4CMYV

Chlorobium tepidum ferritin
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
163
structure length
163
Chain Sequence
b'MLSKTILDKLNHQVNFEAASAHLYLQMSAWLLTQSLDSTAAFFRAHAEEEKAHMMKLFDYINETGSLALIGEVATPAPEWKSHIELLEAAYNHELAITQSINDLVDTALREKDYSTFQFLQWYVAEQHEEEYLFSSMLHKARIIDTMDGRALFRFDEEVRKSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERRITIN
publication title The Crystal Structure of Ferritin from Chlorobium Tepidum Reveals a New Conformation of the 4-Fold Channel for This Protein Family.
pubmed doi rcsb
source organism Chlorobaculum tepidum
molecule tags Metal transport
total genus 75
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2014-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4cmyV00
2Y3QA 3R2MA 4ZL5A 1TK6A 4ISPA 4Z3BA 3Q4QA 3PZAA 2G4HA 2XKQA 2V15A 5J8SA 3A9QA 4XKSA 3GHQA 4CYBA 3QB9A 2BKCA 3BT5A 1NF4A 4IXKA 4CVRA 2C41A 4LQNA 1DVBA 4M34A 2WLUA 2FHAA 4AM5A 4DYYA 3F33A 5HQOA 1Z4AA 2JD70 2VXXA 1LKOA 5LBHA 3KA9A 1JIGA 3FSEA 1BG7A 2V2IA 1NFVA 3WVVA 1RCCA 1DATA 1H96A 2IB0A 3BVFA 3PW8C 5D8RA 1RYTA 4MUDA 5FEJA 4TOHA 2CN7A 3FI6A 4PG0A 4CYAA 2CLBA 3SE1A 3O7SA 4AM4A 1SQ3A 2XJNA 4CMYV 4PGKA 1B71A 4MJYA 5E1UA 1TJOA 3RAVA 1RCDA 2FKZA 4XKUA 2C6RA 1J30A 3UNOA 4ETRA 3ISEA 3PW1A 3E1PA 3Q4NA 2QQYA 3BKNA 3F34A 4PG1A 3HL1A 1S2ZA 5LG8A 4II4B 5HJFA 4DYXA 1JYBA 1XZ1A 4DYUA 4DYZA 1UVHA 2C2JA 3PVRB 1RCIA 5D8XA 5CMRA 3KXUA 3PVTB 4TODA 1N1QA 5JKMA 3ERZA 5J9VA 4IWJA 4QUWA 3FVBA 5CZUA 2Z5RA 5D8YA 2XJOA 5IX6A 2FL0A 3QZ3A 1EUMA 4LYUA 4TOGA 1XZ3A 5JKMG 3PW8A 3AF9X 4EVEA 2D5KA 1QYBA 5D8QA 5GN8A 3PWQA 3BVIA 4DI0A 2FFXJ 2ZA7A 5JKLA 3E1QA 5LG2A 2C2FA 3F39A 2ITBA 2GYQA 4TOBA 1VJXA 3OJ5A 3SHXA 4M32A 1IERA 1MFRA 1ZS3A 2OH3A 4OYNA 5JKLG 2ZA8A 4MN9A 4PGIA 4A25A 3T9JA 3KA6A 3RGDA 1R03A 2CN6A 3F36A 4DE6A 3RD0A 5FFAA 5J8WA 3H7GA 3E6SA 2FG8A 2CLUA 3Q4RA 5I4JA 1VEQA 3HIUA 1NF6A 1QGHA 4II4A 4DASA 2W0OA 1JI5A 2BW1A 1NNQA 5GU3X 2CHPA 2F7NA 1UMNA 4ZKXA 2Z5PA 4EVCA 3E1MA 3QHBA 1LB3A 5FFCA 3R2KA 1JGCA 2V2SA 2Z6MA 4YKHA 4XKTA 5AXSA 2PYBA 4EVBA 4LPNA 3KA4A 4LYXA 4M33A 2X170 2ZG8X 3BVEA 1F33A 5GOUA 1BFRA 2V2LA 4LQJA 3TA8A 2IY4A 1F30A 4RC7A 4ZMCA 4RC8A 2CEIA 4RC5A 3F35A 1JI4A 1LKPA 2V2OA 2CIHA 1JKVA 2HTNA 4Y08A 5FFDA 2CHIA 2ZG9X 2WLAA 1AEWA 1LKMA 5D8OA 4CVPA 4M35A 1O9IA 1IESA 3SH6A 2YW6A 3WNWA 4R42A 2JD80 5ERJA 3IS8A 4LPJA 4ITTA 4ZJKA 4XGSA 1SOFA 3E1LA 5J93A 3OGHA 4CMYA 1RCGA 3U90A 2V2JA 4TOFA 3MPSA 4ZLWA 2HR5A 1YUXA 2V2PA 4IWKA 2GYDA 3ES3A 3WVWA 4TO9A 3PW1B 3WVUA 4KVQA 5GU0X 1RCEA 5GU1X 3QHCA 1GWGA 2VXIA 1MOJA 4LQVA 5CMQA 1ZUJA 3KA8A 1O9RA 2V2MA 3EZUA 3F38A 1L8HA 3PVYB 4RC6B 2FJCA 5K52A 4MY7A 4ZTTA 3AJQA 1FHAA 3PWFA 3EZ0A 5GU2X 4DZ0A 1L8IA 2CF7A 1S30A 4TOEA 3UOIA 3AK9A 3E1OA 1BCFA 3AK8A 4Z5SA 2BJYA 3NOZX 4P18A 1JREA 4ZKHA 2QF9A 2Z5QA 3UOFA 4ITWA 2BK6A 5D8SA 2V2NA 3RBCA 1Z6OM 2Z90A 2V2RA 4ERUA 4ML5A 4TOAA 4KVRA 5GN8B 1VELA 3KX9A 3PVRA 2YJJA 3GE4A 3RE7A 3VNXA 