  3BKN A;  4Z3B A;  2GYD A;  2XJN A;  1L8I A;  3R2K A;  4Z5S A;  2FL0 A;  4EVC A;  3F32 A;  4M34 A;  2IU2 A;  1Z4A A;  2FHA A;  3NP0 X;  4PG0 A;  3W54 A;  2N02 A;  2V8T A;  4CVP A;  1TJO A;  3F34 A;  2XJO A;  3PWQ A;  1NFV A;  3QHC A;  1F30 A;  3GHQ A;  1JTS A;  5JKM G;  5HU6 D;  4ITT A;  5D8P A;  3KA4 A;  3N6O A;  2CHI A;  1SOF A;  4RC7 B;  2CN6 A;  2PYB A;  5D8S A;  1RCC A;  3LKD A;  3QB9 A;  2YW6 A;  2ZA8 A;  1BG7 A;  3HIU A;  1LB3 A;  4KVQ A;  3EZ0 A;  5GU2 X;  3AJQ A;  3BVL A;  3NP2 X;  1TKO A;  2ZA7 A;  5D8R A;  3UFB A;  1R03 A;  4M32 A;  5I4J A;  2XKQ A;  4LQN A;  1JI4 A;  3KA6 A;  1Z6O M;  3O7S A;  4DAS A;  3F36 A;  2XGW A;  4ZL5 A;  2FG4 A;  4XGS A;  2CN7 A;  3KA8 A;  5LG2 A;  2V2S A;  4AM2 A;  5FFB A;  3A68 A;  5GU0 X;  1RCD A;  1J30 A;  4LQV A;  1LKM A;  5AXS A;  4ZJK A;  3E2C A;  4ZKH A;  4CVT A;  3PVT B;  5LBH A;  3PW1 A;  5CMR A;  4ISM A;  3O7R A;  2FG8 A;  3PWF A;  3GVY A;  2FZF A;  1RYT A;  4CY9 A;  5D8Q A;  3RGD A;  3C21 A;  2WLU A;  1DAT A;  2CIH A;  3PVR A;  2V2R A;  3Q4Q A;  4IWJ A;  3OJ5 A;  4MY7 A;  3PVY B;  3AF7 X;  3VVA A;  1Z6O A;  3AK8 A;  4TOE A;  5JDO A;  4RC6 B;  1RCE A;  1QYB A;  3QD8 A;  4II4 A;  2OH3 A;  4TW3 A;  3HL1 A;  4EVE A;  5GOU A;  3MPS A;  4ZKW A;  2Z5P A;  3R2R A;  5FFC A;  4TO9 A;  3L0M A;  3UOI A;  3F38 A;  1TKP A;  4XKS A;  1JKU A;  5ERJ A;  4ERU A;  1DPS A;  4KXR B;  5J8S A;  4W4L B;  3V3K B;  5GU1 X;  2V2M A;  2ITB A;  2XJM A;  4YXM A;  1NF6 A;  3EGM A;  4LQH A;  5HJH A;  4IXK A;  3C1Z A;  5D8Y A;  2UX1 A;  1ZS3 A;  3UOF A;  2GYQ A;  2C2J A;  3QZ3 A;  2OC5 A;  2BKC A;  3WVU A;  1O9R A;  2V2I A;  3UNO A;  3JZA B;  3QHB A;  2YJJ A;  4YVZ A;  3BVF A;  2V2L A;  3SH6 A;  2CHP A;  1O9I A;  1AEW A;  4DYU A;  4RC7 A;  5E1U A;  3R2H A;  1S2Z A;  3F39 A;  3AF9 X;  3PW8 C;  2ZUR X;  2WWX B;  4LPN A;  4YKH A;  3QVD A;  3F35 A;  4RC5 A;  3A9Q A;  2WTL A;  4ETR A;  1VEI A;  4CVS A;  5HQO A;  4DE6 A;  3Q4N A;  1B71 A;  3E6S A;  4M33 A;  5CZU A;  4DI0 A;  2ZG8 X;  5FFE A;  1EUM A;  2X17 0;  4LQJ A;  3E1M A;  5D8X A;  1MFR A;  3R2O A;  3IS8 A;  3SID A;  1S3Q A;  2JD8 0;  