1O9RA

The x-ray crystal structure of agrobacterium tumefaciens dps, a member of the family that protect dna without binding
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
162
structure length
162
Chain Sequence
MKTHKTKNDLPSNAKSTVIGILNESLASVIDLALVTKQAHWNLKGPQFIAVHELLDTFRTQLDNHGDTIAERVVQLGGTALGSLQAVSSTTKLKAYPTDIYKIHDHLDALIERYGEVANMIRKAIDDSDEAGDPTTADIFTAASRDLDKSLWFLEAHVQEKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Iron-binding protein
molecule keywords AGROBACTERIUM TUMEFACIENS DPS
publication title The Dps Protein of Agrobacterium Tumefaciens Does not Bind to DNA But Protects It Toward Oxidative Cleavage: X-Ray Crystal Structure, Iron Binding, and Hydroxyl-Radical Scavenging Properties
pubmed doi rcsb
source organism Agrobacterium tumefaciens
total genus 65
structure length 162
sequence length 162
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2002-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1o9rA00
4TW3A 5JKMA 5HJHA 4DYXA 2ZG7X 5J9VA 3E6SA 4CYBA 3EZUA 4LQVA 4EVEA 3R2KA 2Z5RA 3PWQA 1HRSA 3AJOA 4CMYA 2GYQA 2IY4A 1KRQA 1JKUA 4RC6B 2F7NA 1RYTA 2BK6A 4ZKWA 5LG8A 2XJMA 1N1QA 2JD70 4ZKXA 5CMQA 4XKUA 5HQOA 4YKHA 1JI5A 4II4A 1LKPA 2CHIA 1RCDA 2V2MA 5LG2A 4LQJA 4XKTA 1XZ1A 3GHQA 1NNQA 3PWQC 3BVIA 4M34A 4DI0A 3BVFA 3PVRB 2V15A 1IERA 4ITWA 2CHPA 4RC5B 1GWGA 4DYUA 1BFRA 1Z4AA 3H7GA 4ISMA 3NOZX 3F39A 4TOCA 1H96A 5E1UA 5E2DA 5GU0X 3KXUA 2D5KA 3UOFA 4AM4A 3E1MA 4CVPA 3F34A 1NF4A 4LPMA 3O7SA 5GU2X 1LB3A 4PG0A 2ZG8X 3ERZA 1S30A 4ISPA 1NF6A 4Z3BA 4TOAA 4AM2A 4ZL5A 1FHAA 3R2HA 3WVWA 4IWKA 3KWOA 3R2SA 2V2PA 2XJOA 5I4JA 4RC6A 3GE4A 4M35A 4CVSA 3BVEA 5LS9A 3FVBA 1XZ3A 2XGWA 4KVSA 2OH3A 4REUA 2C2UA 2VZBA 1JKVA 2ZURX 2CN7A 1VEIA 2VXIA 3OJ5A 1Z6OM 1QGHA 1JYBA 3PW1A 4PG1A 3PVYA 5FFDA 2FKZA 2BW1A 3TA8A 1R03A 3MPSA 4PGIA 4LQHA 4ZTTA 4PGKA 1LKMA 1NFVA 3RGDA 2XJNA 1Z6OA 4CVRA 4RC5A 2YJJA 4CY9A 5GOUA 3E1PA 1DPSA 2YJKA 3FSEA 2FG8A 2FL0A 3AF8X 3PVTB 4LYUA 4LPJA 4ERUA 1UVHA 2Z5PA 2FG4A 2V2RA 4DYZA 3KX9A 3E1JA 4LQNA 3O7RA 3AJPA 3R2RA 3WVUA 2HR5A 2FZFA 4IXKA 1J30A 1BCFA 4E6KA 4EVBA 1EUMA 3BT5A 5D8OA 3PW1B 3PVYB 5GN8A 2C6RA 2PYBA 4MKUA 4TOHA 1L8HA 5D8RA 3IS7A 4MJYA 5D8YA 4ITTA 2V2SA 5FEJA 4CVTA 2V2LA 4RC7B 2GS4A 2CIHA 1O9RA 3KA4A 3ES3A 2YW7A 4CYAA 1ZUJA 1F30A 4P18A 2Z5QA 3PZAA 1VEQA 2CEIA 3PW8A 3F37A 4TODA 5J93A 5GU3X 3NP0X 2YW6A 1F33A 3E1OA 1JIGA 3PVTA 3KA9A 4AM5A 1DVBA 1JREA 4KVQA 5D8SA 5GN8B 3QZ3A 3QHCA 3NP2X 4TOEA 3PW8C 3F38A 1TKPA 1S2ZA 2WTLA 4TOBA 4TO9A 4LYXA 2FHAA 1RCEA 3WVVA 3F32A 4MUDA 1MFRA 4IWJA 5AXSA 1RCGA 1JI4A 5FFEA 4KVRA 4DYYA 2JD60 5K53A 1YV1A 1UMNA 2G4HA 2V2IA 3SH6A 3QB9A 3EGMA 3SE1A 3VNXA 4ETRA 3Q4NA 4RC7A 2ZA8A 4XGSA 2FFXJ 3SHXA 1DATA 4ZLWA 1ZS3A 3RE7A 5D8XA 4DASA 2Z90A 1VLGA 