4CMYV

Chlorobium tepidum ferritin
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
163
structure length
163
Chain Sequence
MLSKTILDKLNHQVNFEAASAHLYLQMSAWLLTQSLDSTAAFFRAHAEEEKAHMMKLFDYINETGSLALIGEVATPAPEWKSHIELLEAAYNHELAITQSINDLVDTALREKDYSTFQFLQWYVAEQHEEEYLFSSMLHKARIIDTMDGRALFRFDEEVRKSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords FERRITIN
publication title The Crystal Structure of Ferritin from Chlorobium Tepidum Reveals a New Conformation of the 4-Fold Channel for This Protein Family.
pubmed doi rcsb
source organism Chlorobaculum tepidum
total genus 75
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2014-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4cmyV00
1HRSA 3PWQA 2YJKA 1RCCA 3RAVA 2VZBA 2VXXA 3KA9A 4CYBA 4TOHA 3F37A 4MUDA 3A9QA 1YUZA 2WLAA 1YV1A 4CMYV 5HQOA 2ZA6A 4QUWA 2G4HA 4ERUA 4ZTTA 2FG8A 2Z5RA 4PGIA 2HTNA 4CVRA 4ITTA 1Z6OM 1XZ3A 3F34A 3PVYB 2FZFA 5JKLG 2Y3QA 3E1PA 3WNWA 1GWGA 5CZUA 2V2JA 5CMRA 4TOBA 3PW8A 5GN8A 2CN6A 2IY4A 3R2RA 4LPJA 4IWKA 3IQ1A 2FHAA 1SQ3A 1J30A 1TK6A 3R2HA 2ZA8A 1S30A 3BVLA 1JIGA 4EVDA 1S3QA 1Z4AA 1XZ1A 2CIHA 2Z5PA 5J8SA 5FEJA 1OTKA 3SE1A 4DYYA 1RCGA 2FFXJ 5JKLA 2YW7A 4E6KA 1NNQA 3F33A 4LQJA 4LPMA 4ZKWA 1Z6OA 4Y08A 4CMYA 4ZKXA 1JKVA 4LYXA 4DZ0A 3PVRB 4ZLWA 1L8HA 4TW3A 2XJOA 1JTSA 2C2JA 1BCFA 3F38A 3F32A 3GVYA 4MY7A 1IESA 2C2UA 3Q4OA 2GYDA 5GOUA 1RCEA 2ZA7A 4M32A 2CN7A 3SIDA 1TJOA 2BKCA 3AK9A 3RGDA 3ISEA 3QHBA 2BW1A 5ERJA 5GU0X 3OGHA 4Z5SA 3GE4A 2ZG8X 4A25A 2CHPA 4XKTA 2X170 3FVBA 4LQNA 2V2MA 3UNOA 4II4A 3PVTA 5K52A 2GYQA 2ZG9X 4PG1A 4ML5A 3KX9A 2YW6A 5K53A 5LS9A 4RC7A 4CVPA 4ISPA 2FKZA 4ZL6A 4ZL5A 2OC5A 2Z6MA 5D8SA 4PGKA 3MPSA 4R42A 3E2CA 3AF8X 1LB3A 4KVSA 2XJMA 3KA6A 2V2OA 2XGWA 4RC5A 2V2SA 3RD0A 4EVEA 3KA3A 3R2KA 4LQHA 4YKHA 3ERZA 3E1NA 3E6SA 4XKUA 2UX1A 5D8YA 4DYXA 5ERKA 3TA8A 3BVEA 4RC6A 1O9RA 3R2LA 4KVQA 1RCDA 3Q4QA 4EVCA 2QQYA 4EVBA 4MN9A 1O9IA 1UVHA 2GS4A 2YJJA 1TKOA 1F30A 2CLBA 4U3GA 2IU2A 1TKPA 3PZAA 3RBCA 5JKMG 2XKQA 3WVVA 2VXIA 2Z90A 4TODA 5LBHA 1VELA 3BVFA 4CVTA 2BJYA 5FFAA 5D8RA 1RYTA 2V2RA 3ES3A 4IWJA 2CHIA 2JD60 2OH3A 4AM2A 3KXUA 5FFDA 5GU3X 2V2PA 3E6RA 5D8QA 3PW1A 4LYUA 5D8XA 5LG8A 2JD80 5IX6A 4M35A 5JKMA 4M34A 3F36A 1MOJA 4DE6A 1VEQA 4OYNA 4TOFA 1DATA 4LQVA 3EZUA 2F7NA 2PYBA 5I4JA 4XKSA 5GN8B 2CEIA 2ITBA 4AM4A 1YUXA 2CLUA 1S2ZA 3PWQC 3AJQA 4Z3BA 5FFCA 1ZS3A 1NF6A 1L8IA 3U90A 3E1LA 3EZ0A 3H7GA 2RBDA 1QGHA 2V2IA 4CYAA 2HR5A 1JGCA 1MFRA 4PG0A 3FI6A 3KA8A 3T9JA 3QHCA 4MJYA 1BG7A 3AJPA 3KA4A 1UMNA 4AM5A 1R03A 4REUA 5JACA 3PWFA 5FFEA 3AK8A 3IS7A 3NOZX 2FG4A 3SH6A 3WVUA 2D5KA 3PW8C 4ZJKA 4CY9A 3UOFA 3F35A 4DYUA 1JKUA 4TOAA 2JD70 4ZMCA 4ITWA 1QYBA 2QF9A 4RC8A 5CMQA 3BKNA 4II4B 2XJNA 4KVRA 3PVTB 3E1OA 3NP2X 4XGSA 1JI4A 3Q4RA 3R2SA 3HIUA 3QB9A 5AXSA 2C2FA 2C6RA 4DASA 5GU1X 4RC7B 2V2NA 3E1MA 3AF7X 3E1QA 1KRQA 2WLUA 1NF4A 3PVRA 1N1QA 4LPNA 5D8PA 3R2MA 2FJCA 