1Z4AA

Ferritin from t. maritima
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
164
structure length
164
Chain Sequence
MMVISEKVRKALNEQLNREIYSSYLYLSMATYFDAEGFKGFAHWMKKQAQEELTHAMKFYEYIYERGGRVELEAIEKPPSNWNGIKDAFEAALKHEEFVTQSIYNILELASEEKDHATVSFLKWFVDEQVEEEDQVREILDLLEKANGQMSVIFQLDRYLGQRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords ferritin
publication title Structure of T. maritima ferritin
rcsb
source organism Thermotoga maritima
total genus 76
structure length 164
sequence length 164
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2005-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1z4aA00
5D8OA 3F32A 2ZG8X 2IB0A 1NF4A 3AJOA 5FFBA 4CY9A 5JKMG 1BFRA 3VNXA 5JKMA 2V2NA 4TODA 5GN8B 3HIUA 2HTNA 5GU3X 3R2KA 2ZA8A 4AM5A 4AM2A 3PWQC 4RC6B 1YV1A 2FL0A 3PW1B 3E1NA 4TOAA 1JKUA 2ITBA 4ZL6A 2V2PA 1JGCA 3R2HA 2C41A 2FZFA 3BVKA 2HR5A 4IXKA 4ZTTA 2VXIA 4ZLWA 2CF7A 4IWKA 3E6RA 5J8WA 3KA3A 4PGKA 2JD80 1NF6A 3SIDA 3ERZA 4KVRA 1SOFA 3PVYB 1L8HA 4REUA 3A9QA 5GU0X 4DASA 5K52A 1KRQA 3U90A 3F35A 1FHAA 4M34A 1BG7A 4E6KA 3PWQA 4IWJA 3ISEA 4TOHA 2Z5PA 2CHPA 1TK6A 4AM4A 3E1MA 2V2RA 4XKUA 3PZAA 4OYNA 4TOFA 2ZG7X 2XGWA 1S3QA 1MOJA 3KWOA 1DATA 4II4B 4DE6A 3AJPA 3FVBA 4CVTA 5AXSA 3PVRB 2ZG9X 1AEWA 2BW1A 4LYUA 4TOEA 1DPSA 2V2JA 3T9JA 3KA9A 5D8YA 1LKMA 4ZJKA 1O9IA 3ES3A 1O9RA 4DYXA 2F7NA 3QVDA 4DZ0A 1ZS3A 3QZ3A 3KA4A 4XKSA 4LPNA 3R2OA 5GN8A 5LBHA 3R2MA 5JKLG 4PGIA 5J8SA 4XKTA 5J9VA 4RC6A 3PW1A 5JKLA 2BJYA 3PVTA 2ZA7A 4M33A 4KVQA 1QGHA 3F34A 3WNWA 1RCCA 1S2ZA 1DVBA 3PWFA 2OH3A 3PVTB 3NOZX 3F38A 4MKUA 4MJYA 2CHIA 4MY7A 2WTLA 2XJMA 3O7SA 2Z5QA 4DYUA 3Q4QA 3E1JA 1J30A 2D5KA 3AK9A 4ZKWA 2V15A 4Z3BA 2WLUA 1LKPA 2FFXJ 3GHQA 3H7GA 4A25A 2C2UA 5IX6A 2FHAA 3EZ0A 1LB3A 3KXUA 4DYZA 2CN6A 2V2LA 3BKNA 2FG8A 3PVYA 3NP2X 4TW3A 2UX1A 2ZURX 4LQJA 1JI5A 1JKVA 2OC5A 4YKHA 5D8RA 5FFCA 2GYDA 4ISPA 4MN9A 3OJ5A 3MPSA 5GU1X 1IESA 3QD8A 3UOIA 2IY4A 2GYQA 3SHXA 4ETRA 4EVBA 3OGHA 1JTSA 3AF8X 1Z6OM 4ZMCA 4RC7B 4M35A 1JIGA 3F33A 2VXXA 5ERJA 4II4A 1H96A 5JACA 5LG2A 5CZUA 2V2IA 3KX9A 4RC5A 4EVCA 3IS8A 1ZUJA 1RYTA 3WVUA 3F37A 5K53A 5D8SA 3PVRA 2CLBA 4ML5A 3WVVA 5HQOA 3RAVA 2XJOA 2RBDA 1F30A 4RC5B 3F39A 2C2FA 1F33A 4LQNA 1VEIA 2XJNA 2V2SA 1R03A 2YJJA 3UOFA 5CMQA 4ITTA 3BVLA 1UVHA 2X170 4EVEA 2PYBA 4XGSA 2CEIA 4ZL5A 2Z90A 2YJKA 2CLUA 3SE1A 4ZKXA 5FEJA 4ERUA 3RBCA 4Z5SA 4M32A 4R42A 2VZBA 3BVIA 5ERKA 3AK8A 4TO9A 3GE4A 4Y08A 1YUXA 5HJHA 2CIHA 3E1OA 3KA8A 4TOGA 1LKOA 1XZ1A 2FJCA 1NNQA 2Y3QA 3F36A 5CMRA 4U3GA 5GOUA 1Z4AA 4TOBA 3BT5A 1UMNA 3BVFA 2QQYA 1TKPA 2Z5RA 3E1LA 4P18A 4CMYV 5LG8A 1VELA 3IS7A 3QHCA 4CYBA 2Z6MA 1JYBA 3ISFA 4KVSA 1QYBA 5E2DA 4DYYA 1RCGA 5GU2X 1NFVA 3R2LA 3WVWA 3PW8C 3E2CA 3R2SA 3FI6A 2BK6A 5HJFA 2FG4A 4PG1A 1N1QA 4DI0A 4ITWA 2C2JA 1Z6OA 4CYAA 3GVYA 3TA8A 5I4JA 3UNOA 1RCEA 5D8XA 1S30A 3A68A 4TOCA 2FKZA 4QUWA 1MFRA 3EGMA 4RC7A 3RD0A 1TJOA 3HL1A 