1O9IA 2XKQA 1TK6A 4ZKHA 5K52A 3IS8A 3E2CA 3F35A 3PWFA 1VELA 3QVDA 5JKLG 3Q4OA 3WNWA 4ZMCA 4MN9A 3E1LA 1YUXA 5FFAA 1YUZA 4RC8A 2RBDA 5CMRA 5GU1X 4LPNA 1BG7A 3F36A 3AF9X 5LBHA 5D8PA 2ITBA 4OYNA 1MOJA 5ERJA 5JKLA 2C2FA 3E6RA 5HJFA 2IB0A 5C6FA 3E1QA 4DZ0A 4Z5SA 1TJOA 2FJCA 3UOIA 3UNOA 5ERKA 2ZA6A 3R2MA 3RD0A 2CLUA 3AJQA 4CMYV 3FI6A 1SQ3A 2BJYA 4MY7A 5J8WA 2V2OA 1AEWA 2IU2A 3R2LA 3RAVA 2QF9A 3BVLA 2Z6MA 3E1NA 2W0OA 4M33A 3Q4RA 5CZUA 2GYDA 3T9JA 3BVKA 5FFCA 4A25A 3HL1A 1B71A 5JACA 3Q4QA 1QYBA 1IESA 1OTKA 5D8QA 1RCIA 1JTSA 1S3QA 2BKCA 4EVCA 4ZL6A 2V2JA 3KA8A 1LKOA 3AK8A 3OGHA 4TOFA 2CLBA 5IX6A 1L8IA 2C2JA 4II4B 3BKNA 2C41A 4M32A 3ISEA 3AF7X 2ZA7A 3ISFA 3KA6A 4DE6A 2JD80 3A9QA 2UX1A 1TKOA 4R42A 4Y08A 3RBCA 4ZJKA 4U3GA 4EVDA 3HIUA 3QHBA 4XKSA 1RCCA 5JKMG 2HTNA 3AK9A 4ML5A 2WLUA 3A68A 2QQYA 2WLAA 2Y3QA 3QD8A 3GVYA 3R2OA 4QUWA 2CN6A 2ZG9X 1VJXA 3EZ0A 3PVRA 5FFBA 2CF7A 3F33A 2X170 5J8SA 3U90A 2VXXA 1JGCA 1SOFA 3SIDA 2OC5A 3KA3A 4TOGA 2V2NA 3IQ1A
chains in the Genus database with same CATH superfamily
4TW3A 5JKMA 5HU6D 5HJHA 4DYXA 2ZG7X 5J9VA 3E6SA 4CYBA 3EZUA 4LQVA 4EVEA 3R2KA 2Z5RA 3PWQA 1HRSA 3AJOA 4CMYA 2GYQA 2IY4A 1KRQA 1JKUA 4RC6B 2CWLA 2F7NA 1RYTA 2BK6A 4ZKWA 5LG8A 2XJMA 1N1QA 2JD70 4ZKXA 5CMQA 4XKUA 5HQOA 4YKHA 1JI5A 4II4A 1LKPA 2V8UA 2CHIA 1RCDA 2V2MA 5LG2A 4LQJA 4XKTA 1XZ1A 3GHQA 1NNQA 3PWQC 3BVIA 4M34A 4DI0A 3BVFA 3PVRB 2V15A 1IERA 4MXPA 4ITWA 2CHPA 4RC5B 1GWGA 4YXJA 4DYUA 1BFRA 1Z4AA 3H7GA 4ISMA 3NOZX 3F39A 4TOCA 1H96A 2OKCA 5E1UA 5E2DA 5GU0X 3KXUA 2D5KA 3UOFA 4AM4A 3E1MA 4CVPA 3F34A 1NF4A 4LPMA 3O7SA 5GU2X 3UFBA 1LB3A 4PG0A 2ZG8X 5JDOB 3ERZA 3JZ9A 2Y44A 1S30A 4ISPA 1NF6A 4YXMA 4Z3BA 3V3KB 4TOAA 4AM2A 2N02A 4ZL5A 1FHAA 3R2HA 3WVWA 4IWKA 3KWOA 3R2SA 3C1ZA 2V2PA 2XJOA 5I4JA 4RC6A 3GE4A 4M35A 4CVSA 3BVEA 5LS9A 3FVBA 1XZ3A 2XGWA 4KVSA 2OH3A 4REUA 2C2UA 2VZBA 1JKVA 2ZURX 2CN7A 1VEIA 2VXIA 3OJ5A 1Z6OM 4KXRB 1QGHA 1JYBA 3PW1A 4PG1A 3PVYA 5FFDA 2FKZA 2BW1A 3TA8A 1R03A 3MPSA 4PGIA 4LQHA 4ZTTA 4PGKA 1LKMA 1NFVA 3RGDA 2XJNA 1Z6OA 4CVRA 4RC5A 2YJJA 4CY9A 5GOUA 3E1PA 1DPSA 2YJKA 3FSEA 2FG8A 2FL0A 4W4LB 3AF8X 3PVTB 2MGYA 4LYUA 4LPJA 4ERUA 1UVHA 2Z5PA 2FG4A 2V2RA 4WJG4 4DYZA 3KX9A 3E1JA 4LQNA 5JDOA 3O7RA 3AJPA 3R2RA 3WVUA 2HR5A 2FZFA 4IXKA 1J30A 1BCFA 4E6KA 2G38B 4EVBA 1EUMA 3BT5A 5D8OA 3PW1B 3PVYB 5GN8A 3VV9A 2C6RA 2PYBA 2AR0A 4MKUA 4TOHA 2V8TA 1L8HA 5D8RA 3IS7A 3FRSA 4MJYA 5D8YA 3VVAA 4ITTA 2V2SA 5FEJA 3GGZA 4CVTA 2V2LA 4RC7B 2GS4A 2CIHA 1O9RA 3KA4A 3ES3A 2YW7A 4CYAA 1ZUJA 1F30A 4P18A 2Z5QA 3PZAA 1VEQA 2CEIA 3PW8A 3F37A 4TODA 5J93A 5GU3X 3NP0X 3KDQA 2YW6A 1F33A 3E1OA 1JIGA 3PVTA 3KA9A 4AM5A 1DVBA 1JREA 3D19A 4KVQA 5D8SA 5GN8B 3QZ3A 3QHCA 3NP2X 4TOEA 3PW8C 3F38A 3W54A 1TKPA 1S2ZA 2WTLA 4TOBA 4TO9A 4LYXA 