1IERA 1JREA 4RC5B 1JI5A 1EUMA 3Q4NA 5HJHA 2Z5QA 3QVDA 1ZUJA 5GU2X 5C6FA 3BT5A 1F33A 1VLGA 4DYZA 2IB0A 2V15A 4RC6B 4ISMA 2V2LA 4DI0A 3UOIA 1VEIA 3BVKA 5HJFA 1H96A 4TO9A 5LG2A 3R2OA 4CVSA 2ZG7X 3O7RA 1AEWA 1BFRA 4TOCA 3AJOA 2FL0A 1LKMA 1LKPA 3IS8A 5FFBA 1LKOA 4ZKHA 3E1JA 3QD8A 1FHAA 1DPSA 2WTLA 3BVIA 5E1UA 1B71A 3EGMA 1JYBA 2CF7A 1RCIA 5J9VA 1DVBA 3HL1A 3FSEA 3WVWA 3AF9X 5D8OA 3O7SA 3PW1B 5J8WA 1VJXA 4P18A 4TOEA 4IXKA 2BK6A 2C41A 4TOGA 5J93A 3GHQA 1NFVA 5E2DA 3PVYA 3VNXA 3NP0X 3ISFA 1SOFA 3F39A 4ETRA 3SHXA 3QZ3A 2W0OA 3RE7A 4M33A 3A68A 2ZURX 4MKUA 3OJ5A 3KWOA
chains in the Genus database with same CATH superfamily
1HRSA 3PWQA 2YJKA 3M6JA 1RCCA 3RAVA 2VZBA 2VXXA 2G38B 3KA9A 4W4LB 4CYBA 4TOHA 3F37A 4MUDA 3A9QA 1YUZA 4YXJA 2WLAA 1YV1A 4CMYV 5HQOA 2ZA6A 4QUWA 2G4HA 4ERUA 4ZTTA 2FG8A 2Z5RA 4PGIA 2HTNA 4CVRA 4ITTA 1Z6OM 2N02A 1XZ3A 3F34A 3PVYB 3GGYA 2FZFA 5JKLG 2Y3QA 3E1PA 3WNWA 1GWGA 5CZUA 2V2JA 5CMRA 4TOBA 3PW8A 5GN8A 2CN6A 2IY4A 3R2RA 4LPJA 4IWKA 3IQ1A 2FHAA 2AR0A 1SQ3A 1J30A 1TK6A 3R2HA 2ZA8A 1S30A 3BVLA 1JIGA 4EVDA 1S3QA 1Z4AA 1XZ1A 2CIHA 3KHKA 2Z5PA 5J8SA 5FEJA 1OTKA 3SE1A 4DYYA 4X0JA 1RCGA 2FFXJ 5JKLA 2YW7A 4E6KA 1NNQA 3FRRA 3F33A 4LQJA 4LPMA 4ZKWA 1Z6OA 4Y08A 4CMYA 4ZKXA 1JKVA 4LYXA 4DZ0A 3PVRB 4ZLWA 1L8HA 4TW3A 2XJOA 1JTSA 3L0MA 2C2JA 1BCFA 3F38A 3F32A 4WJG4 3GVYA 1IESA 2CWLA 4MY7A 2C2UA 3D19A 3Q4OA 2GYDA 5GOUA 1RCEA 2ZA7A 4M32A 2CN7A 3SIDA 1TJOA 2BKCA 3AK9A 3FRSA 3RGDA 3ISEA 3QHBA 2BW1A 5ERJA 5GU0X 3OGHA 4Z5SA 3GE4A 2ZG8X 4A25A 2CHPA 4XKTA 2X170 3FVBA 4LQNA 2V2MA 3UNOA 4II4A 3PVTA 5K52A 2GYQA 2ZG9X 4PG1A 4ML5A 3KX9A 2YW6A 5K53A 5LS9A 4RC7A 4YVZA 4CVPA 4ISPA 2FKZA 4ZL6A 4ZL5A 2OC5A 2Z6MA 5D8SA 4PGKA 3MPSA 4R42A 3E2CA 3AF8X 1LB3A 4KVSA 4KXRB 2XJMA 3KA6A 2V2OA 2XGWA 4RC5A 2V2SA 3RD0A 4EVEA 3KA3A 3R2KA 4LQHA 4YKHA 3ERZA 3E1NA 2WWXB 3E6SA 4XKUA 2UX1A 5D8YA 4DYXA 4MXPA 5ERKA 3TA8A 3BVEA 4RC6A 5HU6D 1O9RA 3R2LA 3V3KB 4KVQA 1RCDA 5JDOA 3Q4QA 4EVCA 2QQYA 3C21A 3C1ZA 4EVBA 4MN9A 1O9IA 1UVHA 2GS4A 2YJJA 1TKOA 1F30A 2CLBA 4U3GA 2IU2A 1TKPA 3PZAA 3RBCA 5JKMG 2XKQA 3N6OA 3WVVA 2VXIA 2Z90A 4TODA 5LBHA 1VELA 3BVFA 4CVTA 2BJYA 5FFAA 5D8RA 1RYTA 3W54A 2V2RA 3ES3A 4IWJA 2CHIA 2V8UA 2JD60 2OH3A 4AM2A 3KXUA 5FFDA 5GU3X 2V2PA 3E6RA 5D8QA 3PW1A 4LYUA 5D8XA 5LG8A 2JD80 5IX6A 4M35A 5JKMA 4M34A 3F36A 1MOJA 4DE6A 1VEQA 4OYNA 4TOFA 1DATA 4LQVA 3UFBA 3EZUA 2F7NA 2PYBA 5I4JA 4XKSA 5GN8B 2CEIA 2ITBA 4AM4A 1YUXA 3JZAB 2CLUA 1S2ZA 3PWQC 3AJQA 4Z3BA 5FFCA 1ZS3A 1NF6A 1L8IA 3U90A 3E1LA 3EZ0A 3C23A 2Y44A 3H7GA 2RBDA 1QGHA 2V2IA 4CYAA 2HR5A 1JGCA 3KDQA 1MFRA 4PG0A 3FI6A 3KA8A 3T9JA 3QHCA 4MJYA 1BG7A 3AJPA 3KA4A 1UMNA 4AM5A 1R03A 4REUA 5JACA 3PWFA 5FFEA 3AK8A 3IS7A 3NOZX 2FG4A 3SH6A 3WVUA 3VVAA 2D5KA 3PW8C 4ZJKA 4CY9A 3UOFA 3F35A 4DYUA 1JKUA 4TOAA 2JD70 4ZMCA 4ITWA 1QYBA 2QF9A 4RC8A 5CMQA 3BKNA 4II4B 2XJNA 4KVRA 3PVTB 3E1OA 3NP2X 4XGSA 1JI4A 3Q4RA 3R2SA 3HIUA 