4MUDA 2IU2A 5E1UA 3NP0X 3Q4OA 4LYXA 2CN7A 4LPJA 5FFDA 4EVDA 1VEQA 3EZUA 3AF7X 2V2OA 4ISMA 2C6RA 5FFEA 3RGDA 3Q4RA 3QHBA 2W0OA 3O7RA 1RCIA 2G4HA 3RE7A 1JREA 3PW8A 1HRSA 2JD60 3AJQA 4PG0A 1JI4A 4LQHA 3FSEA 2QF9A 4CVSA 1GWGA 5FFAA 3E6SA 1VLGA 4CVRA 2BKCA 1XZ3A 1YUZA 5LS9A 1OTKA 2GS4A 3AF9X 1EUMA 1VJXA 4CVPA 2JD70 1RCDA 1L8IA 4CMYA 1IERA 3R2RA 1B71A 5J93A 5D8PA 3E1PA 4LPMA 3BVEA 1BCFA 3E1QA 2ZA6A 4ZKHA 2YW6A 4RC8A 3SH6A 3IQ1A 4LQVA 5D8QA 1SQ3A 3KA6A 3Q4NA 2YW7A 1TKOA 2V2MA 2XKQA 3QB9A 2WLAA 5C6FA
chains in the Genus database with same CATH superfamily
3N6OA 5D8OA 3F32A 2ZG8X 2IB0A 1NF4A 3AJOA 5FFBA 4CY9A 5JKMG 3L0MA 4MXPA 1BFRA 3VNXA 4E40A 5JKMA 2V2NA 4TODA 5GN8B 3HIUA 2HTNA 5GU3X 3R2KA 2ZA8A 4AM5A 4AM2A 3PWQC 4RC6B 1YV1A 2FL0A 3PW1B 3E1NA 4TOAA 1JKUA 2ITBA 4YXJA 4ZL6A 2V2PA 1JGCA 3R2HA 2OKCA 4YVZA 2C41A 2FZFA 3BVKA 2HR5A 3V3KB 4IXKA 4ZTTA 2VXIA 4ZLWA 2CF7A 4IWKA 3E6RA 5J8WA 3KA3A 4PGKA 2JD80 1NF6A 3SIDA 3ERZA 4KVRA 1SOFA 3PVYB 3D19A 1L8HA 4REUA 3A9QA 5GU0X 4DASA 5K52A 1KRQA 3U90A 3F35A 1FHAA 4M34A 1BG7A 4E6KA 3PWQA 4IWJA 3ISEA 4TOHA 3W54A 2Z5PA 2CHPA 1TK6A 4AM4A 3E1MA 2V2RA 4XKUA 3PZAA 4OYNA 4KXRB 3JZAB 4TOFA 2ZG7X 2XGWA 1S3QA 1MOJA 3KWOA 1DATA 4II4B 4DE6A 3AJPA 3FVBA 2WWXB 4CVTA 5AXSA 3PVRB 2ZG9X 1AEWA 2BW1A 4LYUA 4TOEA 1DPSA 2V2JA 3T9JA 3KA9A 5D8YA 1LKMA 4ZJKA 1O9IA 3ES3A 3FRRA 1O9RA 4DYXA 2F7NA 3QVDA 4DZ0A 1ZS3A 3QZ3A 3KA4A 4XKSA 4LPNA 3R2OA 3UFBA 5GN8A 5LBHA 3R2MA 5JKLG 4PGIA 5J8SA 2V8TA 4XKTA 5J9VA 4RC6A 3PW1A 5JKLA 2BJYA 3PVTA 2ZA7A 4M33A 4KVQA 1QGHA 3F34A 3WNWA 1RCCA 1S2ZA 1DVBA 3PWFA 2OH3A 3PVTB 3NOZX 3F38A 4MKUA 4MJYA 2CHIA 4MY7A 2WTLA 2XJMA 3C23A 3O7SA 3M6JA 2Z5QA 4DYUA 3Q4QA 3E1JA 1J30A 2D5KA 3AK9A 4ZKWA 2V15A 4Z3BA 2WLUA 1LKPA 2FFXJ 3GHQA 3H7GA 4A25A 2C2UA 5IX6A 2FHAA 3EZ0A 1LB3A 3KXUA 4DYZA 2CN6A 2V2LA 2N02A 3BKNA 2FG8A 3PVYA 3NP2X 4TW3A 2UX1A 2ZURX 4LQJA 1JI5A 4X0JA 1JKVA 2OC5A 4YKHA 5D8RA 5FFCA 2GYDA 4ISPA 4MN9A 3OJ5A 3MPSA 5GU1X 1IESA 3QD8A 3UOIA 2IY4A 2GYQA 3SHXA 4ETRA 4EVBA 3OGHA 1JTSA 3JZ9A 3KHKA 3AF8X 1Z6OM 4ZMCA 4RC7B 4M35A 1JIGA 3F33A 2VXXA 5ERJA 4II4A 1H96A 5JACA 5LG2A 3VVAA 5CZUA 2V2IA 3KX9A 4RC5A 4EVCA 2Y44A 3IS8A 1ZUJA 1RYTA 3WVUA 3F37A 5K53A 5D8SA 3PVRA 2CLBA 4ML5A 3WVVA 5HQOA 3RAVA 2XJOA 2RBDA 1F30A 4RC5B 3F39A 2C2FA 1F33A 4LQNA 1VEIA 2XJNA 2V2SA 1R03A 2YJJA 3UOFA 5CMQA 4ITTA 4YXMA 3BVLA 1UVHA 2X170 3C1ZA 4EVEA 2PYBA 4XGSA 2CEIA 4ZL5A 2Z90A 2YJKA 2CLUA 3SE1A 4ZKXA 5FEJA 4ERUA 3RBCA 4Z5SA 4M32A 4R42A 2VZBA 3GGZA 3BVIA 5JDOB 5ERKA 3AK8A 4TO9A 3GE4A 4Y08A 1YUXA 3GGYA 5HJHA 2CIHA 3E1OA 3KA8A 4TOGA 2MGYA 1LKOA 3DBYA 1XZ1A 2FJCA 1NNQA 2Y3QA 3F36A 5CMRA 4U3GA 5GOUA 1Z4AA 4TOBA 3BT5A 1UMNA 3BVFA 2QQYA 1TKPA 2Z5RA 3E1LA 4P18A 4CMYV 5LG8A 1VELA 3IS7A 3QHCA 4CYBA 2Z6MA 1JYBA 3ISFA 4KVSA 4W4LB 1QYBA 5E2DA 2V8UA 4DYYA 1RCGA 5GU2X 1NFVA 3R2LA 3WVWA 3PW8C 3E2CA 3R2SA 3FI6A 2BK6A 5HJFA 2FG4A 4PG1A 1N1QA 