2FHAA 1RCEA 3WVVA 3F32A 4MUDA 1MFRA 4IWJA 5AXSA 1RCGA 1JI4A 5FFEA 4KVRA 4DYYA 2JD60 5K53A 1YV1A 1UMNA 2G4HA 2V2IA 3GGYA 3SH6A 3QB9A 3EGMA 3SE1A 3VNXA 4ETRA 3Q4NA 4RC7A 2ZA8A 4XGSA 2FFXJ 3SHXA 1DATA 4ZLWA 1ZS3A 3RE7A 5D8XA 4DASA 2Z90A 1VLGA 1O9IA 2XKQA 1TK6A 4ZKHA 3C21A 3IS8A 5K52A 3E2CA 3F35A 3PWFA 1VELA 3QVDA 5JKLG 3C1YA 3Q4OA 3WNWA 4ZMCA 4MN9A 3E1LA 1YUXA 5FFAA 1YUZA 4RC8A 2RBDA 5CMRA 5GU1X 4LPNA 1BG7A 3F36A 3AF9X 5LBHA 5D8PA 2ITBA 4OYNA 1MOJA 5ERJA 5JKLA 2C2FA 3E6RA 5HJFA 2IB0A 5C6FA 3E1QA 4DZ0A 4Z5SA 4X0JA 1TJOA 2FJCA 3UOIA 3UNOA 5ERKA 2ZA6A 3R2MA 3RD0A 2CLUA 3AJQA 4CMYV 3FI6A 1SQ3A 2BJYA 3KHKA 4MY7A 3LKDA 2V2OA 1AEWA 5J8WA 2IU2A 3R2LA 3RAVA 2QF9A 3BVLA 3DBYA 2Z6MA 3E1NA 3C23A 2W0OA 4M33A 3Q4RA 5CZUA 2GYDA 3T9JA 3BVKA 5FFCA 4A25A 3HL1A 1B71A 5JACA 3Q4QA 1QYBA 1IESA 1OTKA 5D8QA 1RCIA 1JTSA 1S3QA 2BKCA 4EVCA 4ZL6A 2V2JA 3KA8A 1LKOA 3AK8A 3OGHA 4TOFA 2CLBA 5IX6A 1L8IA 2C2JA 3N6OA 4II4B 3BKNA 2C41A 4M32A 4YVZA 3ISEA 3AF7X 2ZA7A 3ISFA 3KA6A 3FRRA 4DE6A 2JD80 3A9QA 2UX1A 1TKOA 4R42A 4Y08A 3RBCA 4ZJKA 4U3GA 4EVDA 2WWXB 3M6JA 4E40A 3HIUA 3QHBA 4XKSA 1RCCA 5JKMG 4W4KB 2HTNA 3AK9A 4ML5A 2WLUA 3A68A 2QQYA 2WLAA 2Y3QA 3QD8A 3GVYA 3R2OA 4QUWA 2CN6A 2ZG9X 3JZAB 1VJXA 3EZ0A 3PVRA 5FFBA 3L0MA 2CF7A 3F33A 2X170 5J8SA 3U90A 2VXXA 1JGCA 1SOFA 3SIDA 2OC5A 3KA3A 4TOGA 2V2NA 3IQ1A
chains in the Genus database with same CATH topology
4TW3A 5JKMA 5HU6D 5HJHA 4DYXA 2ZG7X 5J9VA 3E6SA 4CYBA 3EZUA 4LQVA 4EVEA 3R2KA 2Z5RA 3PWQA 1HRSA 3AJOA 4CMYA 2GYQA 2IY4A 1KRQA 1JKUA 4RC6B 2CWLA 2F7NA 1RYTA 2BK6A 4ZKWA 5LG8A 2XJMA 1N1QA 2JD70 4ZKXA 5CMQA 4XKUA 5HQOA 4YKHA 1JI5A 4II4A 1LKPA 2V8UA 2CHIA 1RCDA 2V2MA 5LG2A 4LQJA 4XKTA 1XZ1A 3GHQA 1NNQA 3PWQC 3BVIA 4M34A 4DI0A 3BVFA 3PVRB 2V15A 1IERA 4MXPA 4ITWA 2CHPA 4RC5B 1GWGA 4YXJA 4DYUA 1BFRA 1Z4AA 3H7GA 4ISMA 3NOZX 3F39A 4TOCA 1H96A 2OKCA 5E1UA 5E2DA 5GU0X 3KXUA 2D5KA 3UOFA 4AM4A 3E1MA 4CVPA 3F34A 1NF4A 4LPMA 3O7SA 5GU2X 3UFBA 1LB3A 4PG0A 2ZG8X 5JDOB 3ERZA 3JZ9A 2Y44A 1S30A 4ISPA 1NF6A 4YXMA 4Z3BA 3V3KB 4TOAA 4AM2A 2N02A 4ZL5A 1FHAA 3R2HA 3WVWA 4IWKA 3KWOA 3R2SA 3C1ZA 2V2PA 2XJOA 5I4JA 4RC6A 3GE4A 4M35A 4CVSA 3BVEA 5LS9A 3FVBA 1XZ3A 2XGWA 4KVSA 2OH3A 4REUA 2C2UA 2VZBA 1JKVA 2ZURX 2CN7A 1VEIA 2VXIA 3OJ5A 1Z6OM 4KXRB 1QGHA 1JYBA 3PW1A 4PG1A 3PVYA 5FFDA 2FKZA 2BW1A 3TA8A 1R03A 3MPSA 4PGIA 4LQHA 4ZTTA 4PGKA 1LKMA 1NFVA 3RGDA 2XJNA 1Z6OA 4CVRA 4RC5A 2YJJA 4CY9A 5GOUA 3E1PA 1DPSA 2YJKA 3FSEA 2FG8A 2FL0A 4W4LB 3AF8X 3PVTB 2MGYA 4LYUA 4LPJA 4ERUA 1UVHA 2Z5PA 2FG4A 2V2RA 4WJG4 4DYZA 3KX9A 3E1JA 4LQNA 5JDOA 3O7RA 3AJPA 3R2RA 3WVUA 2HR5A 2FZFA 4IXKA 1J30A 1BCFA 4E6KA 2G38B 4EVBA 1EUMA 3BT5A 5D8OA 3PW1B 3PVYB 5GN8A 3VV9A 2C6RA 2PYBA 2AR0A 4MKUA 4TOHA 2V8TA 1L8HA 5D8RA 3IS7A 3FRSA 4MJYA 