3QB9A 5AXSA 2C2FA 2C6RA 4DASA 5GU1X 4RC7B 2V2NA 3E1MA 3AF7X 3E1QA 1KRQA 2WLUA 1NF4A 3PVRA 1N1QA 4LPNA 5D8PA 3R2MA 2FJCA 4YXMA 1IERA 4E40A 1JREA 3JZ9A 4RC5B 1JI5A 1EUMA 3Q4NA 5HJHA 2Z5QA 3QVDA 1ZUJA 3LKDA 5GU2X 5C6FA 3BT5A 1F33A 3VV9A 1VLGA 4DYZA 2IB0A 2V15A 4RC6B 4ISMA 2V2LA 4DI0A 3UOIA 1VEIA 3DBYA 3BVKA 5HJFA 1H96A 4TO9A 5LG2A 5JDOB 3R2OA 4CVSA 2ZG7X 3O7RA 1AEWA 1BFRA 4TOCA 3AJOA 2FL0A 1LKMA 1LKPA 3IS8A 5FFBA 1LKOA 4ZKHA 3E1JA 3QD8A 1FHAA 1DPSA 2V8TA 2WTLA 3BVIA 5E1UA 1B71A 3EGMA 1JYBA 2CF7A 1RCIA 5J9VA 2MGYA 1DVBA 3HL1A 3FSEA 3WVWA 3AF9X 5D8OA 3O7SA 3GGZA 2OKCA 3PW1B 5J8WA 1VJXA 4P18A 4TOEA 4IXKA 2BK6A 2C41A 4TOGA 5J93A 3C1YA 3GHQA 1NFVA 5E2DA 3PVYA 3VNXA 3NP0X 3ISFA 1SOFA 3F39A 4ETRA 3SHXA 3QZ3A 2W0OA 3RE7A 4M33A 3A68A 2ZURX 4MKUA 4W4KB 3OJ5A 3KWOA
chains in the Genus database with same CATH topology
1HRSA 3PWQA 2YJKA 3M6JA 1RCCA 3RAVA 2VZBA 2VXXA 2G38B 3KA9A 4W4LB 4CYBA 4TOHA 3F37A 4MUDA 3A9QA 1YUZA 4YXJA 2WLAA 1YV1A 4CMYV 5HQOA 2ZA6A 4QUWA 2G4HA 4ERUA 4ZTTA 2FG8A 2Z5RA 4PGIA 2HTNA 4CVRA 4ITTA 1Z6OM 2N02A 1XZ3A 3F34A 3PVYB 3GGYA 2FZFA 5JKLG 2Y3QA 3E1PA 3WNWA 1GWGA 5CZUA 2V2JA 5CMRA 4TOBA 3PW8A 5GN8A 2CN6A 2IY4A 3R2RA 4LPJA 4IWKA 3IQ1A 2FHAA 2AR0A 1SQ3A 1J30A 1TK6A 3R2HA 2ZA8A 1S30A 3BVLA 1JIGA 4EVDA 1S3QA 1Z4AA 1XZ1A 2CIHA 3KHKA 2Z5PA 5J8SA 5FEJA 1OTKA 3SE1A 4DYYA 4X0JA 1RCGA 2FFXJ 5JKLA 2YW7A 4E6KA 1NNQA 3FRRA 3F33A 4LQJA 4LPMA 4ZKWA 1Z6OA 4Y08A 4CMYA 4ZKXA 1JKVA 4LYXA 4DZ0A 3PVRB 4ZLWA 1L8HA 4TW3A 2XJOA 1JTSA 3L0MA 2C2JA 1BCFA 3F38A 3F32A 4WJG4 3GVYA 1IESA 2CWLA 4MY7A 2C2UA 3D19A 3Q4OA 2GYDA 5GOUA 1RCEA 2ZA7A 4M32A 2CN7A 3SIDA 1TJOA 2BKCA 3AK9A 3FRSA 3RGDA 3ISEA 3QHBA 2BW1A 5ERJA 5GU0X 3OGHA 4Z5SA 3GE4A 2ZG8X 4A25A 2CHPA 4XKTA 2X170 3FVBA 4LQNA 2V2MA 3UNOA 4II4A 3PVTA 5K52A 2GYQA 2ZG9X 4PG1A 4ML5A 3KX9A 2YW6A 5K53A 5LS9A 4RC7A 4YVZA 4CVPA 4ISPA 2FKZA 4ZL6A 4ZL5A 2OC5A 2Z6MA 5D8SA 4PGKA 3MPSA 4R42A 3E2CA 3AF8X 1LB3A 4KVSA 4KXRB 2XJMA 3KA6A 2V2OA 2XGWA 4RC5A 2V2SA 3RD0A 4EVEA 3KA3A 3R2KA 4LQHA 4YKHA 3ERZA 3E1NA 2WWXB 3E6SA 4XKUA 2UX1A 5D8YA 4DYXA 4MXPA 5ERKA 3TA8A 3BVEA 4RC6A 5HU6D 1O9RA 3R2LA 3V3KB 4KVQA 1RCDA 5JDOA 3Q4QA 4EVCA 2QQYA 3C21A 3C1ZA 4EVBA 4MN9A 1O9IA 1UVHA 2GS4A 2YJJA 1TKOA 1F30A 2CLBA 4U3GA 2IU2A 1TKPA 3PZAA 3RBCA 5JKMG 2XKQA 3N6OA 3WVVA 2VXIA 2Z90A 4TODA 5LBHA 1VELA 3BVFA 4CVTA 2BJYA 5FFAA 5D8RA 1RYTA 3W54A 2V2RA 3ES3A 4IWJA 2CHIA 2V8UA 2JD60 2OH3A 4AM2A 3KXUA 5FFDA 5GU3X 2V2PA 3E6RA 5D8QA 3PW1A 4LYUA 5D8XA 5LG8A 2JD80 5IX6A 4M35A 5JKMA 4M34A 3F36A 1MOJA 4DE6A 1VEQA 4OYNA 4TOFA 1DATA 4LQVA 3UFBA 3EZUA 2F7NA 2PYBA 5I4JA 4XKSA 5GN8B 2CEIA 2ITBA 4AM4A 1YUXA 3JZAB 2CLUA 1S2ZA 3PWQC 3AJQA 4Z3BA 5FFCA 1ZS3A 1NF6A 1L8IA 3U90A 3E1LA 3EZ0A 3C23A 2Y44A 3H7GA 2RBDA 1QGHA 2V2IA 4CYAA 2HR5A 1JGCA 3KDQA 1MFRA 4PG0A 3FI6A 3KA8A 3T9JA 3QHCA 4MJYA 1BG7A 3AJPA 3KA4A 1UMNA 4AM5A 1R03A 4REUA 5JACA 3PWFA 5FFEA 3AK8A 3IS7A 3NOZX 