4CY9A 3PVTA 3E2CA 5HJHA 3R2SA 4E6KA 4ISMA 1TKPA 5K53A 4EVDA 5JACA 1KRQA 3R2RA 4ZL6A 3SIDA 3PWQC 2ZURX 3E6RA 2YW7A 3AF7X 3O7RA 1S3QA 1VEIA 1VLGA 1HRSA 3A68A 2GS4A 2IU2A 2XGWA 1DPSA 3QVDA 2ZA6A 5ERKA 5C6FA 3NP0X 5D8PA 1Z6OA 4LQHA 1TKOA 3R2OA 3EGMA 3BVKA 3QD8A 3R2LA 1OTKA 4U3GA 3BVLA 4KVSA 4LPMA 4RC6A 3KA3A 3GVYA 3E1JA 3PVYA 4CVTA 2XJMA 2OC5A 3Q4OA 3IS7A 1JKUA 2JD60 2WTLA 3AF8X 2C2UA 5FFBA 2YJKA 2ZG7X 2FZFA 5LS9A 3KWOA 3F32A 3F37A 3R2HA 4AM2A 1YUZA 4ZKWA 3E1NA 3IQ1A 4TOCA 3AJPA 4CVSA 5FFEA 4TW3A 1JTSA 1YV1A 2VZBA 2RBDA 3NP2X 4RC7B 2UX1A 4MKUA 2FG4A 4RC5B 5E2DA 3ISFA 4REUA 3AJOA
chains in the Genus database with same CATH superfamily
2Y3QA 3R2MA 4ZL5A 1TK6A 4ISPA 4Z3BA 3Q4QA 3N6OA 3PZAA 2G4HA 2XKQA 2V15A 5J8SA 3A9QA 4XKSA 3GHQA 4CYBA 3QB9A 2BKCA 3BT5A 1NF4A 4IXKA 4CVRA 2C41A 4LQNA 1DVBA 4M34A 2WLUA 2FHAA 4AM5A 4DYYA 3F33A 5HQOA 3GGZA 1Z4AA 2JD70 2VXXA 1LKOA 5LBHA 3KA9A 1JIGA 3FSEA 1BG7A 2V2IA 1NFVA 3WVVA 1RCCA 1DATA 1H96A 2IB0A 3BVFA 3PW8C 5D8RA 1RYTA 3VVAA 4MUDA 5FEJA 4TOHA 2CN7A 3FI6A 4PG0A 4CYAA 2CLBA 3SE1A 3O7SA 4AM4A 3C1YA 1SQ3A 3V3KB 2XJNA 4CMYV 4PGKA 1B71A 2OKCA 4MJYA 5E1UA 1TJOA 3RAVA 1RCDA 2FKZA 4XKUA 2C6RA 1J30A 3UNOA 4ETRA 3ISEA 3PW1A 3E1PA 3Q4NA 2QQYA 3BKNA 3F34A 4PG1A 3HL1A 1S2ZA 5LG8A 3C1ZA 4II4B 5HJFA 4DYXA 1JYBA 1XZ1A 4DYUA 4DYZA 1UVHA 2C2JA 3PVRB 3C23A 1RCIA 5D8XA 5CMRA 3KXUA 3PVTB 4TODA 1N1QA 5JKMA 3ERZA 5J9VA 4IWJA 4QUWA 3FVBA 5CZUA 2Z5RA 5D8YA 2XJOA 5JDOB 5IX6A 2FL0A 3QZ3A 1EUMA 4LYUA 4TOGA 4W4LB 1XZ3A 5JKMG 3PW8A 3AF9X 4EVEA 2D5KA 1QYBA 5D8QA 5GN8A 3PWQA 3BVIA 4DI0A 2FFXJ 2ZA7A 5JKLA 3E1QA 5LG2A 2C2FA 3F39A 2ITBA 2GYQA 4TOBA 1VJXA 3OJ5A 3SHXA 2MGYA 4M32A 1IERA 3D19A 1MFRA 1ZS3A 2OH3A 4OYNA 5JKLG 2ZA8A 4MN9A 4PGIA 4A25A 3T9JA 3KA6A 3RGDA 1R03A 2CN6A 2CWLA 3F36A 4DE6A 3RD0A 5FFAA 5J8WA 3H7GA 3E6SA 2FG8A 3JZ9A 2CLUA 3Q4RA 5I4JA 1VEQA 3JZAB 3HIUA 1NF6A 1QGHA 4II4A 2V8TA 3VV9A 4DASA 4MXPA 3C21A 2W0OA 1JI5A 2BW1A 1NNQA 3W54A 5GU3X 2CHPA 2F7NA 1UMNA 4KXRB 2AR0A 3GGYA 4ZKXA 2Z5PA 4EVCA 3LKDA 3E1MA 3QHBA 1LB3A 5FFCA 3R2KA 1JGCA 2V2SA 2Z6MA 4YKHA 5JDOA 4XKTA 5AXSA 2PYBA 4EVBA 4LPNA 3KA4A 4LYXA 4M33A 2X170 2ZG8X 5HU6D 3BVEA 1F33A 5GOUA 3KHKA 1BFRA 2V2LA 4LQJA 3TA8A 2IY4A 1F30A 4RC7A 4ZMCA 4RC8A 2CEIA 4RC5A 3F35A 1JI4A 1LKPA 2V2OA 2CIHA 1JKVA 2G38B 2HTNA 4Y08A 5FFDA 2CHIA 2ZG9X 2WLAA 1AEWA 1LKMA 5D8OA 4CVPA 4M35A 1O9IA 1IESA 3SH6A 2YW6A 3WNWA 4R42A 2JD80 5ERJA 3IS8A 4LPJA 4ITTA 4ZJKA 4XGSA 1SOFA 3E1LA 5J93A 3OGHA 4CMYA 1RCGA 3U90A 2V2JA 4TOFA 3MPSA 4ZLWA 2HR5A 1YUXA 2V2PA 4IWKA 2GYDA 3ES3A 3WVWA 4TO9A 3PW1B 3WVUA 4KVQA 5GU0X 1RCEA 5GU1X 3M6JA 3QHCA 1GWGA 2VXIA 1MOJA 4LQVA 5CMQA 1ZUJA 3KA8A 1O9RA 2V2MA 3EZUA 3F38A 3PVYB 1L8HA 4RC6B 4W4KB 2FJCA 5K52A 4MY7A 4YXMA 4ZTTA 3AJQA 3FRSA 1FHAA 3PWFA 4E40A 3EZ0A 5GU2X 4DZ0A 1L8IA 2CF7A 1S30A 4TOEA 3UOIA 3AK9A 3E1OA 3L0MA 1BCFA 3AK8A 4Z5SA 2BJYA 3NOZX 4P18A 1JREA 4ZKHA 2QF9A 2Z5QA 