4DI0A 4ITWA 2C2JA 3KDQA 1Z6OA 4CYAA 3GVYA 3TA8A 5I4JA 3UNOA 1RCEA 5D8XA 4W4KB 1S30A 3A68A 4TOCA 2FKZA 4QUWA 1MFRA 3EGMA 4RC7A 3RD0A 1TJOA 3HL1A 4MUDA 2IU2A 3C1YA 5E1UA 3NP0X 3Q4OA 4LYXA 2CN7A 4LPJA 5FFDA 4EVDA 1VEQA 3EZUA 3AF7X 2V2OA 4ISMA 2C6RA 5FFEA 3RGDA 3Q4RA 3QHBA 2W0OA 3O7RA 1RCIA 2G4HA 3RE7A 1JREA 3PW8A 1HRSA 2JD60 3AJQA 3C21A 4PG0A 1JI4A 4LQHA 3FSEA 2QF9A 4CVSA 1GWGA 5FFAA 3E6SA 4WJG4 1VLGA 5JDOA 4CVRA 2BKCA 1XZ3A 1YUZA 5LS9A 1OTKA 2GS4A 3AF9X 5HU6D 2AR0A 1EUMA 1VJXA 4CVPA 2JD70 1RCDA 1L8IA 4CMYA 1IERA 3R2RA 1B71A 5J93A 5D8PA 3E1PA 3FRSA 4LPMA 3BVEA 1BCFA 3E1QA 2ZA6A 4ZKHA 2YW6A 4RC8A 3SH6A 3IQ1A 4LQVA 5D8QA 3VV9A 1SQ3A 3KA6A 2CWLA 3Q4NA 2YW7A 1TKOA 2V2MA 2G38B 3LKDA 2XKQA 3QB9A 2WLAA 5C6FA
chains in the Genus database with same CATH topology
3N6OA 5D8OA 3F32A 2ZG8X 2IB0A 1NF4A 3AJOA 5FFBA 4CY9A 5JKMG 3L0MA 4MXPA 1BFRA 3VNXA 4E40A 5JKMA 2V2NA 4TODA 5GN8B 3HIUA 2HTNA 5GU3X 3R2KA 2ZA8A 4AM5A 4AM2A 3PWQC 4RC6B 1YV1A 2FL0A 3PW1B 3E1NA 4TOAA 1JKUA 2ITBA 4YXJA 4ZL6A 2V2PA 1JGCA 3R2HA 2OKCA 4YVZA 2C41A 2FZFA 3BVKA 2HR5A 3V3KB 4IXKA 4ZTTA 2VXIA 4ZLWA 2CF7A 4IWKA 3E6RA 5J8WA 3KA3A 4PGKA 2JD80 1NF6A 3SIDA 3ERZA 4KVRA 1SOFA 3PVYB 3D19A 1L8HA 4REUA 3A9QA 5GU0X 4DASA 5K52A 1KRQA 3U90A 3F35A 1FHAA 4M34A 1BG7A 4E6KA 3PWQA 4IWJA 3ISEA 4TOHA 3W54A 2Z5PA 2CHPA 1TK6A 4AM4A 3E1MA 2V2RA 4XKUA 3PZAA 4OYNA 4KXRB 3JZAB 4TOFA 2ZG7X 2XGWA 1S3QA 1MOJA 3KWOA 1DATA 4II4B 4DE6A 3AJPA 3FVBA 2WWXB 4CVTA 5AXSA 3PVRB 2ZG9X 1AEWA 2BW1A 4LYUA 4TOEA 1DPSA 2V2JA 3T9JA 3KA9A 5D8YA 1LKMA 4ZJKA 1O9IA 3ES3A 3FRRA 1O9RA 4DYXA 2F7NA 3QVDA 4DZ0A 1ZS3A 3QZ3A 3KA4A 4XKSA 4LPNA 3R2OA 3UFBA 5GN8A 5LBHA 3R2MA 5JKLG 4PGIA 5J8SA 2V8TA 4XKTA 5J9VA 4RC6A 3PW1A 5JKLA 2BJYA 3PVTA 2ZA7A 4M33A 4KVQA 1QGHA 3F34A 3WNWA 1RCCA 1S2ZA 1DVBA 3PWFA 2OH3A 3PVTB 3NOZX 3F38A 4MKUA 4MJYA 2CHIA 4MY7A 2WTLA 2XJMA 3C23A 3O7SA 3M6JA 2Z5QA 4DYUA 3Q4QA 3E1JA 1J30A 2D5KA 3AK9A 4ZKWA 2V15A 4Z3BA 2WLUA 1LKPA 2FFXJ 3GHQA 3H7GA 4A25A 2C2UA 5IX6A 2FHAA 3EZ0A 1LB3A 3KXUA 4DYZA 2CN6A 2V2LA 2N02A 3BKNA 2FG8A 3PVYA 3NP2X 4TW3A 2UX1A 2ZURX 4LQJA 1JI5A 4X0JA 1JKVA 2OC5A 4YKHA 5D8RA 5FFCA 2GYDA 4ISPA 4MN9A 3OJ5A 3MPSA 5GU1X 1IESA 3QD8A 3UOIA 2IY4A 2GYQA 3SHXA 4ETRA 4EVBA 3OGHA 1JTSA 3JZ9A 3KHKA 3AF8X 1Z6OM 4ZMCA 4RC7B 4M35A 1JIGA 3F33A 2VXXA 5ERJA 4II4A 1H96A 5JACA 5LG2A 3VVAA 5CZUA 2V2IA 3KX9A 4RC5A 4EVCA 2Y44A 3IS8A 1ZUJA 1RYTA 3WVUA 3F37A 5K53A 5D8SA 3PVRA 2CLBA 4ML5A 3WVVA 5HQOA 3RAVA 2XJOA 2RBDA 1F30A 4RC5B 3F39A 2C2FA 1F33A 4LQNA 1VEIA 2XJNA 2V2SA 1R03A 2YJJA 3UOFA 5CMQA 4ITTA 4YXMA 3BVLA 1UVHA 2X170 3C1ZA 4EVEA 2PYBA 4XGSA 2CEIA 4ZL5A 2Z90A 2YJKA 2CLUA 3SE1A 4ZKXA 5FEJA 4ERUA 3RBCA 4Z5SA 4M32A 4R42A 2VZBA 3GGZA 3BVIA 5JDOB 5ERKA 3AK8A 4TO9A 3GE4A 4Y08A 1YUXA 3GGYA 5HJHA 2CIHA 3E1OA 3KA8A 4TOGA 2MGYA 1LKOA 3DBYA 1XZ1A 2FJCA 1NNQA 2Y3QA 3F36A 5CMRA 4U3GA 5GOUA 1Z4AA 4TOBA 3BT5A 1UMNA 3BVFA 