5D8YA 3VVAA 4ITTA 2V2SA 5FEJA 3GGZA 4CVTA 2V2LA 4RC7B 2GS4A 2CIHA 1O9RA 3KA4A 3ES3A 2YW7A 4CYAA 1ZUJA 1F30A 4P18A 2Z5QA 3PZAA 1VEQA 2CEIA 3PW8A 3F37A 4TODA 5J93A 5GU3X 3NP0X 3KDQA 2YW6A 1F33A 3E1OA 1JIGA 3PVTA 3KA9A 4AM5A 1DVBA 1JREA 3D19A 4KVQA 5D8SA 5GN8B 3QZ3A 3QHCA 3NP2X 4TOEA 3PW8C 3F38A 3W54A 1TKPA 1S2ZA 2WTLA 4TOBA 4TO9A 4LYXA 2FHAA 1RCEA 3WVVA 3F32A 4MUDA 1MFRA 4IWJA 5AXSA 1RCGA 1JI4A 5FFEA 4KVRA 4DYYA 2JD60 5K53A 1YV1A 1UMNA 2G4HA 2V2IA 3GGYA 3SH6A 3QB9A 3EGMA 3SE1A 3VNXA 4ETRA 3Q4NA 4RC7A 2ZA8A 4XGSA 2FFXJ 3SHXA 1DATA 4ZLWA 1ZS3A 3RE7A 5D8XA 4DASA 2Z90A 1VLGA 1O9IA 2XKQA 1TK6A 4ZKHA 3C21A 3IS8A 5K52A 3E2CA 3F35A 3PWFA 1VELA 3QVDA 5JKLG 3C1YA 3Q4OA 3WNWA 4ZMCA 4MN9A 3E1LA 1YUXA 5FFAA 1YUZA 4RC8A 2RBDA 5CMRA 5GU1X 4LPNA 1BG7A 3F36A 3AF9X 5LBHA 5D8PA 2ITBA 4OYNA 1MOJA 5ERJA 5JKLA 2C2FA 3E6RA 5HJFA 2IB0A 5C6FA 3E1QA 4DZ0A 4Z5SA 4X0JA 1TJOA 2FJCA 3UOIA 3UNOA 5ERKA 2ZA6A 3R2MA 3RD0A 2CLUA 3AJQA 4CMYV 3FI6A 1SQ3A 2BJYA 3KHKA 4MY7A 3LKDA 2V2OA 1AEWA 5J8WA 2IU2A 3R2LA 3RAVA 2QF9A 3BVLA 3DBYA 2Z6MA 3E1NA 3C23A 2W0OA 4M33A 3Q4RA 5CZUA 2GYDA 3T9JA 3BVKA 5FFCA 4A25A 3HL1A 1B71A 5JACA 3Q4QA 1QYBA 1IESA 1OTKA 5D8QA 1RCIA 1JTSA 1S3QA 2BKCA 4EVCA 4ZL6A 2V2JA 3KA8A 1LKOA 3AK8A 3OGHA 4TOFA 2CLBA 5IX6A 1L8IA 2C2JA 3N6OA 4II4B 3BKNA 2C41A 4M32A 4YVZA 3ISEA 3AF7X 2ZA7A 3ISFA 3KA6A 3FRRA 4DE6A 2JD80 3A9QA 2UX1A 1TKOA 4R42A 4Y08A 3RBCA 4ZJKA 4U3GA 4EVDA 2WWXB 3M6JA 4E40A 3HIUA 3QHBA 4XKSA 1RCCA 5JKMG 4W4KB 2HTNA 3AK9A 4ML5A 2WLUA 3A68A 2QQYA 2WLAA 2Y3QA 3QD8A 3GVYA 3R2OA 4QUWA 2CN6A 2ZG9X 3JZAB 1VJXA 3EZ0A 3PVRA 5FFBA 3L0MA 2CF7A 3F33A 2X170 5J8SA 3U90A 2VXXA 1JGCA 1SOFA 3SIDA 2OC5A 3KA3A 4TOGA 2V2NA 3IQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TW3 A;  5JKM A;  5HJH A;  4DYX A;  2ZG7 X;  5J9V A;  3E6S A;  4CYB A;  3EZU A;  4LQV A;  4EVE A;  3R2K A;  2Z5R A;  3PWQ A;  1HRS A;  3AJO A;  4CMY A;  2GYQ A;  2IY4 A;  1KRQ A;  1JKU A;  4RC6 B;  2F7N A;  1RYT A;  2BK6 A;  4ZKW A;  5LG8 A;  2XJM A;  1N1Q A;  2JD7 0;  4ZKX A;  5CMQ A;  4XKU A;  5HQO A;  4YKH A;  1JI5 A;  4II4 A;  1LKP A;  2CHI A;  1RCD A;  2V2M A;  5LG2 A;  4LQJ A;  4XKT A;  1XZ1 A;  3GHQ A;  1NNQ A;  3PWQ C;  3BVI A;  4M34 A;  4DI0 A;  3BVF A;  3PVR B;  2V15 A;  1IER A;  4ITW A;  2CHP A;  4RC5 B;  1GWG A;  4DYU A;  1BFR A;  1Z4A A;  3H7G A;  4ISM A;  3NOZ X;  3F39 A;  4TOC A;  1H96 A;  5E1U A;  5E2D A;  5GU0 X;  3KXU A;  2D5K A;  3UOF A;  4AM4 A;  3E1M A;  4CVP A;  3F34 A;  1NF4 A;  4LPM A;  3O7S A;  5GU2 X;  1LB3 A;  4PG0 A;  2ZG8 X;  3ERZ A;  1S30 A;  4ISP A;  1NF6 A;  4Z3B A;  4TOA A;  4AM2 A;  4ZL5 A;  1FHA A;  3R2H A;  3WVW A;  4IWK A;  3KWO A;  3R2S A;  2V2P A;  2XJO A;  5I4J A;  4RC6 A;  3GE4 A;  4M35 A;  4CVS A;  3BVE A;  5LS9 