2FG4A 3SH6A 3WVUA 3VVAA 2D5KA 3PW8C 4ZJKA 4CY9A 3UOFA 3F35A 4DYUA 1JKUA 4TOAA 2JD70 4ZMCA 4ITWA 1QYBA 2QF9A 4RC8A 5CMQA 3BKNA 4II4B 2XJNA 4KVRA 3PVTB 3E1OA 3NP2X 4XGSA 1JI4A 3Q4RA 3R2SA 3HIUA 3QB9A 5AXSA 2C2FA 2C6RA 4DASA 5GU1X 4RC7B 2V2NA 3E1MA 3AF7X 3E1QA 1KRQA 2WLUA 1NF4A 3PVRA 1N1QA 4LPNA 5D8PA 3R2MA 2FJCA 4YXMA 1IERA 4E40A 1JREA 3JZ9A 4RC5B 1JI5A 1EUMA 3Q4NA 5HJHA 2Z5QA 3QVDA 1ZUJA 3LKDA 5GU2X 5C6FA 3BT5A 1F33A 3VV9A 1VLGA 4DYZA 2IB0A 2V15A 4RC6B 4ISMA 2V2LA 4DI0A 3UOIA 1VEIA 3DBYA 3BVKA 5HJFA 1H96A 4TO9A 5LG2A 5JDOB 3R2OA 4CVSA 2ZG7X 3O7RA 1AEWA 1BFRA 4TOCA 3AJOA 2FL0A 1LKMA 1LKPA 3IS8A 5FFBA 1LKOA 4ZKHA 3E1JA 3QD8A 1FHAA 1DPSA 2V8TA 2WTLA 3BVIA 5E1UA 1B71A 3EGMA 1JYBA 2CF7A 1RCIA 5J9VA 2MGYA 1DVBA 3HL1A 3FSEA 3WVWA 3AF9X 5D8OA 3O7SA 3GGZA 2OKCA 3PW1B 5J8WA 1VJXA 4P18A 4TOEA 4IXKA 2BK6A 2C41A 4TOGA 5J93A 3C1YA 3GHQA 1NFVA 5E2DA 3PVYA 3VNXA 3NP0X 3ISFA 1SOFA 3F39A 4ETRA 3SHXA 3QZ3A 2W0OA 3RE7A 4M33A 3A68A 2ZURX 4MKUA 4W4KB 3OJ5A 3KWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HRS A;  3PWQ A;  2YJK A;  1RCC A;  3RAV A;  2VZB A;  2VXX A;  3KA9 A;  4CYB A;  4TOH A;  3F37 A;  4MUD A;  3A9Q A;  1YUZ A;  2WLA A;  1YV1 A;  4CMY V;  5HQO A;  2ZA6 A;  4QUW A;  2G4H A;  4ERU A;  4ZTT A;  2FG8 A;  2Z5R A;  4PGI A;  2HTN A;  4CVR A;  4ITT A;  1Z6O M;  1XZ3 A;  3F34 A;  3PVY B;  2FZF A;  5JKL G;  2Y3Q A;  3E1P A;  3WNW A;  1GWG A;  5CZU A;  2V2J A;  5CMR A;  4TOB A;  3PW8 A;  5GN8 A;  2CN6 A;  2IY4 A;  3R2R A;  4LPJ A;  4IWK A;  3IQ1 A;  2FHA A;  1SQ3 A;  1J30 A;  1TK6 A;  3R2H A;  2ZA8 A;  1S30 A;  3BVL A;  1JIG A;  4EVD A;  1S3Q A;  1Z4A A;  1XZ1 A;  2CIH A;  2Z5P A;  5J8S A;  5FEJ A;  1OTK A;  3SE1 A;  4DYY A;  1RCG A;  2FFX J;  5JKL A;  2YW7 A;  4E6K A;  1NNQ A;  3F33 A;  4LQJ A;  4LPM A;  4ZKW A;  1Z6O A;  4Y08 A;  4CMY A;  4ZKX A;  1JKV A;  4LYX A;  4DZ0 A;  3PVR B;  4ZLW A;  1L8H A;  4TW3 A;  2XJO A;  1JTS A;  2C2J A;  1BCF A;  3F38 A;  3F32 A;  3GVY A;  4MY7 A;  1IES A;  2C2U A;  3Q4O A;  2GYD A;  5GOU A;  1RCE A;  2ZA7 A;  4M32 A;  2CN7 A;  3SID A;  1TJO A;  2BKC A;  3AK9 A;  3RGD A;  3ISE A;  3QHB A;  2BW1 A;  5ERJ A;  5GU0 X;  3OGH A;  4Z5S A;  3GE4 A;  2ZG8 X;  4A25 A;  2CHP A;  4XKT A;  2X17 0;  3FVB A;  4LQN A;  2V2M A;  3UNO A;  4II4 A;  3PVT A;  5K52 A;  2GYQ A;  2ZG9 X;  4PG1 A;  4ML5 A;  3KX9 A;  2YW6 A;  5K53 A;  5LS9 A;  4RC7 A;  4CVP A;  4ISP A;  2FKZ A;  4ZL6 A;  4ZL5 A;  2OC5 A;  2Z6M A;  5D8S A;  4PGK A;  3MPS A;  4R42 A;  3E2C A;  3AF8 X;  1LB3 A;  4KVS A;  2XJM A;  3KA6 A;  2V2O A;  2XGW A;  4RC5 A;  2V2S A;  3RD0 A;  4EVE A;  3KA3 A;  3R2K A;  4LQH A;  4YKH A;  3ERZ A;  3E1N A;  3E6S A;  4XKU A;  2UX1 A;  5D8Y A;  4DYX A;  5ERK A;  3TA8 A;  3BVE A;  4RC6 A;  1O9R A;  3R2L A;  4KVQ A;  1RCD A;  3Q4Q A;  4EVC A;  2QQY A;  4EVB A;  4MN9 A;  1O9I A;  1UVH A;  2GS4 A;  2YJJ A;  1TKO A;  1F30 A;  2CLB