3UOFA 4ITWA 2BK6A 5D8SA 2V2NA 3KDQA 3RBCA 4WJG4 1Z6OM 2Z90A 2V2RA 4ERUA 4ML5A 4TOAA 4KVRA 5GN8B 1VELA 3KX9A 3PVRA 2YJJA 3GE4A 3RE7A 3VNXA 4CY9A 3PVTA 3E2CA 5HJHA 3R2SA 4E6KA 4ISMA 2N02A 1TKPA 5K53A 4EVDA 5JACA 1KRQA 3R2RA 4ZL6A 3SIDA 3PWQC 2ZURX 4X0JA 3E6RA 2YW7A 3AF7X 3O7RA 2V8UA 1S3QA 1VEIA 1VLGA 1HRSA 3A68A 2GS4A 2IU2A 2XGWA 4YXJA 1DPSA 3QVDA 2ZA6A 5ERKA 3UFBA 5C6FA 3NP0X 5D8PA 1Z6OA 4LQHA 1TKOA 3R2OA 3EGMA 3BVKA 3QD8A 3R2LA 1OTKA 4U3GA 3BVLA 4KVSA 4LPMA 4RC6A 3KA3A 3GVYA 3E1JA 3PVYA 4CVTA 2XJMA 4YVZA 2OC5A 3Q4OA 3IS7A 1JKUA 2JD60 2WTLA 3AF8X 2C2UA 5FFBA 2YJKA 2ZG7X 2FZFA 5LS9A 3DBYA 3KWOA 3F32A 3F37A 3R2HA 4AM2A 1YUZA 4ZKWA 3E1NA 3IQ1A 4TOCA 3AJPA 4CVSA 3FRRA 5FFEA 4TW3A 1JTSA 1YV1A 2VZBA 2RBDA 2WWXB 3NP2X 4RC7B 2Y44A 2UX1A 4MKUA 2FG4A 4RC5B 5E2DA 3ISFA 4REUA 3AJOA
chains in the Genus database with same CATH topology
2Y3QA 3R2MA 4ZL5A 1TK6A 4ISPA 4Z3BA 3Q4QA 3N6OA 3PZAA 2G4HA 2XKQA 2V15A 5J8SA 3A9QA 4XKSA 3GHQA 4CYBA 3QB9A 2BKCA 3BT5A 1NF4A 4IXKA 4CVRA 2C41A 4LQNA 1DVBA 4M34A 2WLUA 2FHAA 4AM5A 4DYYA 3F33A 5HQOA 3GGZA 1Z4AA 2JD70 2VXXA 1LKOA 5LBHA 3KA9A 1JIGA 3FSEA 1BG7A 2V2IA 1NFVA 3WVVA 1RCCA 1DATA 1H96A 2IB0A 3BVFA 3PW8C 5D8RA 1RYTA 3VVAA 4MUDA 5FEJA 4TOHA 2CN7A 3FI6A 4PG0A 4CYAA 2CLBA 3SE1A 3O7SA 4AM4A 3C1YA 1SQ3A 3V3KB 2XJNA 4CMYV 4PGKA 1B71A 2OKCA 4MJYA 5E1UA 1TJOA 3RAVA 1RCDA 2FKZA 4XKUA 2C6RA 1J30A 3UNOA 4ETRA 3ISEA 3PW1A 3E1PA 3Q4NA 2QQYA 3BKNA 3F34A 4PG1A 3HL1A 1S2ZA 5LG8A 3C1ZA 4II4B 5HJFA 4DYXA 1JYBA 1XZ1A 4DYUA 4DYZA 1UVHA 2C2JA 3PVRB 3C23A 1RCIA 5D8XA 5CMRA 3KXUA 3PVTB 4TODA 1N1QA 5JKMA 3ERZA 5J9VA 4IWJA 4QUWA 3FVBA 5CZUA 2Z5RA 5D8YA 2XJOA 5JDOB 5IX6A 2FL0A 3QZ3A 1EUMA 4LYUA 4TOGA 4W4LB 1XZ3A 5JKMG 3PW8A 3AF9X 4EVEA 2D5KA 1QYBA 5D8QA 5GN8A 3PWQA 3BVIA 4DI0A 2FFXJ 2ZA7A 5JKLA 3E1QA 5LG2A 2C2FA 3F39A 2ITBA 2GYQA 4TOBA 1VJXA 3OJ5A 3SHXA 2MGYA 4M32A 1IERA 3D19A 1MFRA 1ZS3A 2OH3A 4OYNA 5JKLG 2ZA8A 4MN9A 4PGIA 4A25A 3T9JA 3KA6A 3RGDA 1R03A 2CN6A 2CWLA 3F36A 4DE6A 3RD0A 5FFAA 5J8WA 3H7GA 3E6SA 2FG8A 3JZ9A 2CLUA 3Q4RA 5I4JA 1VEQA 3JZAB 3HIUA 1NF6A 1QGHA 4II4A 2V8TA 3VV9A 4DASA 4MXPA 3C21A 2W0OA 1JI5A 2BW1A 1NNQA 3W54A 5GU3X 2CHPA 2F7NA 1UMNA 4KXRB 2AR0A 3GGYA 4ZKXA 2Z5PA 4EVCA 3LKDA 3E1MA 3QHBA 1LB3A 5FFCA 3R2KA 1JGCA 2V2SA 2Z6MA 4YKHA 5JDOA 4XKTA 5AXSA 2PYBA 4EVBA 4LPNA 3KA4A 4LYXA 4M33A 2X170 2ZG8X 5HU6D 3BVEA 1F33A 5GOUA 3KHKA 1BFRA 2V2LA 4LQJA 3TA8A 2IY4A 1F30A 4RC7A 4ZMCA 4RC8A 2CEIA 4RC5A 3F35A 1JI4A 1LKPA 2V2OA 2CIHA 1JKVA 2G38B 2HTNA 4Y08A 5FFDA 2CHIA 2ZG9X 2WLAA 1AEWA 1LKMA 5D8OA 4CVPA 4M35A 1O9IA 1IESA 3SH6A 2YW6A 3WNWA 4R42A 2JD80 5ERJA 3IS8A 4LPJA 4ITTA 4ZJKA 4XGSA 1SOFA 3E1LA 5J93A 3OGHA 4CMYA 1RCGA 3U90A 2V2JA 4TOFA 3MPSA 4ZLWA 2HR5A 1YUXA 2V2PA 4IWKA 2GYDA 3ES3A 3WVWA 4TO9A 3PW1B 3WVUA 4KVQA 5GU0X 1RCEA 5GU1X 3M6JA 3QHCA 1GWGA 2VXIA 1MOJA 4LQVA 5CMQA 1ZUJA 3KA8A 1O9RA 2V2MA 3EZUA 3F38A 3PVYB 1L8HA 4RC6B 