A;  3FVB A;  1XZ3 A;  2XGW A;  4KVS A;  2OH3 A;  4REU A;  2C2U A;  2VZB A;  1JKV A;  2ZUR X;  2CN7 A;  1VEI A;  2VXI A;  3OJ5 A;  1Z6O M;  1QGH A;  1JYB A;  3PW1 A;  4PG1 A;  3PVY A;  5FFD A;  2FKZ A;  2BW1 A;  3TA8 A;  1R03 A;  3MPS A;  4PGI A;  4LQH A;  4ZTT A;  4PGK A;  1LKM A;  1NFV A;  3RGD A;  2XJN A;  1Z6O A;  4CVR A;  4RC5 A;  2YJJ A;  4CY9 A;  5GOU A;  3E1P A;  1DPS A;  2YJK A;  3FSE A;  2FG8 A;  2FL0 A;  3AF8 X;  3PVT B;  4LYU A;  4LPJ A;  4ERU A;  1UVH A;  2Z5P A;  2FG4 A;  2V2R A;  4DYZ A;  3KX9 A;  3E1J A;  4LQN A;  3O7R A;  3AJP A;  3R2R A;  3WVU A;  2HR5 A;  2FZF A;  4IXK A;  1J30 A;  1BCF A;  4E6K A;  4EVB A;  1EUM A;  3BT5 A;  5D8O A;  3PW1 B;  3PVY B;  5GN8 A;  2C6R A;  2PYB A;  4MKU A;  4TOH A;  1L8H A;  5D8R A;  3IS7 A;  4MJY A;  5D8Y A;  4ITT A;  2V2S A;  5FEJ A;  4CVT A;  2V2L A;  4RC7 B;  2GS4 A;  2CIH A;  1O9R A;  3KA4 A;  3ES3 A;  2YW7 A;  4CYA A;  1ZUJ A;  1F30 A;  4P18 A;  2Z5Q A;  3PZA A;  1VEQ A;  2CEI A;  3PW8 A;  3F37 A;  4TOD A;  5J93 A;  5GU3 X;  3NP0 X;  2YW6 A;  1F33 A;  3E1O A;  1JIG A;  3PVT A;  3KA9 A;  4AM5 A;  1DVB A;  1JRE A;  4KVQ A;  5D8S A;  5GN8 B;  3QZ3 A;  3QHC A;  3NP2 X;  4TOE A;  3PW8 C;  3F38 A;  1TKP A;  1S2Z A;  2WTL A;  4TOB A;  4TO9 A;  4LYX A;  2FHA A;  1RCE A;  3WVV A;  3F32 A;  4MUD A;  1MFR A;  4IWJ A;  5AXS A;  1RCG A;  1JI4 A;  5FFE A;  4KVR A;  4DYY A;  2JD6 0;  5K53 A;  1YV1 A;  1UMN A;  2G4H A;  2V2I A;  3SH6 A;  3QB9 A;  3EGM A;  3SE1 A;  3VNX A;  4ETR A;  3Q4N A;  4RC7 A;  2ZA8 A;  4XGS A;  2FFX J;  3SHX A;  1DAT A;  4ZLW A;  1ZS3 A;  3RE7 A;  5D8X A;  4DAS A;  2Z90 A;  1VLG A;  1O9I A;  2XKQ A;  1TK6 A;  4ZKH A;  5K52 A;  3IS8 A;  3E2C A;  3F35 A;  3PWF A;  1VEL A;  3QVD A;  5JKL G;  3Q4O A;  3WNW A;  4ZMC A;  4MN9 A;  3E1L A;  1YUX A;  5FFA A;  1YUZ A;  4RC8 A;  2RBD A;  5CMR A;  5GU1 X;  4LPN A;  1BG7 A;  3F36 A;  3AF9 X;  5LBH A;  5D8P A;  2ITB A;  4OYN A;  1MOJ A;  5ERJ A;  5JKL A;  2C2F A;  3E6R A;  5HJF A;  2IB0 A;  5C6F A;  3E1Q A;  4DZ0 A;  4Z5S A;  1TJO A;  2FJC A;  3UOI A;  3UNO A;  5ERK A;  2ZA6 A;  3R2M A;  3RD0 A;  2CLU A;  3AJQ A;  4CMY V;  3FI6 A;  1SQ3 A;  2BJY A;  4MY7 A;  5J8W A;  2V2O A;  1AEW A;  2IU2 A;  3R2L A;  3RAV A;  2QF9 A;  3BVL A;  2Z6M A;  3E1N A;  2W0O A;  4M33 A;  3Q4R A;  5CZU A;  2GYD A;  3T9J A;  3BVK A;  5FFC A;  4A25 A;  3HL1 A;  1B71 A;  5JAC A;  3Q4Q A;  1QYB A;  1IES A;  1OTK A;  5D8Q A;  1RCI A;  1JTS A;  1S3Q A;  2BKC A;  4EVC A;  4ZL6 A;  2V2J A;  3KA8 A;  1LKO A;  3AK8 A;  3OGH A;  4TOF A;  2CLB A;  5IX6 A;  1L8I A;  2C2J A;  4II4 B;  3BKN A;  2C41 A;  4M32 A;  3ISE A;  3AF7 X;  2ZA7 A;  3ISF A;  3KA6 A;  4DE6 A;  2JD8 0;  3A9Q A;  2UX1 A;  1TKO A;  4R42 A;  4Y08 A;  3RBC A;  4ZJK A;  4U3G A;  4EVD A;  3HIU A;  3QHB A;  4XKS A;  1RCC A;  5JKM G;  2HTN A;  3AK9 A;  4ML5 A;  2WLU A;  3A68 A;  2QQY A;  2WLA A;  2Y3Q A;  3QD8 A;  3GVY A;  3R2O A;  4QUW A;  2CN6 A;  2ZG9 X;  1VJX A;  3EZ0 A;  3PVR A;  5FFB A;  2CF7 A;  3F33 A;  2X17 0;  5J8S A;  3U90 A;  2VXX A;  1JGC A;  1SOF A;  3SID A;  2OC5 A;  3KA3 A;  4TOG A;  2V2N A;  3IQ1 A; 