A;  4U3G A;  2IU2 A;  1TKP A;  3PZA A;  3RBC A;  5JKM G;  2XKQ A;  3WVV A;  2VXI A;  2Z90 A;  4TOD A;  5LBH A;  1VEL A;  3BVF A;  4CVT A;  2BJY A;  5FFA A;  5D8R A;  1RYT A;  2V2R A;  3ES3 A;  4IWJ A;  2CHI A;  2JD6 0;  2OH3 A;  4AM2 A;  3KXU A;  5FFD A;  5GU3 X;  2V2P A;  3E6R A;  5D8Q A;  3PW1 A;  4LYU A;  5D8X A;  5LG8 A;  2JD8 0;  5IX6 A;  4M35 A;  5JKM A;  4M34 A;  3F36 A;  1MOJ A;  4DE6 A;  1VEQ A;  4OYN A;  4TOF A;  1DAT A;  4LQV A;  3EZU A;  2F7N A;  2PYB A;  5I4J A;  4XKS A;  5GN8 B;  2CEI A;  2ITB A;  4AM4 A;  1YUX A;  2CLU A;  1S2Z A;  3PWQ C;  3AJQ A;  4Z3B A;  5FFC A;  1ZS3 A;  1NF6 A;  1L8I A;  3U90 A;  3E1L A;  3EZ0 A;  3H7G A;  2RBD A;  1QGH A;  2V2I A;  4CYA A;  2HR5 A;  1JGC A;  1MFR A;  4PG0 A;  3FI6 A;  3KA8 A;  3T9J A;  3QHC A;  4MJY A;  1BG7 A;  3AJP A;  3KA4 A;  1UMN A;  4AM5 A;  1R03 A;  4REU A;  5JAC A;  3PWF A;  5FFE A;  3AK8 A;  3IS7 A;  3NOZ X;  2FG4 A;  3SH6 A;  3WVU A;  2D5K A;  3PW8 C;  4ZJK A;  4CY9 A;  3UOF A;  3F35 A;  4DYU A;  1JKU A;  4TOA A;  2JD7 0;  4ZMC A;  4ITW A;  1QYB A;  2QF9 A;  4RC8 A;  5CMQ A;  3BKN A;  4II4 B;  2XJN A;  4KVR A;  3PVT B;  3E1O A;  3NP2 X;  4XGS A;  1JI4 A;  3Q4R A;  3R2S A;  3HIU A;  3QB9 A;  5AXS A;  2C2F A;  2C6R A;  4DAS A;  5GU1 X;  4RC7 B;  2V2N A;  3E1M A;  3AF7 X;  3E1Q A;  1KRQ A;  2WLU A;  1NF4 A;  3PVR A;  1N1Q A;  4LPN A;  5D8P A;  3R2M A;  2FJC A;  1IER A;  1JRE A;  4RC5 B;  1JI5 A;  1EUM A;  3Q4N A;  5HJH A;  2Z5Q A;  3QVD A;  1ZUJ A;  5GU2 X;  5C6F A;  3BT5 A;  1F33 A;  1VLG A;  4DYZ A;  2IB0 A;  2V15 A;  4RC6 B;  4ISM A;  2V2L A;  4DI0 A;  3UOI A;  1VEI A;  3BVK A;  5HJF A;  1H96 A;  4TO9 A;  5LG2 A;  3R2O A;  4CVS A;  2ZG7 X;  3O7R A;  1AEW A;  1BFR A;  4TOC A;  3AJO A;  2FL0 A;  1LKM A;  1LKP A;  3IS8 A;  5FFB A;  1LKO A;  4ZKH A;  3E1J A;  3QD8 A;  1FHA A;  1DPS A;  2WTL A;  3BVI A;  5E1U A;  1B71 A;  3EGM A;  1JYB A;  2CF7 A;  1RCI A;  5J9V A;  1DVB A;  3HL1 A;  3FSE A;  3WVW A;  3AF9 X;  5D8O A;  3O7S A;  3PW1 B;  5J8W A;  1VJX A;  4P18 A;  4TOE A;  4IXK A;  2BK6 A;  2C41 A;  4TOG A;  5J93 A;  3GHQ A;  1NFV A;  5E2D A;  3PVY A;  3VNX A;  3NP0 X;  3ISF A;  1SOF A;  3F39 A;  4ETR A;  3SHX A;  3QZ3 A;  2W0O A;  3RE7 A;  4M33 A;  3A68 A;  2ZUR X;  4MKU A;  3OJ5 A;  3KWO A; 
#chains in the Genus database with same CATH topology
 1HRS A;  3PWQ A;  2YJK A;  3M6J A;  1RCC A;  3RAV A;  2VZB A;  2VXX A;  2G38 B;  3KA9 A;  4W4L B;  4CYB A;  4TOH A;  3F37 A;  4MUD A;  3A9Q A;  1YUZ A;  4YXJ A;  2WLA A;  1YV1 A;  4CMY V;  5HQO A;  2ZA6 A;  4QUW A;  2G4H A;  4ERU A;  4ZTT A;  2FG8 A;  2Z5R A;  4PGI A;  2HTN A;  4CVR A;  4ITT A;  1Z6O M;  2N02 A;  1XZ3 A;  3F34 A;  3PVY B;  3GGY A;  2FZF A;  5JKL G;  2Y3Q A;  3E1P A;  3WNW A;  1GWG A;  5CZU A;  2V2J A;  5CMR A;  4TOB A;  3PW8 A;  5GN8 A;  2CN6 A;  2IY4 A;  3R2R A;  4LPJ A;  4IWK A;  3IQ1 A;  2FHA A;  2AR0 A;  