4W4KB 2FJCA 5K52A 4MY7A 4YXMA 4ZTTA 3AJQA 3FRSA 1FHAA 3PWFA 4E40A 3EZ0A 5GU2X 4DZ0A 1L8IA 2CF7A 1S30A 4TOEA 3UOIA 3AK9A 3E1OA 3L0MA 1BCFA 3AK8A 4Z5SA 2BJYA 3NOZX 4P18A 1JREA 4ZKHA 2QF9A 2Z5QA 3UOFA 4ITWA 2BK6A 5D8SA 2V2NA 3KDQA 3RBCA 4WJG4 1Z6OM 2Z90A 2V2RA 4ERUA 4ML5A 4TOAA 4KVRA 5GN8B 1VELA 3KX9A 3PVRA 2YJJA 3GE4A 3RE7A 3VNXA 4CY9A 3PVTA 3E2CA 5HJHA 3R2SA 4E6KA 4ISMA 2N02A 1TKPA 5K53A 4EVDA 5JACA 1KRQA 3R2RA 4ZL6A 3SIDA 3PWQC 2ZURX 4X0JA 3E6RA 2YW7A 3AF7X 3O7RA 2V8UA 1S3QA 1VEIA 1VLGA 1HRSA 3A68A 2GS4A 2IU2A 2XGWA 4YXJA 1DPSA 3QVDA 2ZA6A 5ERKA 3UFBA 5C6FA 3NP0X 5D8PA 1Z6OA 4LQHA 1TKOA 3R2OA 3EGMA 3BVKA 3QD8A 3R2LA 1OTKA 4U3GA 3BVLA 4KVSA 4LPMA 4RC6A 3KA3A 3GVYA 3E1JA 3PVYA 4CVTA 2XJMA 4YVZA 2OC5A 3Q4OA 3IS7A 1JKUA 2JD60 2WTLA 3AF8X 2C2UA 5FFBA 2YJKA 2ZG7X 2FZFA 5LS9A 3DBYA 3KWOA 3F32A 3F37A 3R2HA 4AM2A 1YUZA 4ZKWA 3E1NA 3IQ1A 4TOCA 3AJPA 4CVSA 3FRRA 5FFEA 4TW3A 1JTSA 1YV1A 2VZBA 2RBDA 2WWXB 3NP2X 4RC7B 2Y44A 2UX1A 4MKUA 2FG4A 4RC5B 5E2DA 3ISFA 4REUA 3AJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y3Q A;  3R2M A;  4ZL5 A;  1TK6 A;  4ISP A;  4Z3B A;  3Q4Q A;  3PZA A;  2G4H A;  2XKQ A;  2V15 A;  5J8S A;  3A9Q A;  4XKS A;  3GHQ A;  4CYB A;  3QB9 A;  2BKC A;  3BT5 A;  1NF4 A;  4IXK A;  4CVR A;  2C41 A;  4LQN A;  1DVB A;  4M34 A;  2WLU A;  2FHA A;  4AM5 A;  4DYY A;  3F33 A;  5HQO A;  1Z4A A;  2JD7 0;  2VXX A;  1LKO A;  5LBH A;  3KA9 A;  1JIG A;  3FSE A;  1BG7 A;  2V2I A;  1NFV A;  3WVV A;  1RCC A;  1DAT A;  1H96 A;  2IB0 A;  3BVF A;  3PW8 C;  5D8R A;  1RYT A;  4MUD A;  5FEJ A;  4TOH A;  2CN7 A;  3FI6 A;  4PG0 A;  4CYA A;  2CLB A;  3SE1 A;  3O7S A;  4AM4 A;  1SQ3 A;  2XJN A;  4CMY V;  4PGK A;  1B71 A;  4MJY A;  5E1U A;  1TJO A;  3RAV A;  1RCD A;  2FKZ A;  4XKU A;  2C6R A;  1J30 A;  3UNO A;  4ETR A;  3ISE A;  3PW1 A;  3E1P A;  3Q4N A;  2QQY A;  3BKN A;  3F34 A;  4PG1 A;  3HL1 A;  1S2Z A;  5LG8 A;  4II4 B;  5HJF A;  4DYX A;  1JYB A;  1XZ1 A;  4DYU A;  4DYZ A;  1UVH A;  2C2J A;  3PVR B;  1RCI A;  5D8X A;  5CMR A;  3KXU A;  3PVT B;  4TOD A;  1N1Q A;  5JKM A;  3ERZ A;  5J9V A;  4IWJ A;  4QUW A;  3FVB A;  5CZU A;  2Z5R A;  5D8Y A;  2XJO A;  5IX6 A;  2FL0 A;  3QZ3 A;  1EUM A;  4LYU A;  4TOG A;  1XZ3 A;  5JKM G;  3PW8 A;  3AF9 X;  4EVE A;  2D5K A;  1QYB A;  5D8Q A;  5GN8 A;  3PWQ A;  3BVI A;  4DI0 A;  2FFX J;  2ZA7 A;  5JKL A;  3E1Q A;  5LG2 A;  2C2F A;  3F39 A;  2ITB A;  2GYQ A;  4TOB A;  1VJX A;  3OJ5 A;  3SHX A;  4M32 A;  1IER A;  1MFR A;  1ZS3 A;  2OH3 A;  4OYN A;  5JKL G;  2ZA8 A;  4MN9 A;  4PGI A;  4A25 A;  3T9J A;  3KA6 A;  3RGD A;  1R03 A;  2CN6 A;  3F36 A;  4DE6 A;  3RD0 A;  5FFA A;  5J8W A;  3H7G A;  3E6S A;  2FG8 A;  2CLU A;  3Q4R A;  5I4J A;  1VEQ A;  3HIU A;  1NF6 A;  1QGH A;  4II4 A;  4DAS A;  2W0O A;  1JI5 A;  2BW1 A;  1NNQ A;  5GU3 X;  2CHP A;  2F7N A;  1UMN A;  4ZKX A;  2Z5P A;  4EVC A;  3E1M A;  3QHB A;  1LB3 A;  5FFC