1JI5 A;  2V15 A;  3T9J A;  2AR0 A;  5GU3 X;  4ML5 A;  4U3G A;  3AK9 A;  4CMY V;  5J93 A;  5K52 A;  5HJF A;  5GN8 A;  1UMN A;  4Y08 A;  1GWG A;  1MOJ A;  3RAV A;  3PW1 B;  2CLB A;  1QGH A;  4PGK A;  4ISP A;  2VZB A;  2V2N A;  2Y44 A;  2ZG7 X;  3E1O A;  2V2J A;  4LPM A;  4E6K A;  4LYX A;  4DYY A;  1BCF A;  3EZU A;  3M6J A;  2YW7 A;  4TOG A;  3BVK A;  4W4K B;  2G38 B;  4AM5 A;  2Z6M A;  4E40 A;  5J9V A;  3GGZ A;  3AF8 X;  5JDO B;  1BFR A;  5JKM A;  4DZ0 A;  3FVB A;  5E2D A;  4II4 B;  4ZKX A;  4ZLW A;  3BT5 A;  3R2S A;  3WVV A;  2C2F A;  3C1Y A;  3KDQ A;  3PZA A;  5K53 A;  2JD6 0;  4LYU A;  4R42 A;  1RCG A;  4X0J A;  5FFD A;  2CEI A;  1YV1 A;  3FI6 A;  1VEQ A;  5LG8 A;  1LKP A;  3F33 A;  3PWQ C;  3AJO A;  4PG1 A;  2CWL A;  2C41 A;  1VJX A;  3E1N A;  2OKC A;  2V2P A;  3FSE A;  4AM4 A;  3KHK A;  3ES3 A;  2ZG9 X;  4QUW A;  3GE4 A;  1JKV A;  3NOZ X;  2QF9 A;  2Z90 A;  3JZ9 A;  2W0O A;  2VXX A;  3IS7 A;  4WJG 4;  5C6F A;  4TOB A;  2IB0 A;  4KVS A;  2BW1 A;  5CMQ A;  4TOD A;  2FFX J;  2GS4 A;  2Z5R A;  4TOA A;  1VLG A;  1DVB A;  1L8H A;  3RE7 A;  2CLU A;  5ERK A;  4REU A;  2HTN A;  4MUD A;  4P18 A;  1JRE A;  1SQ3 A;  3VNX A;  2BK6 A;  3KWO A;  1NNQ A;  5FFA A;  1F33 A;  1HRS A;  1IER A;  3R2L A;  2CF7 A;  1XZ1 A;  4RC5 B;  4TOC A;  3E1P A;  2FKZ A;  1FHA A;  3F37 A;  4XKT A;  1N1Q A;  1OTK A;  1JYB A;  2D5K A;  3R2M A;  4IWK A;  5JKL A;  2RBD A;  3KA9 A;  4CVR A;  3VV9 A;  1UVH A;  3PW8 A;  3E1L A;  2BJY A;  2QQY A;  1JGC A;  3KX9 A;  2V2O A;  1VEL A;  4YXJ A;  4ZMC A;  1LKO A;  4XKU A;  4PGI A;  3PVT A;  2C6R A;  3BVE A;  1S30 A;  1TK6 A;  1KRQ A;  3C23 A;  3Q4O A;  2ZA6 A;  5GN8 B;  4CYB A;  3GGY A;  3WVW A; 
#chains in the Genus database with same CATH homology
 4RC8 A;  2G4H A;  1YUX A;  4TOH A;  2JD7 0;  1RCI A;  4A25 A;  2VXI A;  2FJC A;  1NF4 A;  3ERZ A;  1H96 A;  3RD0 A;  3PVR B;  2Z5Q A;  3E6R A;  4CYA A;  5IX6 A;  3FRS A;  3FRR A;  4ZTT A;  3SHX A;  2F7N A;  3ISE A;  2C2U A;  2Y3Q A;  1YUZ A;  2HR5 A;  4ITW A;  3PVY A;  3Q4R A;  1ZUJ A;  1XZ3 A;  3DBY A;  5JAC A;  1IES A;  3E1J A;  4MN9 A;  4EVB A;  