2QQYA 1TKPA 2Z5RA 3E1LA 4P18A 4CMYV 5LG8A 1VELA 3IS7A 3QHCA 4CYBA 2Z6MA 1JYBA 3ISFA 4KVSA 4W4LB 1QYBA 5E2DA 2V8UA 4DYYA 1RCGA 5GU2X 1NFVA 3R2LA 3WVWA 3PW8C 3E2CA 3R2SA 3FI6A 2BK6A 5HJFA 2FG4A 4PG1A 1N1QA 4DI0A 4ITWA 2C2JA 3KDQA 1Z6OA 4CYAA 3GVYA 3TA8A 5I4JA 3UNOA 1RCEA 5D8XA 4W4KB 1S30A 3A68A 4TOCA 2FKZA 4QUWA 1MFRA 3EGMA 4RC7A 3RD0A 1TJOA 3HL1A 4MUDA 2IU2A 3C1YA 5E1UA 3NP0X 3Q4OA 4LYXA 2CN7A 4LPJA 5FFDA 4EVDA 1VEQA 3EZUA 3AF7X 2V2OA 4ISMA 2C6RA 5FFEA 3RGDA 3Q4RA 3QHBA 2W0OA 3O7RA 1RCIA 2G4HA 3RE7A 1JREA 3PW8A 1HRSA 2JD60 3AJQA 3C21A 4PG0A 1JI4A 4LQHA 3FSEA 2QF9A 4CVSA 1GWGA 5FFAA 3E6SA 4WJG4 1VLGA 5JDOA 4CVRA 2BKCA 1XZ3A 1YUZA 5LS9A 1OTKA 2GS4A 3AF9X 5HU6D 2AR0A 1EUMA 1VJXA 4CVPA 2JD70 1RCDA 1L8IA 4CMYA 1IERA 3R2RA 1B71A 5J93A 5D8PA 3E1PA 3FRSA 4LPMA 3BVEA 1BCFA 3E1QA 2ZA6A 4ZKHA 2YW6A 4RC8A 3SH6A 3IQ1A 4LQVA 5D8QA 3VV9A 1SQ3A 3KA6A 2CWLA 3Q4NA 2YW7A 1TKOA 2V2MA 2G38B 3LKDA 2XKQA 3QB9A 2WLAA 5C6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D8O A;  3F32 A;  2ZG8 X;  2IB0 A;  1NF4 A;  3AJO A;  5FFB A;  4CY9 A;  5JKM G;  1BFR A;  3VNX A;  5JKM A;  2V2N A;  4TOD A;  5GN8 B;  3HIU A;  2HTN A;  5GU3 X;  3R2K A;  2ZA8 A;  4AM5 A;  4AM2 A;  3PWQ C;  4RC6 B;  1YV1 A;  2FL0 A;  3PW1 B;  3E1N A;  4TOA A;  1JKU A;  2ITB A;  4ZL6 A;  2V2P A;  1JGC A;  3R2H A;  2C41 A;  2FZF A;  3BVK A;  2HR5 A;  4IXK A;  4ZTT A;  2VXI A;  4ZLW A;  2CF7 A;  4IWK A;  3E6R A;  5J8W A;  3KA3 A;  4PGK A;  2JD8 0;  1NF6 A;  3SID A;  3ERZ A;  4KVR A;  1SOF A;  3PVY B;  1L8H A;  4REU A;  3A9Q A;  5GU0 X;  4DAS A;  5K52 A;  1KRQ A;  3U90 A;  3F35 A;  1FHA A;  4M34 A;  1BG7 A;  4E6K A;  3PWQ A;  4IWJ A;  3ISE A;  4TOH A;  2Z5P A;  2CHP A;  1TK6 A;  4AM4 A;  3E1M A;  2V2R A;  4XKU A;  3PZA A;  4OYN A;  4TOF A;  2ZG7 X;  2XGW A;  1S3Q A;  1MOJ A;  3KWO A;  1DAT A;  4II4 B;  4DE6 A;  3AJP A;  3FVB A;  4CVT A;  5AXS A;  3PVR B;  2ZG9 X;  1AEW A;  2BW1 A;  4LYU A;  4TOE A;  1DPS A;  2V2J A;  3T9J A;  3KA9 A;  5D8Y A;  1LKM A;  4ZJK A;  1O9I A;  3ES3 A;  1O9R A;  4DYX A;  2F7N A;  3QVD A;  4DZ0 A;  1ZS3 A;  3QZ3 A;  3KA4 A;  4XKS A;  4LPN A;  3R2O A;  5GN8 A;  5LBH A;  3R2M A;  5JKL G;  4PGI A;  5J8S A;  4XKT A;  5J9V A;  4RC6 A;  3PW1 A;  5JKL A;  2BJY A;  3PVT A;  2ZA7 A;  4M33 A;  4KVQ A;  1QGH A;  3F34 A;  3WNW A;  1RCC A;  1S2Z A;  1DVB A;  3PWF A;  2OH3 A;  3PVT B;  3NOZ X;  3F38 A;  4MKU A;  4MJY A;  2CHI A;  4MY7 A;  2WTL A;  2XJM A;  3O7S A;  2Z5Q A;  4DYU A;  3Q4Q A;  3E1J A;  1J30 A;  2D5K A;  3AK9 A;  4ZKW A;  2V15 A;  4Z3B A;  2WLU A;  1LKP A;  2FFX J;  3GHQ A;  3H7G A;  4A25 A;  2C2U A;  5IX6 A;  2FHA A;  3EZ0 A;  1LB3 A;  3KXU A;  4DYZ A;  2CN6 A;  2V2L A;  3BKN A;  2FG8 A;  3PVY A;  3NP2 X;  4TW3 A;  2UX1 A;  2ZUR X;  4LQJ A;  1JI5 A;  1JKV A;  2OC5 A;  4YKH A;  5D8R A;  5FFC A;  2GYD A;  4ISP A;  4MN9 A;  3OJ5 A;  3MPS A;  5GU1 X;  1IES