1SQ3 A;  1J30 A;  1TK6 A;  3R2H A;  2ZA8 A;  1S30 A;  3BVL A;  1JIG A;  4EVD A;  1S3Q A;  1Z4A A;  1XZ1 A;  2CIH A;  3KHK A;  2Z5P A;  5J8S A;  5FEJ A;  1OTK A;  3SE1 A;  4DYY A;  4X0J A;  1RCG A;  2FFX J;  5JKL A;  2YW7 A;  4E6K A;  1NNQ A;  3FRR A;  3F33 A;  4LQJ A;  4LPM A;  4ZKW A;  1Z6O A;  4Y08 A;  4CMY A;  4ZKX A;  1JKV A;  4LYX A;  4DZ0 A;  3PVR B;  4ZLW A;  1L8H A;  4TW3 A;  2XJO A;  1JTS A;  3L0M A;  2C2J A;  1BCF A;  3F38 A;  3F32 A;  4WJG 4;  3GVY A;  1IES A;  2CWL A;  4MY7 A;  2C2U A;  3D19 A;  3Q4O A;  2GYD A;  5GOU A;  1RCE A;  2ZA7 A;  4M32 A;  2CN7 A;  3SID A;  1TJO A;  2BKC A;  3AK9 A;  3FRS A;  3RGD A;  3ISE A;  3QHB A;  2BW1 A;  5ERJ A;  5GU0 X;  3OGH A;  4Z5S A;  3GE4 A;  2ZG8 X;  4A25 A;  2CHP A;  4XKT A;  2X17 0;  3FVB A;  4LQN A;  2V2M A;  3UNO A;  4II4 A;  3PVT A;  5K52 A;  2GYQ A;  2ZG9 X;  4PG1 A;  4ML5 A;  3KX9 A;  2YW6 A;  5K53 A;  5LS9 A;  4RC7 A;  4YVZ A;  4CVP A;  4ISP A;  2FKZ A;  4ZL6 A;  4ZL5 A;  2OC5 A;  2Z6M A;  5D8S A;  4PGK A;  3MPS A;  4R42 A;  3E2C A;  3AF8 X;  1LB3 A;  4KVS A;  4KXR B;  2XJM A;  3KA6 A;  2V2O A;  2XGW A;  4RC5 A;  2V2S A;  3RD0 A;  4EVE A;  3KA3 A;  3R2K A;  4LQH A;  4YKH A;  3ERZ A;  3E1N A;  2WWX B;  3E6S A;  4XKU A;  2UX1 A;  5D8Y A;  4DYX A;  4MXP A;  5ERK A;  3TA8 A;  3BVE A;  4RC6 A;  5HU6 D;  1O9R A;  3R2L A;  3V3K B;  4KVQ A;  1RCD A;  5JDO A;  3Q4Q A;  4EVC A;  2QQY A;  3C21 A;  3C1Z A;  4EVB A;  4MN9 A;  1O9I A;  1UVH A;  2GS4 A;  2YJJ A;  1TKO A;  1F30 A;  2CLB A;  4U3G A;  2IU2 A;  1TKP A;  3PZA A;  3RBC A;  5JKM G;  2XKQ A;  3N6O A;  3WVV A;  2VXI A;  2Z90 A;  4TOD A;  5LBH A;  1VEL A;  3BVF A;  4CVT A;  2BJY A;  5FFA A;  5D8R A;  1RYT A;  3W54 A;  2V2R A;  3ES3 A;  4IWJ A;  2CHI A;  2V8U A;  2JD6 0;  2OH3 A;  4AM2 A;  3KXU A;  5FFD A;  5GU3 X;  2V2P A;  3E6R A;  5D8Q A;  3PW1 A;  4LYU A;  5D8X A;  5LG8 A;  2JD8 0;  5IX6 A;  4M35 A;  5JKM A;  4M34 A;  3F36 A;  1MOJ A;  4DE6 A;  1VEQ A;  4OYN A;  4TOF A;  1DAT A;  4LQV A;  3UFB A;  3EZU A;  2F7N A;  2PYB A;  5I4J A;  4XKS A;  5GN8 B;  2CEI A;  2ITB A;  4AM4 A;  1YUX A;  3JZA B;  2CLU A;  1S2Z A;  3PWQ C;  3AJQ A;  4Z3B A;  5FFC A;  1ZS3 A;  1NF6 A;  1L8I A;  3U90 A;  3E1L A;  3EZ0 A;  3C23 A;  2Y44 A;  3H7G A;  2RBD A;  1QGH A;  2V2I A;  4CYA A;  2HR5 A;  1JGC A;  3KDQ A;  1MFR A;  4PG0 A;  3FI6 A;  3KA8 A;  3T9J A;  3QHC A;  4MJY A;  1BG7 A;  3AJP A;  3KA4 A;  1UMN A;  4AM5 A;  1R03 A;  4REU A;  5JAC A;  3PWF A;  5FFE A;  3AK8 A;  3IS7 A;  3NOZ X;  2FG4 A;  3SH6 A;  3WVU A;  3VVA A;  2D5K A;  3PW8 C;  4ZJK A;  4CY9 A;  3UOF A;  3F35 A;  4DYU A;  1JKU A;  4TOA A;  2JD7 0;  4ZMC A;  4ITW A;  1QYB A;  2QF9 A;  4RC8 A;  5CMQ A;  3BKN A;  4II4 B;  2XJN A;  4KVR A;  3PVT B;  3E1O A;  3NP2 X;  4XGS A;  1JI4 A;  3Q4R A;  3R2S A;  3HIU A;  3QB9 A;  5AXS A;  2C2F A;  2C6R A;  4DAS A;  5GU1 X;  4RC7 B;  2V2N A;  