4RC6 A;  4EVD A;  3U90 A;  4CMY A;  3IQ1 A;  1JIG A;  3ISF A;  3AJP A;  3KA3 A;  3BVI A;  4MXP A;  5JKL G;  2YJK A;  4DYZ A;  3SE1 A;  2MGY A;  3TA8 A;  4LPJ A;  5FEJ A;  3E1Q A;  4OYN A;  3D19 A;  4ZL6 A;  5LS9 A;  3H7G A;  3WNW A;  5J8W A;  4DYX A;  4TOF A;  3OGH A;  3RBC A;  4MKU A;  4KVR A;  4M35 A;  4MJY A;  2V8U A;  2IY4 A;  2WLA A;  3KXU A;  5D8O A;  3BKN A;  4Z3B A;  2GYD A;  2XJN A;  1L8I A;  3R2K A;  4Z5S A;  2FL0 A;  4EVC A;  3F32 A;  4M34 A;  2IU2 A;  1Z4A A;  2FHA A;  3NP0 X;  4PG0 A;  3W54 A;  2N02 A;  2V8T A;  4CVP A;  1TJO A;  3F34 A;  2XJO A;  3PWQ A;  1NFV A;  3QHC A;  1F30 A;  3GHQ A;  1JTS A;  5JKM G;  5HU6 D;  4ITT A;  5D8P A;  3KA4 A;  3N6O A;  2CHI A;  1SOF A;  4RC7 B;  2CN6 A;  2PYB A;  5D8S A;  1RCC A;  3LKD A;  3QB9 A;  2YW6 A;  2ZA8 A;  1BG7 A;  3HIU A;  1LB3 A;  4KVQ A;  3EZ0 A;  5GU2 X;  3AJQ A;  3BVL A;  3NP2 X;  1TKO A;  2ZA7 A;  5D8R A;  3UFB A;  1R03 A;  4M32 A;  5I4J A;  2XKQ A;  4LQN A;  1JI4 A;  3KA6 A;  1Z6O M;  3O7S A;  4DAS A;  3F36 A;  2XGW A;  4ZL5 A;  2FG4 A;  4XGS A;  2CN7 A;  3KA8 A;  5LG2 A;  2V2S A;  4AM2 A;  5FFB A;  3A68 A;  5GU0 X;  1RCD A;  1J30 A;  4LQV A;  1LKM A;  5AXS A;  4ZJK A;  3E2C A;  4ZKH A;  4CVT A;  3PVT B;  5LBH A;  3PW1 A;  5CMR A;  4ISM A;  3O7R A;  2FG8 A;  3PWF A;  3GVY A;  2FZF A;  1RYT A;  4CY9 A;  5D8Q A;  3RGD A;  3C21 A;  2WLU A;  1DAT A;  2CIH A;  3PVR A;  2V2R A;  3Q4Q A;  4IWJ A;  3OJ5 A;  4MY7 A;  3PVY B;  3AF7 X;  3VVA A;  1Z6O A;  3AK8 A;  4TOE A;  5JDO A;  4RC6 B;  1RCE A;  1QYB A;  3QD8 A;  4II4 A;  2OH3 A;  4TW3 A;  3HL1 A;  4EVE A;  5GOU A;  3MPS A;  4ZKW A;  2Z5P A;  3R2R A;  5FFC A;  4TO9 A;  3L0M A;  3UOI A;  3F38 A;  1TKP A;  4XKS A;  1JKU A;  5ERJ A;  4ERU A;  1DPS A;  4KXR B;  5J8S A;  4W4L B;  3V3K B;  5GU1 X;  2V2M A;  2ITB A;  2XJM A;  4YXM A;  1NF6 A;  3EGM A;  4LQH A;  5HJH A;  4IXK A;  3C1Z A;  5D8Y A;  2UX1 A;  1ZS3 A;  3UOF A;  2GYQ A;  2C2J A;  3QZ3 A;  2OC5 A;  2BKC A;  3WVU A;  1O9R A;  2V2I A;  3UNO A;  3JZA B;  3QHB A;  2YJJ A;  4YVZ A;  3BVF A;  2V2L A;  3SH6 A;  2CHP A;  1O9I A;  1AEW A;  4DYU A;  4RC7 