A;  3QD8 A;  3UOI A;  2IY4 A;  2GYQ A;  3SHX A;  4ETR A;  4EVB A;  3OGH A;  1JTS A;  3AF8 X;  1Z6O M;  4ZMC A;  4RC7 B;  4M35 A;  1JIG A;  3F33 A;  2VXX A;  5ERJ A;  4II4 A;  1H96 A;  5JAC A;  5LG2 A;  5CZU A;  2V2I A;  3KX9 A;  4RC5 A;  4EVC A;  3IS8 A;  1ZUJ A;  1RYT A;  3WVU A;  3F37 A;  5K53 A;  5D8S A;  3PVR A;  2CLB A;  4ML5 A;  3WVV A;  5HQO A;  3RAV A;  2XJO A;  2RBD A;  1F30 A;  4RC5 B;  3F39 A;  2C2F A;  1F33 A;  4LQN A;  1VEI A;  2XJN A;  2V2S A;  1R03 A;  2YJJ A;  3UOF A;  5CMQ A;  4ITT A;  3BVL A;  1UVH A;  2X17 0;  4EVE A;  2PYB A;  4XGS A;  2CEI A;  4ZL5 A;  2Z90 A;  2YJK A;  2CLU A;  3SE1 A;  4ZKX A;  5FEJ A;  4ERU A;  3RBC A;  4Z5S A;  4M32 A;  4R42 A;  2VZB A;  3BVI A;  5ERK A;  3AK8 A;  4TO9 A;  3GE4 A;  4Y08 A;  1YUX A;  5HJH A;  2CIH A;  3E1O A;  3KA8 A;  4TOG A;  1LKO A;  1XZ1 A;  2FJC A;  1NNQ A;  2Y3Q A;  3F36 A;  5CMR A;  4U3G A;  5GOU A;  1Z4A A;  4TOB A;  3BT5 A;  1UMN A;  3BVF A;  2QQY A;  1TKP A;  2Z5R A;  3E1L A;  4P18 A;  4CMY V;  5LG8 A;  1VEL A;  3IS7 A;  3QHC A;  4CYB A;  2Z6M A;  1JYB A;  3ISF A;  4KVS A;  1QYB A;  5E2D A;  4DYY A;  1RCG A;  5GU2 X;  1NFV A;  3R2L A;  3WVW A;  3PW8 C;  3E2C A;  3R2S A;  3FI6 A;  2BK6 A;  5HJF A;  2FG4 A;  4PG1 A;  1N1Q A;  4DI0 A;  4ITW A;  2C2J A;  1Z6O A;  4CYA A;  3GVY A;  3TA8 A;  5I4J A;  3UNO A;  1RCE A;  5D8X A;  1S30 A;  3A68 A;  4TOC A;  2FKZ A;  4QUW A;  1MFR A;  3EGM A;  4RC7 A;  3RD0 A;  1TJO A;  3HL1 A;  4MUD A;  2IU2 A;  5E1U A;  3NP0 X;  3Q4O A;  4LYX A;  2CN7 A;  4LPJ A;  5FFD A;  4EVD A;  1VEQ A;  3EZU A;  3AF7 X;  2V2O A;  4ISM A;  2C6R A;  5FFE A;  3RGD A;  3Q4R A;  3QHB A;  2W0O A;  3O7R A;  1RCI A;  2G4H A;  3RE7 A;  1JRE A;  3PW8 A;  1HRS A;  2JD6 0;  3AJQ A;  4PG0 A;  1JI4 A;  4LQH A;  3FSE A;  2QF9 A;  4CVS A;  1GWG A;  5FFA A;  3E6S A;  1VLG A;  4CVR A;  2BKC A;  1XZ3 A;  1YUZ A;  5LS9 A;  1OTK A;  2GS4 A;  3AF9 X;  1EUM A;  1VJX A;  4CVP A;  2JD7 0;  1RCD A;  1L8I A;  4CMY A;  1IER A;  3R2R A;  1B71 A;  5J93 A;  5D8P A;  3E1P A;  4LPM A;  3BVE A;  1BCF A;  3E1Q A;  2ZA6 A;  4ZKH A;  2YW6 A;  4RC8 A;  3SH6 A;  3IQ1 A;  4LQV A;  5D8Q A;  1SQ3 A;  3KA6 A;  3Q4N A;  2YW7 A;  1TKO A;  2V2M A;  2XKQ A;  3QB9 A;  2WLA A;  5C6F A; 
#chains in the Genus database with same CATH topology
 3N6O A;  5D8O A;  3F32 A;  2ZG8 X;  2IB0 A;  1NF4 A;  3AJO A;  5FFB A;  4CY9 A;  5JKM G;  3L0M A;  4MXP A;  1BFR A;  3VNX A;  4E40 A;  5JKM A;  2V2N A;  4TOD A;  5GN8 B;  3HIU A;  2HTN A;  5GU3 X;  3R2K A;  2ZA8 A;  4AM5 A;  4AM2 A;  3PWQ C;  4RC6 B;  1YV1 A;  2FL0 A;  3PW1 B;  3E1N A;  4TOA A;  1JKU A;  2ITB A;  4YXJ A;  4ZL6 A;  2V2P A;  1JGC A;  3R2H A;  2OKC A;  4YVZ A;  2C41 A;  2FZF A;  3BVK A;  2HR5 A;  3V3K B;  4IXK A;  4ZTT A;  2VXI A;  4ZLW A;  2CF7 A;  4IWK A;  3E6R A;  5J8W A;  3KA3 A;  4PGK A;  2JD8 0;  1NF6 A;  3SID A;  3ERZ A;  4KVR A;  