A;  3R2K A;  1JGC A;  2V2S A;  2Z6M A;  4YKH A;  4XKT A;  5AXS A;  2PYB A;  4EVB A;  4LPN A;  3KA4 A;  4LYX A;  4M33 A;  2X17 0;  2ZG8 X;  3BVE A;  1F33 A;  5GOU A;  1BFR A;  2V2L A;  4LQJ A;  3TA8 A;  2IY4 A;  1F30 A;  4RC7 A;  4ZMC A;  4RC8 A;  2CEI A;  4RC5 A;  3F35 A;  1JI4 A;  1LKP A;  2V2O A;  2CIH A;  1JKV A;  2HTN A;  4Y08 A;  5FFD A;  2CHI A;  2ZG9 X;  2WLA A;  1AEW A;  1LKM A;  5D8O A;  4CVP A;  4M35 A;  1O9I A;  1IES A;  3SH6 A;  2YW6 A;  3WNW A;  4R42 A;  2JD8 0;  5ERJ A;  3IS8 A;  4LPJ A;  4ITT A;  4ZJK A;  4XGS A;  1SOF A;  3E1L A;  5J93 A;  3OGH A;  4CMY A;  1RCG A;  3U90 A;  2V2J A;  4TOF A;  3MPS A;  4ZLW A;  2HR5 A;  1YUX A;  2V2P A;  4IWK A;  2GYD A;  3ES3 A;  3WVW A;  4TO9 A;  3PW1 B;  3WVU A;  4KVQ A;  5GU0 X;  1RCE A;  5GU1 X;  3QHC A;  1GWG A;  2VXI A;  1MOJ A;  4LQV A;  5CMQ A;  1ZUJ A;  3KA8 A;  1O9R A;  2V2M A;  3EZU A;  3F38 A;  1L8H A;  3PVY B;  4RC6 B;  2FJC A;  5K52 A;  4MY7 A;  4ZTT A;  3AJQ A;  1FHA A;  3PWF A;  3EZ0 A;  5GU2 X;  4DZ0 A;  1L8I A;  2CF7 A;  1S30 A;  4TOE A;  3UOI A;  3AK9 A;  3E1O A;  1BCF A;  3AK8 A;  4Z5S A;  2BJY A;  3NOZ X;  4P18 A;  1JRE A;  4ZKH A;  2QF9 A;  2Z5Q A;  3UOF A;  4ITW A;  2BK6 A;  5D8S A;  2V2N A;  3RBC A;  1Z6O M;  2Z90 A;  2V2R A;  4ERU A;  4ML5 A;  4TOA A;  4KVR A;  5GN8 B;  1VEL A;  3KX9 A;  3PVR A;  2YJJ A;  3GE4 A;  3RE7 A;  3VNX A;  4CY9 A;  3PVT A;  3E2C A;  5HJH A;  3R2S A;  4E6K A;  4ISM A;  1TKP A;  5K53 A;  4EVD A;  5JAC A;  1KRQ A;  3R2R A;  4ZL6 A;  3SID A;  3PWQ C;  2ZUR X;  3E6R A;  2YW7 A;  3AF7 X;  3O7R A;  1S3Q A;  1VEI A;  1VLG A;  1HRS A;  3A68 A;  2GS4 A;  2IU2 A;  2XGW A;  1DPS A;  3QVD A;  2ZA6 A;  5ERK A;  5C6F A;  3NP0 X;  5D8P A;  1Z6O A;  4LQH A;  1TKO A;  3R2O A;  3EGM A;  3BVK A;  3QD8 A;  3R2L A;  1OTK A;  4U3G A;  3BVL A;  4KVS A;  4LPM A;  4RC6 A;  3KA3 A;  3GVY A;  3E1J A;  3PVY A;  4CVT A;  2XJM A;  2OC5 A;  3Q4O A;  3IS7 A;  1JKU A;  2JD6 0;  2WTL A;  3AF8 X;  2C2U A;  5FFB A;  2YJK A;  2ZG7 X;  2FZF A;  5LS9 A;  3KWO A;  3F32 A;  3F37 A;  3R2H A;  4AM2 A;  1YUZ A;  4ZKW A;  3E1N A;  3IQ1 A;  4TOC A;  3AJP A;  4CVS A;  5FFE A;  4TW3 A;  1JTS A;  1YV1 A;  2VZB A;  2RBD A;  3NP2 X;  4RC7 B;  2UX1 A;  4MKU A;  2FG4 A;  4RC5 B;  5E2D A;  3ISF A;  4REU A;  3AJO A; 
#chains in the Genus database with same CATH topology
 2Y3Q A;  3R2M A;  4ZL5 A;  1TK6 A;  4ISP A;  4Z3B A;  3Q4Q A;  3N6O A;  3PZA A;  2G4H A;  2XKQ A;  2V15 A;  5J8S A;  3A9Q A;  4XKS A;  3GHQ A;  4CYB A;  3QB9 A;  2BKC A;  3BT5 A;  1NF4 A;  4IXK A;  4CVR A;  2C41 A;  4LQN A;  1DVB A;  4M34 A;  2WLU A;  2FHA A;  4AM5 A;  4DYY A;  3F33 A;  5HQO A;  3GGZ A;  1Z4A A;  2JD7 0;  2VXX A;  1LKO A;  5LBH A;  3KA9 A;  1JIG A;  3FSE A;  1BG7 A;  2V2I A;  1NFV A;  3WVV A;  1RCC A;  1DAT A;  1H96 A;  2IB0 A;  3BVF A;  3PW8 C;  5D8R A;  1RYT A;  3VVA A;  4MUD A;  5FEJ A;  4TOH A;  