#chains in the Genus database with same CATH topology
 4TW3 A;  5JKM A;  5HU6 D;  5HJH A;  4DYX A;  2ZG7 X;  5J9V A;  3E6S A;  4CYB A;  3EZU A;  4LQV A;  4EVE A;  3R2K A;  2Z5R A;  3PWQ A;  1HRS A;  3AJO A;  4CMY A;  2GYQ A;  2IY4 A;  1KRQ A;  1JKU A;  4RC6 B;  2CWL A;  2F7N A;  1RYT A;  2BK6 A;  4ZKW A;  5LG8 A;  2XJM A;  1N1Q A;  2JD7 0;  4ZKX A;  5CMQ A;  4XKU A;  5HQO A;  4YKH A;  1JI5 A;  4II4 A;  1LKP A;  2V8U A;  2CHI A;  1RCD A;  2V2M A;  5LG2 A;  4LQJ A;  4XKT A;  1XZ1 A;  3GHQ A;  1NNQ A;  3PWQ C;  3BVI A;  4M34 A;  4DI0 A;  3BVF A;  3PVR B;  2V15 A;  1IER A;  4MXP A;  4ITW A;  2CHP A;  4RC5 B;  1GWG A;  4YXJ A;  4DYU A;  1BFR A;  1Z4A A;  3H7G A;  4ISM A;  3NOZ X;  3F39 A;  4TOC A;  1H96 A;  2OKC A;  5E1U A;  5E2D A;  5GU0 X;  3KXU A;  2D5K A;  3UOF A;  4AM4 A;  3E1M A;  4CVP A;  3F34 A;  1NF4 A;  4LPM A;  3O7S A;  5GU2 X;  3UFB A;  1LB3 A;  4PG0 A;  2ZG8 X;  5JDO B;  3ERZ A;  3JZ9 A;  2Y44 A;  1S30 A;  4ISP A;  1NF6 A;  4YXM A;  4Z3B A;  3V3K B;  4TOA A;  4AM2 A;  2N02 A;  4ZL5 A;  1FHA A;  3R2H A;  3WVW A;  4IWK A;  3KWO A;  3R2S A;  3C1Z A;  2V2P A;  2XJO A;  5I4J A;  4RC6 A;  3GE4 A;  4M35 A;  4CVS A;  3BVE A;  5LS9 A;  3FVB A;  1XZ3 A;  2XGW A;  4KVS A;  2OH3 A;  4REU A;  2C2U A;  2VZB A;  1JKV A;  2ZUR X;  2CN7 A;  1VEI A;  2VXI A;  3OJ5 A;  1Z6O M;  4KXR B;  1QGH A;  1JYB A;  3PW1 A;  4PG1 A;  3PVY A;  5FFD A;  2FKZ A;  2BW1 A;  3TA8 A;  1R03 A;  3MPS A;  4PGI A;  4LQH A;  4ZTT A;  4PGK A;  1LKM A;  1NFV A;  3RGD A;  2XJN A;  1Z6O A;  4CVR A;  4RC5 A;  2YJJ A;  4CY9 A;  5GOU A;  3E1P A;  1DPS A;  2YJK A;  3FSE A;  2FG8 A;  2FL0 A;  4W4L B;  3AF8 X;  3PVT B;  2MGY A;  4LYU A;  4LPJ A;  4ERU A;  1UVH A;  2Z5P A;  2FG4 A;  2V2R A;  4WJG 4;  4DYZ A;  3KX9 A;  3E1J A;  4LQN A;  5JDO A;  3O7R A;  3AJP A;  3R2R A;  3WVU A;  2HR5 A;  2FZF A;  4IXK A;  1J30 A;  1BCF A;  4E6K A;  2G38 B;  4EVB A;  1EUM A;  3BT5 A;  5D8O A;  3PW1 B;  3PVY B;  5GN8 A;  3VV9 A;  2C6R A;  2PYB A;  2AR0 A;  4MKU A;  4TOH A;  2V8T A;  1L8H A;  5D8R A;  3IS7 A;  3FRS A;  4MJY A;  5D8Y A;  3VVA A;  4ITT A;  2V2S A;  5FEJ A;  3GGZ A;  4CVT A;  2V2L A;  4RC7 B;  2GS4 A;  2CIH A;  1O9R A;  3KA4 A;  3ES3 A;  2YW7 A;  4CYA A;  1ZUJ A;  1F30 A;  4P18 A;  2Z5Q A;  3PZA A;  1VEQ A;  2CEI A;  3PW8 A;  3F37 A;  4TOD A;  5J93 A;  5GU3 X;  3NP0 X;  3KDQ A;  2YW6 A;  