1SOF A;  3PVY B;  3D19 A;  1L8H A;  4REU A;  3A9Q A;  5GU0 X;  4DAS A;  5K52 A;  1KRQ A;  3U90 A;  3F35 A;  1FHA A;  4M34 A;  1BG7 A;  4E6K A;  3PWQ A;  4IWJ A;  3ISE A;  4TOH A;  3W54 A;  2Z5P A;  2CHP A;  1TK6 A;  4AM4 A;  3E1M A;  2V2R A;  4XKU A;  3PZA A;  4OYN A;  4KXR B;  3JZA B;  4TOF A;  2ZG7 X;  2XGW A;  1S3Q A;  1MOJ A;  3KWO A;  1DAT A;  4II4 B;  4DE6 A;  3AJP A;  3FVB A;  2WWX B;  4CVT A;  5AXS A;  3PVR B;  2ZG9 X;  1AEW A;  2BW1 A;  4LYU A;  4TOE A;  1DPS A;  2V2J A;  3T9J A;  3KA9 A;  5D8Y A;  1LKM A;  4ZJK A;  1O9I A;  3ES3 A;  3FRR A;  1O9R A;  4DYX A;  2F7N A;  3QVD A;  4DZ0 A;  1ZS3 A;  3QZ3 A;  3KA4 A;  4XKS A;  4LPN A;  3R2O A;  3UFB A;  5GN8 A;  5LBH A;  3R2M A;  5JKL G;  4PGI A;  5J8S A;  2V8T A;  4XKT A;  5J9V A;  4RC6 A;  3PW1 A;  5JKL A;  2BJY A;  3PVT A;  2ZA7 A;  4M33 A;  4KVQ A;  1QGH A;  3F34 A;  3WNW A;  1RCC A;  1S2Z A;  1DVB A;  3PWF A;  2OH3 A;  3PVT B;  3NOZ X;  3F38 A;  4MKU A;  4MJY A;  2CHI A;  4MY7 A;  2WTL A;  2XJM A;  3C23 A;  3O7S A;  3M6J A;  2Z5Q A;  4DYU A;  3Q4Q A;  3E1J A;  1J30 A;  2D5K A;  3AK9 A;  4ZKW A;  2V15 A;  4Z3B A;  2WLU A;  1LKP A;  2FFX J;  3GHQ A;  3H7G A;  4A25 A;  2C2U A;  5IX6 A;  2FHA A;  3EZ0 A;  1LB3 A;  3KXU A;  4DYZ A;  2CN6 A;  2V2L A;  2N02 A;  3BKN A;  2FG8 A;  3PVY A;  3NP2 X;  4TW3 A;  2UX1 A;  2ZUR X;  4LQJ A;  1JI5 A;  4X0J A;  1JKV A;  2OC5 A;  4YKH A;  5D8R A;  5FFC A;  2GYD A;  4ISP A;  4MN9 A;  3OJ5 A;  3MPS A;  5GU1 X;  1IES A;  3QD8 A;  3UOI A;  2IY4 A;  2GYQ A;  3SHX A;  4ETR A;  4EVB A;  3OGH A;  1JTS A;  3JZ9 A;  3KHK A;  3AF8 X;  1Z6O M;  4ZMC A;  4RC7 B;  4M35 A;  1JIG A;  3F33 A;  2VXX A;  5ERJ A;  4II4 A;  1H96 A;  5JAC A;  5LG2 A;  3VVA A;  5CZU A;  2V2I A;  3KX9 A;  4RC5 A;  4EVC A;  2Y44 A;  3IS8 A;  1ZUJ A;  1RYT A;  3WVU A;  3F37 A;  5K53 A;  5D8S A;  3PVR A;  2CLB A;  4ML5 A;  3WVV A;  5HQO A;  3RAV A;  2XJO A;  2RBD A;  1F30 A;  4RC5 B;  3F39 A;  2C2F A;  1F33 A;  4LQN A;  1VEI A;  2XJN A;  2V2S A;  1R03 A;  2YJJ A;  3UOF A;  5CMQ A;  4ITT A;  4YXM A;  3BVL A;  1UVH A;  2X17 0;  3C1Z A;  4EVE A;  2PYB A;  4XGS A;  2CEI A;  4ZL5 A;  2Z90 A;  2YJK A;  2CLU A;  3SE1 A;  4ZKX A;  5FEJ A;  4ERU A;  3RBC A;  4Z5S A;  4M32 A;  4R42 A;  2VZB A;  3GGZ A;  3BVI A;  5JDO B;  5ERK A;  3AK8 A;  4TO9 A;  3GE4 A;  4Y08 A;  1YUX A;  3GGY A;  5HJH A;  2CIH A;  3E1O A;  3KA8 A;  4TOG A;  2MGY A;  1LKO A;  3DBY A;  1XZ1 A;  2FJC A;  1NNQ A;  2Y3Q A;  3F36 A;  5CMR A;  4U3G A;  5GOU A;  1Z4A A;  4TOB A;  3BT5 A;  1UMN A;  3BVF A;  2QQY A;  1TKP A;  2Z5R A;  3E1L A;  4P18 A;  4CMY V;  5LG8 A;  1VEL A;  3IS7 A;  3QHC A;  4CYB A;  2Z6M A;  1JYB A;  3ISF A;  4KVS A;  4W4L B;  1QYB A;  5E2D A;  2V8U A;  4DYY A;  1RCG A;  5GU2 X;  1NFV A;  3R2L A;  3WVW A;  3PW8 C;  3E2C A;  3R2S A;  3FI6 A;  2BK6 A;  5HJF A;  2FG4 A;  4PG1 A;  1N1Q A;  4DI0 A;  