3E1M A;  3AF7 X;  3E1Q A;  1KRQ A;  2WLU A;  1NF4 A;  3PVR A;  1N1Q A;  4LPN A;  5D8P A;  3R2M A;  2FJC A;  4YXM A;  1IER A;  4E40 A;  1JRE A;  3JZ9 A;  4RC5 B;  1JI5 A;  1EUM A;  3Q4N A;  5HJH A;  2Z5Q A;  3QVD A;  1ZUJ A;  3LKD A;  5GU2 X;  5C6F A;  3BT5 A;  1F33 A;  3VV9 A;  1VLG A;  4DYZ A;  2IB0 A;  2V15 A;  4RC6 B;  4ISM A;  2V2L A;  4DI0 A;  3UOI A;  1VEI A;  3DBY A;  3BVK A;  5HJF A;  1H96 A;  4TO9 A;  5LG2 A;  5JDO B;  3R2O A;  4CVS A;  2ZG7 X;  3O7R A;  1AEW A;  1BFR A;  4TOC A;  3AJO A;  2FL0 A;  1LKM A;  1LKP A;  3IS8 A;  5FFB A;  1LKO A;  4ZKH A;  3E1J A;  3QD8 A;  1FHA A;  1DPS A;  2V8T A;  2WTL A;  3BVI A;  5E1U A;  1B71 A;  3EGM A;  1JYB A;  2CF7 A;  1RCI A;  5J9V A;  2MGY A;  1DVB A;  3HL1 A;  3FSE A;  3WVW A;  3AF9 X;  5D8O A;  3O7S A;  3GGZ A;  2OKC A;  3PW1 B;  5J8W A;  1VJX A;  4P18 A;  4TOE A;  4IXK A;  2BK6 A;  2C41 A;  4TOG A;  5J93 A;  3C1Y A;  3GHQ A;  1NFV A;  5E2D A;  3PVY A;  3VNX A;  3NP0 X;  3ISF A;  1SOF A;  3F39 A;  4ETR A;  3SHX A;  3QZ3 A;  2W0O A;  3RE7 A;  4M33 A;  3A68 A;  2ZUR X;  4MKU A;  4W4K B;  3OJ5 A;  3KWO A; 
#chains in the Genus database with same CATH homology
 1HRS A;  3PWQ A;  2YJK A;  3M6J A;  1RCC A;  3RAV A;  2VZB A;  2VXX A;  2G38 B;  3KA9 A;  4W4L B;  4CYB A;  4TOH A;  3F37 A;  4MUD A;  3A9Q A;  1YUZ A;  4YXJ A;  2WLA A;  1YV1 A;  4CMY V;  5HQO A;  2ZA6 A;  4QUW A;  2G4H A;  4ERU A;  4ZTT A;  2FG8 A;  2Z5R A;  4PGI A;  2HTN A;  4CVR A;  4ITT A;  1Z6O M;  2N02 A;  1XZ3 A;  3F34 A;  3PVY B;  3GGY A;  2FZF A;  5JKL G;  2Y3Q A;  3E1P A;  3WNW A;  1GWG A;  5CZU A;  2V2J A;  5CMR A;  4TOB A;  3PW8 A;  5GN8 A;  2CN6 A;  2IY4 A;  3R2R A;  4LPJ A;  4IWK A;  3IQ1 A;  2FHA A;  2AR0 A;  1SQ3 A;  1J30 A;  1TK6 A;  3R2H A;  2ZA8 A;  1S30 A;  3BVL A;  1JIG A;  4EVD A;  1S3Q A;  1Z4A A;  1XZ1 A;  2CIH A;  3KHK A;  2Z5P A;  5J8S A;  5FEJ A;  1OTK A;  3SE1 A;  4DYY A;  4X0J A;  1RCG A;  2FFX J;  5JKL A;  2YW7 A;  4E6K A;  1NNQ A;  3FRR A;  3F33 A;  4LQJ A;  4LPM A;  4ZKW A;  1Z6O A;  4Y08 A;  4CMY A;  4ZKX A;  1JKV A;  4LYX A;  4DZ0 A;  3PVR B;  4ZLW A;  1L8H A;  4TW3 A;  2XJO A;  1JTS A;  3L0M A;  2C2J A;  1BCF A;  3F38 A;  3F32 A;  4WJG 4;  3GVY A;  1IES A;  2CWL A;  4MY7 A;  2C2U A;  3D19 A;  3Q4O A;  2GYD A;  5GOU A;  1RCE A;  2ZA7 A;  4M32 A;  2CN7 A;  3SID A;  1TJO A;  2BKC A;  3AK9 A;  3FRS A;  3RGD A;  3ISE A;  3QHB A;  2BW1 A;  5ERJ A;  5GU0 X;  3OGH A;  4Z5S A;  3GE4 A;  2ZG8 X;  4A25 A;  2CHP A;  4XKT A;  2X17 0;  3FVB A;  4LQN A;  2V2M A;  3UNO A;  4II4 A;  3PVT A;  5K52 A;  2GYQ A;  2ZG9 X;  4PG1 A;  4ML5 A;  3KX9 A;  2YW6 A;  5K53 A;  5LS9 A;  4RC7 A;  4YVZ A;  4CVP A;  4ISP A;  2FKZ A;  4ZL6 A;  4ZL5 A;  2OC5 A;  2Z6M A;  5D8S A;  4PGK A;  3MPS A;  4R42 A;  3E2C A;  3AF8 X;  1LB3 A;  4KVS A;  4KXR B;  2XJM A;  3KA6 A;  2V2O A;  2XGW A;  4RC5 A;  2V2S A;  3RD0 A;  4EVE A;  3KA3 