A;  5E1U A;  3R2H A;  1S2Z A;  3F39 A;  3AF9 X;  3PW8 C;  2ZUR X;  2WWX B;  4LPN A;  4YKH A;  3QVD A;  3F35 A;  4RC5 A;  3A9Q A;  2WTL A;  4ETR A;  1VEI A;  4CVS A;  5HQO A;  4DE6 A;  3Q4N A;  1B71 A;  3E6S A;  4M33 A;  5CZU A;  4DI0 A;  2ZG8 X;  5FFE A;  1EUM A;  2X17 0;  4LQJ A;  3E1M A;  5D8X A;  1MFR A;  3R2O A;  3IS8 A;  3SID A;  1S3Q A;  2JD8 0;  1JI5 A;  2V15 A;  3T9J A;  2AR0 A;  5GU3 X;  4ML5 A;  4U3G A;  3AK9 A;  4CMY V;  5J93 A;  5K52 A;  5HJF A;  5GN8 A;  1UMN A;  4Y08 A;  1GWG A;  1MOJ A;  3RAV A;  3PW1 B;  2CLB A;  1QGH A;  4PGK A;  4ISP A;  2VZB A;  2V2N A;  2Y44 A;  2ZG7 X;  3E1O A;  2V2J A;  4LPM A;  4E6K A;  4LYX A;  4DYY A;  1BCF A;  3EZU A;  3M6J A;  2YW7 A;  4TOG A;  3BVK A;  4W4K B;  2G38 B;  4AM5 A;  2Z6M A;  4E40 A;  5J9V A;  3GGZ A;  3AF8 X;  5JDO B;  1BFR A;  5JKM A;  4DZ0 A;  3FVB A;  5E2D A;  4II4 B;  4ZKX A;  4ZLW A;  3BT5 A;  3R2S A;  3WVV A;  2C2F A;  3C1Y A;  3KDQ A;  3PZA A;  5K53 A;  2JD6 0;  4LYU A;  4R42 A;  1RCG A;  4X0J A;  5FFD A;  2CEI A;  1YV1 A;  3FI6 A;  1VEQ A;  5LG8 A;  1LKP A;  3F33 A;  3PWQ C;  3AJO A;  4PG1 A;  2CWL A;  2C41 A;  1VJX A;  3E1N A;  2OKC A;  2V2P A;  3FSE A;  4AM4 A;  3KHK A;  3ES3 A;  2ZG9 X;  4QUW A;  3GE4 A;  1JKV A;  3NOZ X;  2QF9 A;  2Z90 A;  3JZ9 A;  2W0O A;  2VXX A;  3IS7 A;  4WJG 4;  5C6F A;  4TOB A;  2IB0 A;  4KVS A;  2BW1 A;  5CMQ A;  4TOD A;  2FFX J;  2GS4 A;  2Z5R A;  4TOA A;  1VLG A;  1DVB A;  1L8H A;  3RE7 A;  2CLU A;  5ERK A;  4REU A;  2HTN A;  4MUD A;  4P18 A;  1JRE A;  1SQ3 A;  3VNX A;  2BK6 A;  3KWO A;  1NNQ A;  5FFA A;  1F33 A;  1HRS A;  1IER A;  3R2L A;  2CF7 A;  1XZ1 A;  4RC5 B;  4TOC A;  3E1P A;  2FKZ A;  1FHA A;  3F37 A;  4XKT A;  1N1Q A;  1OTK A;  1JYB A;  2D5K A;  3R2M A;  4IWK A;  5JKL A;  2RBD A;  3KA9 A;  4CVR A;  3VV9 A;  1UVH A;  3PW8 A;  3E1L A;  2BJY A;  2QQY A;  1JGC A;  3KX9 A;  2V2O A;  1VEL A;  4YXJ A;  4ZMC A;  1LKO A;  4XKU A;  4PGI A;  3PVT A;  2C6R A;  3BVE A;  1S30 A;  1TK6 A;  1KRQ A;  3C23 A;  3Q4O A;  2ZA6 A;  5GN8 B;  4CYB A;  3GGY A;  3WVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...