4ITW A;  2C2J A;  3KDQ A;  1Z6O A;  4CYA A;  3GVY A;  3TA8 A;  5I4J A;  3UNO A;  1RCE A;  5D8X A;  4W4K B;  1S30 A;  3A68 A;  4TOC A;  2FKZ A;  4QUW A;  1MFR A;  3EGM A;  4RC7 A;  3RD0 A;  1TJO A;  3HL1 A;  4MUD A;  2IU2 A;  3C1Y A;  5E1U A;  3NP0 X;  3Q4O A;  4LYX A;  2CN7 A;  4LPJ A;  5FFD A;  4EVD A;  1VEQ A;  3EZU A;  3AF7 X;  2V2O A;  4ISM A;  2C6R A;  5FFE A;  3RGD A;  3Q4R A;  3QHB A;  2W0O A;  3O7R A;  1RCI A;  2G4H A;  3RE7 A;  1JRE A;  3PW8 A;  1HRS A;  2JD6 0;  3AJQ A;  3C21 A;  4PG0 A;  1JI4 A;  4LQH A;  3FSE A;  2QF9 A;  4CVS A;  1GWG A;  5FFA A;  3E6S A;  4WJG 4;  1VLG A;  5JDO A;  4CVR A;  2BKC A;  1XZ3 A;  1YUZ A;  5LS9 A;  1OTK A;  2GS4 A;  3AF9 X;  5HU6 D;  2AR0 A;  1EUM A;  1VJX A;  4CVP A;  2JD7 0;  1RCD A;  1L8I A;  4CMY A;  1IER A;  3R2R A;  1B71 A;  5J93 A;  5D8P A;  3E1P A;  3FRS A;  4LPM A;  3BVE A;  1BCF A;  3E1Q A;  2ZA6 A;  4ZKH A;  2YW6 A;  4RC8 A;  3SH6 A;  3IQ1 A;  4LQV A;  5D8Q A;  3VV9 A;  1SQ3 A;  3KA6 A;  2CWL A;  3Q4N A;  2YW7 A;  1TKO A;  2V2M A;  2G38 B;  3LKD A;  2XKQ A;  3QB9 A;  2WLA A;  5C6F A; 
#chains in the Genus database with same CATH homology
 3N6O A;  5D8O A;  3F32 A;  2ZG8 X;  2IB0 A;  1NF4 A;  3AJO A;  5FFB A;  4CY9 A;  5JKM G;  3L0M A;  4MXP A;  1BFR A;  3VNX A;  4E40 A;  5JKM A;  2V2N A;  4TOD A;  5GN8 B;  3HIU A;  2HTN A;  5GU3 X;  3R2K A;  2ZA8 A;  4AM5 A;  4AM2 A;  3PWQ C;  4RC6 B;  1YV1 A;  2FL0 A;  3PW1 B;  3E1N A;  4TOA A;  1JKU A;  2ITB A;  4YXJ A;  4ZL6 A;  2V2P A;  1JGC A;  3R2H A;  2OKC A;  4YVZ A;  2C41 A;  2FZF A;  3BVK A;  2HR5 A;  3V3K B;  4IXK A;  4ZTT A;  2VXI A;  4ZLW A;  2CF7 A;  4IWK A;  3E6R A;  5J8W A;  3KA3 A;  4PGK A;  2JD8 0;  1NF6 A;  3SID A;  3ERZ A;  4KVR A;  1SOF A;  3PVY B;  3D19 A;  1L8H A;  4REU A;  3A9Q A;  5GU0 X;  4DAS A;  5K52 A;  1KRQ A;  3U90 A;  3F35 A;  1FHA A;  4M34 A;  1BG7 A;  4E6K A;  3PWQ A;  4IWJ A;  3ISE A;  4TOH A;  3W54 A;  2Z5P A;  2CHP A;  1TK6 A;  4AM4 A;  3E1M A;  2V2R A;  4XKU A;  3PZA A;  4OYN A;  4KXR B;  3JZA B;  4TOF A;  2ZG7 X;  2XGW A;  1S3Q A;  1MOJ A;  3KWO A;  1DAT A;  4II4 B;  4DE6 A;  3AJP A;  3FVB A;  2WWX B;  4CVT A;  5AXS A;  3PVR B;  2ZG9 X;  1AEW A;  2BW1 A;  4LYU A;  4TOE A;  1DPS A;  2V2J A;  3T9J A;  3KA9 A;  5D8Y A;  1LKM A;  4ZJK A;  1O9I A;  3ES3 A;  3FRR A;  1O9R A;  4DYX A;  2F7N A;  3QVD A;  4DZ0 A;  1ZS3 A;  3QZ3 A;  3KA4 A;  4XKS A;  4LPN A;  3R2O A;  3UFB A;  5GN8 A;  5LBH A;  3R2M A;  5JKL G;  4PGI A;  5J8S A;  2V8T A;  4XKT A;  5J9V A;  4RC6 A;  3PW1 A;  5JKL A;  2BJY A;  3PVT A;  2ZA7 A;  4M33 A;  4KVQ A;  1QGH A;  3F34 A;  3WNW A;  1RCC A;  1S2Z A;  1DVB A;  3PWF A;  2OH3 A;  3PVT B;  3NOZ X;  3F38 A;  4MKU A;  4MJY A;  2CHI A;  4MY7 A;  2WTL A;  2XJM A;  3C23 A;  3O7S A;  3M6J A;  2Z5Q A;  4DYU A;  3Q4Q A;  3E1J A;  1J30 A;  2D5K A;  3AK9 A;  4ZKW A;  2V15 A;  4Z3B A;  2WLU A;  1LKP