1F33 A;  3E1O A;  1JIG A;  3PVT A;  3KA9 A;  4AM5 A;  1DVB A;  1JRE A;  3D19 A;  4KVQ A;  5D8S A;  5GN8 B;  3QZ3 A;  3QHC A;  3NP2 X;  4TOE A;  3PW8 C;  3F38 A;  3W54 A;  1TKP A;  1S2Z A;  2WTL A;  4TOB A;  4TO9 A;  4LYX A;  2FHA A;  1RCE A;  3WVV A;  3F32 A;  4MUD A;  1MFR A;  4IWJ A;  5AXS A;  1RCG A;  1JI4 A;  5FFE A;  4KVR A;  4DYY A;  2JD6 0;  5K53 A;  1YV1 A;  1UMN A;  2G4H A;  2V2I A;  3GGY A;  3SH6 A;  3QB9 A;  3EGM A;  3SE1 A;  3VNX A;  4ETR A;  3Q4N A;  4RC7 A;  2ZA8 A;  4XGS A;  2FFX J;  3SHX A;  1DAT A;  4ZLW A;  1ZS3 A;  3RE7 A;  5D8X A;  4DAS A;  2Z90 A;  1VLG A;  1O9I A;  2XKQ A;  1TK6 A;  4ZKH A;  3C21 A;  3IS8 A;  5K52 A;  3E2C A;  3F35 A;  3PWF A;  1VEL A;  3QVD A;  5JKL G;  3C1Y A;  3Q4O A;  3WNW A;  4ZMC A;  4MN9 A;  3E1L A;  1YUX A;  5FFA A;  1YUZ A;  4RC8 A;  2RBD A;  5CMR A;  5GU1 X;  4LPN A;  1BG7 A;  3F36 A;  3AF9 X;  5LBH A;  5D8P A;  2ITB A;  4OYN A;  1MOJ A;  5ERJ A;  5JKL A;  2C2F A;  3E6R A;  5HJF A;  2IB0 A;  5C6F A;  3E1Q A;  4DZ0 A;  4Z5S A;  4X0J A;  1TJO A;  2FJC A;  3UOI A;  3UNO A;  5ERK A;  2ZA6 A;  3R2M A;  3RD0 A;  2CLU A;  3AJQ A;  4CMY V;  3FI6 A;  1SQ3 A;  2BJY A;  3KHK A;  4MY7 A;  3LKD A;  2V2O A;  1AEW A;  5J8W A;  2IU2 A;  3R2L A;  3RAV A;  2QF9 A;  3BVL A;  3DBY A;  2Z6M A;  3E1N A;  3C23 A;  2W0O A;  4M33 A;  3Q4R A;  5CZU A;  2GYD A;  3T9J A;  3BVK A;  5FFC A;  4A25 A;  3HL1 A;  1B71 A;  5JAC A;  3Q4Q A;  1QYB A;  1IES A;  1OTK A;  5D8Q A;  1RCI A;  1JTS A;  1S3Q A;  2BKC A;  4EVC A;  4ZL6 A;  2V2J A;  3KA8 A;  1LKO A;  3AK8 A;  3OGH A;  4TOF A;  2CLB A;  5IX6 A;  1L8I A;  2C2J A;  3N6O A;  4II4 B;  3BKN A;  2C41 A;  4M32 A;  4YVZ A;  3ISE A;  3AF7 X;  2ZA7 A;  3ISF A;  3KA6 A;  3FRR A;  4DE6 A;  2JD8 0;  3A9Q A;  2UX1 A;  1TKO A;  4R42 A;  4Y08 A;  3RBC A;  4ZJK A;  4U3G A;  4EVD A;  2WWX B;  3M6J A;  4E40 A;  3HIU A;  3QHB A;  4XKS A;  1RCC A;  5JKM G;  4W4K B;  2HTN A;  3AK9 A;  4ML5 A;  2WLU A;  3A68 A;  2QQY A;  2WLA A;  2Y3Q A;  3QD8 A;  3GVY A;  3R2O A;  4QUW A;  2CN6 A;  2ZG9 X;  3JZA B;  1VJX A;  3EZ0 A;  3PVR A;  5FFB A;  3L0M A;  2CF7 A;  3F33 A;  2X17 0;  5J8S A;  3U90 A;  2VXX A;  1JGC A;  1SOF A;  3SID A;  2OC5 A;  3KA3 A;  4TOG A;  2V2N A;  3IQ1 A; 
#chains in the Genus database with same CATH homology
 4TW3 A;  5JKM A;  5HU6 D;  5HJH A;  4DYX A;  2ZG7 X;  5J9V A;  3E6S A;  4CYB A;  3EZU A;  4LQV A;  4EVE A;  3R2K A;  2Z5R A;  3PWQ A;  1HRS A;  3AJO A;  4CMY A;  2GYQ A;  2IY4 A;  1KRQ A;  1JKU A;  4RC6 B;  2CWL A;  2F7N A;  1RYT A;  2BK6 A;  4ZKW A;  5LG8 A;  2XJM A;  1N1Q A;  2JD7 0;  4ZKX A;  5CMQ A;  4XKU A;  5HQO A;  4YKH A;  1JI5 A;  4II4 A;  1LKP A;  2V8U A;  2CHI A;  1RCD A;  2V2M A;  5LG2 A;  4LQJ A;  4XKT A;  1XZ1 