2CN7 A;  3FI6 A;  4PG0 A;  4CYA A;  2CLB A;  3SE1 A;  3O7S A;  4AM4 A;  3C1Y A;  1SQ3 A;  3V3K B;  2XJN A;  4CMY V;  4PGK A;  1B71 A;  2OKC A;  4MJY A;  5E1U A;  1TJO A;  3RAV A;  1RCD A;  2FKZ A;  4XKU A;  2C6R A;  1J30 A;  3UNO A;  4ETR A;  3ISE A;  3PW1 A;  3E1P A;  3Q4N A;  2QQY A;  3BKN A;  3F34 A;  4PG1 A;  3HL1 A;  1S2Z A;  5LG8 A;  3C1Z A;  4II4 B;  5HJF A;  4DYX A;  1JYB A;  1XZ1 A;  4DYU A;  4DYZ A;  1UVH A;  2C2J A;  3PVR B;  3C23 A;  1RCI A;  5D8X A;  5CMR A;  3KXU A;  3PVT B;  4TOD A;  1N1Q A;  5JKM A;  3ERZ A;  5J9V A;  4IWJ A;  4QUW A;  3FVB A;  5CZU A;  2Z5R A;  5D8Y A;  2XJO A;  5JDO B;  5IX6 A;  2FL0 A;  3QZ3 A;  1EUM A;  4LYU A;  4TOG A;  4W4L B;  1XZ3 A;  5JKM G;  3PW8 A;  3AF9 X;  4EVE A;  2D5K A;  1QYB A;  5D8Q A;  5GN8 A;  3PWQ A;  3BVI A;  4DI0 A;  2FFX J;  2ZA7 A;  5JKL A;  3E1Q A;  5LG2 A;  2C2F A;  3F39 A;  2ITB A;  2GYQ A;  4TOB A;  1VJX A;  3OJ5 A;  3SHX A;  2MGY A;  4M32 A;  1IER A;  3D19 A;  1MFR A;  1ZS3 A;  2OH3 A;  4OYN A;  5JKL G;  2ZA8 A;  4MN9 A;  4PGI A;  4A25 A;  3T9J A;  3KA6 A;  3RGD A;  1R03 A;  2CN6 A;  2CWL A;  3F36 A;  4DE6 A;  3RD0 A;  5FFA A;  5J8W A;  3H7G A;  3E6S A;  2FG8 A;  3JZ9 A;  2CLU A;  3Q4R A;  5I4J A;  1VEQ A;  3JZA B;  3HIU A;  1NF6 A;  1QGH A;  4II4 A;  2V8T A;  3VV9 A;  4DAS A;  4MXP A;  3C21 A;  2W0O A;  1JI5 A;  2BW1 A;  1NNQ A;  3W54 A;  5GU3 X;  2CHP A;  2F7N A;  1UMN A;  4KXR B;  2AR0 A;  3GGY A;  4ZKX A;  2Z5P A;  4EVC A;  3LKD A;  3E1M A;  3QHB A;  1LB3 A;  5FFC A;  3R2K A;  1JGC A;  2V2S A;  2Z6M A;  4YKH A;  5JDO A;  4XKT A;  5AXS A;  2PYB A;  4EVB A;  4LPN A;  3KA4 A;  4LYX A;  4M33 A;  2X17 0;  2ZG8 X;  5HU6 D;  3BVE A;  1F33 A;  5GOU A;  3KHK A;  1BFR A;  2V2L A;  4LQJ A;  3TA8 A;  2IY4 A;  1F30 A;  4RC7 A;  4ZMC A;  4RC8 A;  2CEI A;  4RC5 A;  3F35 A;  1JI4 A;  1LKP A;  2V2O A;  2CIH A;  1JKV A;  2G38 B;  2HTN A;  4Y08 A;  5FFD A;  2CHI A;  2ZG9 X;  2WLA A;  1AEW A;  1LKM A;  5D8O A;  4CVP A;  4M35 A;  1O9I A;  1IES A;  3SH6 A;  2YW6 A;  3WNW A;  4R42 A;  2JD8 0;  5ERJ A;  3IS8 A;  4LPJ A;  4ITT A;  4ZJK A;  4XGS A;  1SOF A;  3E1L A;  5J93 A;  3OGH A;  4CMY A;  1RCG A;  3U90 A;  2V2J A;  4TOF A;  3MPS A;  4ZLW A;  2HR5 A;  1YUX A;  2V2P A;  4IWK A;  2GYD A;  3ES3 A;  3WVW A;  4TO9 A;  3PW1 B;  3WVU A;  4KVQ A;  5GU0 X;  1RCE A;  5GU1 X;  3M6J A;  3QHC A;  1GWG A;  2VXI A;  1MOJ A;  4LQV A;  5CMQ A;  1ZUJ A;  3KA8 A;  1O9R A;  2V2M A;  3EZU A;  3F38 A;  3PVY B;  1L8H A;  4RC6 B;  4W4K B;  2FJC A;  5K52 A;  4MY7 A;  4YXM A;  4ZTT A;  3AJQ A;  3FRS A;  1FHA A;  3PWF A;  4E40 A;  3EZ0 A;  5GU2 X;  4DZ0 A;  1L8I A;  2CF7 A;  1S30 A;  4TOE A;  3UOI A;  3AK9 A;  3E1O A;  3L0M A;  1BCF A;  3AK8 A;  4Z5S A;  2BJY A;  3NOZ X;  4P18 A;  1JRE A;  4ZKH A;  2QF9 A;  2Z5Q A;  3UOF A;  4ITW A;  2BK6 A;  5D8S A;  2V2N A;  3KDQ A;  3RBC A;  4WJG 4;  1Z6O M;  2Z90 A;  2V2R