A;  2FFX J;  3GHQ A;  3H7G A;  4A25 A;  2C2U A;  5IX6 A;  2FHA A;  3EZ0 A;  1LB3 A;  3KXU A;  4DYZ A;  2CN6 A;  2V2L A;  2N02 A;  3BKN A;  2FG8 A;  3PVY A;  3NP2 X;  4TW3 A;  2UX1 A;  2ZUR X;  4LQJ A;  1JI5 A;  4X0J A;  1JKV A;  2OC5 A;  4YKH A;  5D8R A;  5FFC A;  2GYD A;  4ISP A;  4MN9 A;  3OJ5 A;  3MPS A;  5GU1 X;  1IES A;  3QD8 A;  3UOI A;  2IY4 A;  2GYQ A;  3SHX A;  4ETR A;  4EVB A;  3OGH A;  1JTS A;  3JZ9 A;  3KHK A;  3AF8 X;  1Z6O M;  4ZMC A;  4RC7 B;  4M35 A;  1JIG A;  3F33 A;  2VXX A;  5ERJ A;  4II4 A;  1H96 A;  5JAC A;  5LG2 A;  3VVA A;  5CZU A;  2V2I A;  3KX9 A;  4RC5 A;  4EVC A;  2Y44 A;  3IS8 A;  1ZUJ A;  1RYT A;  3WVU A;  3F37 A;  5K53 A;  5D8S A;  3PVR A;  2CLB A;  4ML5 A;  3WVV A;  5HQO A;  3RAV A;  2XJO A;  2RBD A;  1F30 A;  4RC5 B;  3F39 A;  2C2F A;  1F33 A;  4LQN A;  1VEI A;  2XJN A;  2V2S A;  1R03 A;  2YJJ A;  3UOF A;  5CMQ A;  4ITT A;  4YXM A;  3BVL A;  1UVH A;  2X17 0;  3C1Z A;  4EVE A;  2PYB A;  4XGS A;  2CEI A;  4ZL5 A;  2Z90 A;  2YJK A;  2CLU A;  3SE1 A;  4ZKX A;  5FEJ A;  4ERU A;  3RBC A;  4Z5S A;  4M32 A;  4R42 A;  2VZB A;  3GGZ A;  3BVI A;  5JDO B;  5ERK A;  3AK8 A;  4TO9 A;  3GE4 A;  4Y08 A;  1YUX A;  3GGY A;  5HJH A;  2CIH A;  3E1O A;  3KA8 A;  4TOG A;  2MGY A;  1LKO A;  3DBY A;  1XZ1 A;  2FJC A;  1NNQ A;  2Y3Q A;  3F36 A;  5CMR A;  4U3G A;  5GOU A;  1Z4A A;  4TOB A;  3BT5 A;  1UMN A;  3BVF A;  2QQY A;  1TKP A;  2Z5R A;  3E1L A;  4P18 A;  4CMY V;  5LG8 A;  1VEL A;  3IS7 A;  3QHC A;  4CYB A;  2Z6M A;  1JYB A;  3ISF A;  4KVS A;  4W4L B;  1QYB A;  5E2D A;  2V8U A;  4DYY A;  1RCG A;  5GU2 X;  1NFV A;  3R2L A;  3WVW A;  3PW8 C;  3E2C A;  3R2S A;  3FI6 A;  2BK6 A;  5HJF A;  2FG4 A;  4PG1 A;  1N1Q A;  4DI0 A;  4ITW A;  2C2J A;  3KDQ A;  1Z6O A;  4CYA A;  3GVY A;  3TA8 A;  5I4J A;  3UNO A;  1RCE A;  5D8X A;  4W4K B;  1S30 A;  3A68 A;  4TOC A;  2FKZ A;  4QUW A;  1MFR A;  3EGM A;  4RC7 A;  3RD0 A;  1TJO A;  3HL1 A;  4MUD A;  2IU2 A;  3C1Y A;  5E1U A;  3NP0 X;  3Q4O A;  4LYX A;  2CN7 A;  4LPJ A;  5FFD A;  4EVD A;  1VEQ A;  3EZU A;  3AF7 X;  2V2O A;  4ISM A;  2C6R A;  5FFE A;  3RGD A;  3Q4R A;  3QHB A;  2W0O A;  3O7R A;  1RCI A;  2G4H A;  3RE7 A;  1JRE A;  3PW8 A;  1HRS A;  2JD6 0;  3AJQ A;  3C21 A;  4PG0 A;  1JI4 A;  4LQH A;  3FSE A;  2QF9 A;  4CVS A;  1GWG A;  5FFA A;  3E6S A;  4WJG 4;  1VLG A;  5JDO A;  4CVR A;  2BKC A;  1XZ3 A;  1YUZ A;  5LS9 A;  1OTK A;  2GS4 A;  3AF9 X;  5HU6 D;  2AR0 A;  1EUM A;  1VJX A;  4CVP A;  2JD7 0;  1RCD A;  1L8I A;  4CMY A;  1IER A;  3R2R A;  1B71 A;  5J93 A;  5D8P A;  3E1P A;  3FRS A;  4LPM A;  3BVE A;  1BCF A;  3E1Q A;  2ZA6 A;  4ZKH A;  2YW6 A;  4RC8 A;  3SH6 A;  3IQ1 A;  4LQV A;  5D8Q A;  3VV9 A;  1SQ3 A;  3KA6 A;  2CWL A;  3Q4N A;  2YW7 A;  1TKO A;  2V2M A;  2G38 B;  3LKD A;  2XKQ A;  3QB9 A;  2WLA A;  5C6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...