A;  3R2K A;  4LQH A;  4YKH A;  3ERZ A;  3E1N A;  2WWX B;  3E6S A;  4XKU A;  2UX1 A;  5D8Y A;  4DYX A;  4MXP A;  5ERK A;  3TA8 A;  3BVE A;  4RC6 A;  5HU6 D;  1O9R A;  3R2L A;  3V3K B;  4KVQ A;  1RCD A;  5JDO A;  3Q4Q A;  4EVC A;  2QQY A;  3C21 A;  3C1Z A;  4EVB A;  4MN9 A;  1O9I A;  1UVH A;  2GS4 A;  2YJJ A;  1TKO A;  1F30 A;  2CLB A;  4U3G A;  2IU2 A;  1TKP A;  3PZA A;  3RBC A;  5JKM G;  2XKQ A;  3N6O A;  3WVV A;  2VXI A;  2Z90 A;  4TOD A;  5LBH A;  1VEL A;  3BVF A;  4CVT A;  2BJY A;  5FFA A;  5D8R A;  1RYT A;  3W54 A;  2V2R A;  3ES3 A;  4IWJ A;  2CHI A;  2V8U A;  2JD6 0;  2OH3 A;  4AM2 A;  3KXU A;  5FFD A;  5GU3 X;  2V2P A;  3E6R A;  5D8Q A;  3PW1 A;  4LYU A;  5D8X A;  5LG8 A;  2JD8 0;  5IX6 A;  4M35 A;  5JKM A;  4M34 A;  3F36 A;  1MOJ A;  4DE6 A;  1VEQ A;  4OYN A;  4TOF A;  1DAT A;  4LQV A;  3UFB A;  3EZU A;  2F7N A;  2PYB A;  5I4J A;  4XKS A;  5GN8 B;  2CEI A;  2ITB A;  4AM4 A;  1YUX A;  3JZA B;  2CLU A;  1S2Z A;  3PWQ C;  3AJQ A;  4Z3B A;  5FFC A;  1ZS3 A;  1NF6 A;  1L8I A;  3U90 A;  3E1L A;  3EZ0 A;  3C23 A;  2Y44 A;  3H7G A;  2RBD A;  1QGH A;  2V2I A;  4CYA A;  2HR5 A;  1JGC A;  3KDQ A;  1MFR A;  4PG0 A;  3FI6 A;  3KA8 A;  3T9J A;  3QHC A;  4MJY A;  1BG7 A;  3AJP A;  3KA4 A;  1UMN A;  4AM5 A;  1R03 A;  4REU A;  5JAC A;  3PWF A;  5FFE A;  3AK8 A;  3IS7 A;  3NOZ X;  2FG4 A;  3SH6 A;  3WVU A;  3VVA A;  2D5K A;  3PW8 C;  4ZJK A;  4CY9 A;  3UOF A;  3F35 A;  4DYU A;  1JKU A;  4TOA A;  2JD7 0;  4ZMC A;  4ITW A;  1QYB A;  2QF9 A;  4RC8 A;  5CMQ A;  3BKN A;  4II4 B;  2XJN A;  4KVR A;  3PVT B;  3E1O A;  3NP2 X;  4XGS A;  1JI4 A;  3Q4R A;  3R2S A;  3HIU A;  3QB9 A;  5AXS A;  2C2F A;  2C6R A;  4DAS A;  5GU1 X;  4RC7 B;  2V2N A;  3E1M A;  3AF7 X;  3E1Q A;  1KRQ A;  2WLU A;  1NF4 A;  3PVR A;  1N1Q A;  4LPN A;  5D8P A;  3R2M A;  2FJC A;  4YXM A;  1IER A;  4E40 A;  1JRE A;  3JZ9 A;  4RC5 B;  1JI5 A;  1EUM A;  3Q4N A;  5HJH A;  2Z5Q A;  3QVD A;  1ZUJ A;  3LKD A;  5GU2 X;  5C6F A;  3BT5 A;  1F33 A;  3VV9 A;  1VLG A;  4DYZ A;  2IB0 A;  2V15 A;  4RC6 B;  4ISM A;  2V2L A;  4DI0 A;  3UOI A;  1VEI A;  3DBY A;  3BVK A;  5HJF A;  1H96 A;  4TO9 A;  5LG2 A;  5JDO B;  3R2O A;  4CVS A;  2ZG7 X;  3O7R A;  1AEW A;  1BFR A;  4TOC A;  3AJO A;  2FL0 A;  1LKM A;  1LKP A;  3IS8 A;  5FFB A;  1LKO A;  4ZKH A;  3E1J A;  3QD8 A;  1FHA A;  1DPS A;  2V8T A;  2WTL A;  3BVI A;  5E1U A;  1B71 A;  3EGM A;  1JYB A;  2CF7 A;  1RCI A;  5J9V A;  2MGY A;  1DVB A;  3HL1 A;  3FSE A;  3WVW A;  3AF9 X;  5D8O A;  3O7S A;  3GGZ A;  2OKC A;  3PW1 B;  5J8W A;  1VJX A;  4P18 A;  4TOE A;  4IXK A;  2BK6 A;  2C41 A;  4TOG A;  5J93 A;  3C1Y A;  3GHQ A;  1NFV A;  5E2D A;  3PVY A;  3VNX A;  3NP0 X;  3ISF A;  1SOF A;  3F39 A;  4ETR A;  3SHX A;  3QZ3 A;  2W0O A;  3RE7 A;  4M33 A;  3A68 A;  2ZUR X;  4MKU A;  4W4K B;  3OJ5 A;  3KWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...