A;  4ERU A;  4ML5 A;  4TOA A;  4KVR A;  5GN8 B;  1VEL A;  3KX9 A;  3PVR A;  2YJJ A;  3GE4 A;  3RE7 A;  3VNX A;  4CY9 A;  3PVT A;  3E2C A;  5HJH A;  3R2S A;  4E6K A;  4ISM A;  2N02 A;  1TKP A;  5K53 A;  4EVD A;  5JAC A;  1KRQ A;  3R2R A;  4ZL6 A;  3SID A;  3PWQ C;  2ZUR X;  4X0J A;  3E6R A;  2YW7 A;  3AF7 X;  3O7R A;  2V8U A;  1S3Q A;  1VEI A;  1VLG A;  1HRS A;  3A68 A;  2GS4 A;  2IU2 A;  2XGW A;  4YXJ A;  1DPS A;  3QVD A;  2ZA6 A;  5ERK A;  3UFB A;  5C6F A;  3NP0 X;  5D8P A;  1Z6O A;  4LQH A;  1TKO A;  3R2O A;  3EGM A;  3BVK A;  3QD8 A;  3R2L A;  1OTK A;  4U3G A;  3BVL A;  4KVS A;  4LPM A;  4RC6 A;  3KA3 A;  3GVY A;  3E1J A;  3PVY A;  4CVT A;  2XJM A;  4YVZ A;  2OC5 A;  3Q4O A;  3IS7 A;  1JKU A;  2JD6 0;  2WTL A;  3AF8 X;  2C2U A;  5FFB A;  2YJK A;  2ZG7 X;  2FZF A;  5LS9 A;  3DBY A;  3KWO A;  3F32 A;  3F37 A;  3R2H A;  4AM2 A;  1YUZ A;  4ZKW A;  3E1N A;  3IQ1 A;  4TOC A;  3AJP A;  4CVS A;  3FRR A;  5FFE A;  4TW3 A;  1JTS A;  1YV1 A;  2VZB A;  2RBD A;  2WWX B;  3NP2 X;  4RC7 B;  2Y44 A;  2UX1 A;  4MKU A;  2FG4 A;  4RC5 B;  5E2D A;  3ISF A;  4REU A;  3AJO A; 
#chains in the Genus database with same CATH homology
 2Y3Q A;  3R2M A;  4ZL5 A;  1TK6 A;  4ISP A;  4Z3B A;  3Q4Q A;  3N6O A;  3PZA A;  2G4H A;  2XKQ A;  2V15 A;  5J8S A;  3A9Q A;  4XKS A;  3GHQ A;  4CYB A;  3QB9 A;  2BKC A;  3BT5 A;  1NF4 A;  4IXK A;  4CVR A;  2C41 A;  4LQN A;  1DVB A;  4M34 A;  2WLU A;  2FHA A;  4AM5 A;  4DYY A;  3F33 A;  5HQO A;  3GGZ A;  1Z4A A;  2JD7 0;  2VXX A;  1LKO A;  5LBH A;  3KA9 A;  1JIG A;  3FSE A;  1BG7 A;  2V2I A;  1NFV A;  3WVV A;  1RCC A;  1DAT A;  1H96 A;  2IB0 A;  3BVF A;  3PW8 C;  5D8R A;  1RYT A;  3VVA A;  4MUD A;  5FEJ A;  4TOH A;  2CN7 A;  3FI6 A;  4PG0 A;  4CYA A;  2CLB A;  3SE1 A;  3O7S A;  4AM4 A;  3C1Y A;  1SQ3 A;  3V3K B;  2XJN A;  4CMY V;  4PGK A;  1B71 A;  2OKC A;  4MJY A;  5E1U A;  1TJO A;  3RAV A;  1RCD A;  2FKZ A;  4XKU A;  2C6R A;  1J30 A;  3UNO A;  4ETR A;  3ISE A;  3PW1 A;  3E1P A;  3Q4N A;  2QQY A;  3BKN A;  3F34 A;  4PG1 A;  3HL1 A;  1S2Z A;  5LG8 A;  3C1Z A;  4II4 B;  5HJF A;  4DYX A;  1JYB A;  1XZ1 A;  4DYU A;  4DYZ A;  1UVH A;  2C2J A;  3PVR B;  3C23 A;  1RCI A;  5D8X A;  5CMR A;  3KXU A;  3PVT B;  4TOD A;  1N1Q A;  5JKM A;  3ERZ A;  5J9V A;  4IWJ A;  4QUW A;  3FVB A;  5CZU A;  2Z5R A;  5D8Y A;  2XJO A;  5JDO B;  5IX6 A;  2FL0 A;  3QZ3 A;  1EUM A;  4LYU A;  4TOG A;  4W4L B;  1XZ3 A;  5JKM G;  3PW8 A;  3AF9 X;  4EVE A;  2D5K A;  1QYB A;  5D8Q A;  5GN8 A;  3PWQ A;  3BVI A;  4DI0 A;  2FFX J;  2ZA7 A;  5JKL A;  3E1Q A;  5LG2 A;  2C2F A;  3F39 A;  2ITB A;  2GYQ A;  4TOB A;  1VJX A;  3OJ5 A;  3SHX A;  2MGY A;  4M32 A;  1IER A;  3D19 A;  1MFR A;  1ZS3 A;  2OH3 A;  4OYN A;  5JKL G;  2ZA8 A;  4MN9 A;  4PGI A;  4A25 A;  3T9J A;  3KA6 A;  3RGD A;  1R03 A;  2CN6 A;  2CWL A;  3F36 A;  4DE6 A;  3RD0 A;  5FFA A;  5J8W A;  3H7G A;  3E6S A;  2FG8 A;  3JZ9 A;  2CLU A;  3Q4R A;  5I4J A;  1VEQ A;  3JZA B;  3HIU A;  1NF6 A;  1QGH A;  4II4 A;  2V8T A;  3VV9 A;  4DAS A;  4MXP A;  3C21 A;  2W0O A;  1JI5 A;  2BW1 A;  1NNQ A;  3W54 A;  5GU3 X;  2CHP A;  2F7N A;  1UMN A;  4KXR B;  2AR0 A;  3GGY A;  4ZKX A;  2Z5P A;  4EVC A;  3LKD A;  3E1M A;  3QHB A;  1LB3 A;  5FFC A;  3R2K A;  1JGC A;  2V2S A;  2Z6M A;  4YKH A;  5JDO A;  4XKT A;  5AXS A;  2PYB A;  4EVB A;  4LPN A;  3KA4 A;  4LYX A;  4M33 A;  2X17 0;  2ZG8 X;  5HU6 D;  3BVE A;  1F33 A;  5GOU A;  3KHK A;  1BFR A;  2V2L A;  4LQJ A;  3TA8 A;  2IY4 A;  1F30 A;  4RC7 A;  4ZMC A;  4RC8 A;  2CEI A;  4RC5 A;  3F35 A;  1JI4 A;  1LKP A;  2V2O A;  2CIH A;  1JKV A;  2G38 B;  2HTN A;  4Y08 A;  5FFD A;  2CHI A;  2ZG9 X;  2WLA A;  1AEW A;  1LKM A;  5D8O A;  4CVP A;  4M35 A;  1O9I A;  1IES A;  3SH6 A;  2YW6 A;  3WNW A;  4R42 A;  2JD8 0;  5ERJ A;  3IS8 A;  4LPJ A;  4ITT A;  4ZJK A;  4XGS A;  1SOF A;  3E1L A;  5J93 A;  3OGH A;  4CMY A;  1RCG A;  3U90 A;  2V2J A;  4TOF A;  3MPS A;  4ZLW A;  2HR5 A;  1YUX A;  2V2P A;  4IWK A;  2GYD A;  3ES3 A;  3WVW A;  4TO9 A;  3PW1 B;  3WVU A;  4KVQ A;  5GU0 X;  1RCE A;  5GU1 X;  3M6J A;  3QHC A;  1GWG A;  2VXI A;  1MOJ A;  4LQV A;  5CMQ A;  1ZUJ A;  3KA8 A;  1O9R A;  2V2M A;  3EZU A;  3F38 A;  3PVY B;  1L8H A;  4RC6 B;  4W4K B;  2FJC A;  5K52 A;  4MY7 A;  4YXM A;  4ZTT A;  3AJQ A;  3FRS A;  1FHA A;  3PWF A;  4E40 A;  3EZ0 A;  5GU2 X;  4DZ0 A;  1L8I A;  2CF7 A;  1S30 A;  4TOE A;  3UOI A;  3AK9 A;  3E1O A;  3L0M A;  1BCF A;  3AK8 A;  4Z5S A;  2BJY A;  3NOZ X;  4P18 A;  1JRE A;  4ZKH A;  2QF9 A;  2Z5Q A;  3UOF A;  4ITW A;  2BK6 A;  5D8S A;  2V2N A;  3KDQ A;  3RBC A;  4WJG 4;  1Z6O M;  2Z90 A;  2V2R A;  4ERU A;  4ML5 A;  4TOA A;  4KVR A;  5GN8 B;  1VEL A;  3KX9 A;  3PVR A;  2YJJ A;  3GE4 A;  3RE7 A;  3VNX A;  4CY9 A;  3PVT A;  3E2C A;  5HJH A;  3R2S A;  4E6K A;  4ISM A;  2N02 A;  1TKP A;  5K53 A;  4EVD A;  5JAC A;  1KRQ A;  3R2R A;  4ZL6 A;  3SID A;  3PWQ C;  2ZUR X;  4X0J A;  3E6R A;  2YW7 A;  3AF7 X;  3O7R A;  2V8U A;  1S3Q A;  1VEI A;  1VLG A;  1HRS A;  3A68 A;  2GS4 A;  2IU2 A;  2XGW A;  4YXJ A;  1DPS A;  3QVD A;  2ZA6 A;  5ERK A;  3UFB A;  5C6F A;  3NP0 X;  5D8P A;  1Z6O A;  4LQH A;  1TKO A;  3R2O A;  3EGM A;  3BVK A;  3QD8 A;  3R2L A;  1OTK A;  4U3G A;  3BVL A;  4KVS A;  4LPM A;  4RC6 A;  3KA3 A;  3GVY A;  3E1J A;  3PVY A;  4CVT A;  2XJM A;  4YVZ A;  2OC5 A;  3Q4O A;  3IS7 A;  1JKU A;  2JD6 0;  2WTL A;  3AF8 X;  2C2U A;  5FFB A;  2YJK A;  2ZG7 X;  2FZF A;  5LS9 A;  3DBY A;  3KWO A;  3F32 A;  3F37 A;  3R2H A;  4AM2 A;  1YUZ A;  4ZKW A;  3E1N A;  3IQ1 A;  4TOC A;  3AJP A;  4CVS A;  3FRR A;  5FFE A;  4TW3 A;  1JTS A;  1YV1 A;  2VZB A;  2RBD A;  2WWX B;  3NP2 X;  4RC7 B;  2Y44 A;  2UX1 A;  4MKU A;  2FG4 A;  4RC5 B;  5E2D A;  3ISF A;  4REU A;  3AJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...