A;  3GHQ A;  1NNQ A;  3PWQ C;  3BVI A;  4M34 A;  4DI0 A;  3BVF A;  3PVR B;  2V15 A;  1IER A;  4MXP A;  4ITW A;  2CHP A;  4RC5 B;  1GWG A;  4YXJ A;  4DYU A;  1BFR A;  1Z4A A;  3H7G A;  4ISM A;  3NOZ X;  3F39 A;  4TOC A;  1H96 A;  2OKC A;  5E1U A;  5E2D A;  5GU0 X;  3KXU A;  2D5K A;  3UOF A;  4AM4 A;  3E1M A;  4CVP A;  3F34 A;  1NF4 A;  4LPM A;  3O7S A;  5GU2 X;  3UFB A;  1LB3 A;  4PG0 A;  2ZG8 X;  5JDO B;  3ERZ A;  3JZ9 A;  2Y44 A;  1S30 A;  4ISP A;  1NF6 A;  4YXM A;  4Z3B A;  3V3K B;  4TOA A;  4AM2 A;  2N02 A;  4ZL5 A;  1FHA A;  3R2H A;  3WVW A;  4IWK A;  3KWO A;  3R2S A;  3C1Z A;  2V2P A;  2XJO A;  5I4J A;  4RC6 A;  3GE4 A;  4M35 A;  4CVS A;  3BVE A;  5LS9 A;  3FVB A;  1XZ3 A;  2XGW A;  4KVS A;  2OH3 A;  4REU A;  2C2U A;  2VZB A;  1JKV A;  2ZUR X;  2CN7 A;  1VEI A;  2VXI A;  3OJ5 A;  1Z6O M;  4KXR B;  1QGH A;  1JYB A;  3PW1 A;  4PG1 A;  3PVY A;  5FFD A;  2FKZ A;  2BW1 A;  3TA8 A;  1R03 A;  3MPS A;  4PGI A;  4LQH A;  4ZTT A;  4PGK A;  1LKM A;  1NFV A;  3RGD A;  2XJN A;  1Z6O A;  4CVR A;  4RC5 A;  2YJJ A;  4CY9 A;  5GOU A;  3E1P A;  1DPS A;  2YJK A;  3FSE A;  2FG8 A;  2FL0 A;  4W4L B;  3AF8 X;  3PVT B;  2MGY A;  4LYU A;  4LPJ A;  4ERU A;  1UVH A;  2Z5P A;  2FG4 A;  2V2R A;  4WJG 4;  4DYZ A;  3KX9 A;  3E1J A;  4LQN A;  5JDO A;  3O7R A;  3AJP A;  3R2R A;  3WVU A;  2HR5 A;  2FZF A;  4IXK A;  1J30 A;  1BCF A;  4E6K A;  2G38 B;  4EVB A;  1EUM A;  3BT5 A;  5D8O A;  3PW1 B;  3PVY B;  5GN8 A;  3VV9 A;  2C6R A;  2PYB A;  2AR0 A;  4MKU A;  4TOH A;  2V8T A;  1L8H A;  5D8R A;  3IS7 A;  3FRS A;  4MJY A;  5D8Y A;  3VVA A;  4ITT A;  2V2S A;  5FEJ A;  3GGZ A;  4CVT A;  2V2L A;  4RC7 B;  2GS4 A;  2CIH A;  1O9R A;  3KA4 A;  3ES3 A;  2YW7 A;  4CYA A;  1ZUJ A;  1F30 A;  4P18 A;  2Z5Q A;  3PZA A;  1VEQ A;  2CEI A;  3PW8 A;  3F37 A;  4TOD A;  5J93 A;  5GU3 X;  3NP0 X;  3KDQ A;  2YW6 A;  1F33 A;  3E1O A;  1JIG A;  3PVT A;  3KA9 A;  4AM5 A;  1DVB A;  1JRE A;  3D19 A;  4KVQ A;  5D8S A;  5GN8 B;  3QZ3 A;  3QHC A;  3NP2 X;  4TOE A;  3PW8 C;  3F38 A;  3W54 A;  1TKP A;  1S2Z A;  2WTL A;  4TOB A;  4TO9 A;  4LYX A;  2FHA A;  1RCE A;  3WVV A;  3F32 A;  4MUD A;  1MFR A;  4IWJ A;  5AXS A;  1RCG A;  1JI4 A;  5FFE A;  4KVR A;  4DYY A;  2JD6 0;  5K53 A;  1YV1 A;  1UMN A;  2G4H A;  2V2I A;  3GGY A;  3SH6 A;  3QB9 A;  3EGM A;  3SE1 A;  3VNX A;  4ETR A;  3Q4N A;  4RC7 A;  2ZA8 A;  4XGS A;  2FFX J;  3SHX A;  1DAT A;  4ZLW A;  1ZS3 A;  3RE7 A;  5D8X A;  4DAS A;  2Z90 A;  1VLG A;  1O9I A;  2XKQ A;  1TK6 A;  4ZKH A;  3C21 A;  3IS8 A;  5K52 A;  3E2C A;  3F35 A;  3PWF A;  1VEL A;  3QVD A;  5JKL G;  3C1Y A;  3Q4O A;  3WNW A;  4ZMC A;  4MN9 A;  3E1L A;  1YUX A;  5FFA A;  1YUZ A;  4RC8 A;  2RBD A;  5CMR A;  5GU1 X;  4LPN A;  1BG7 A;  3F36 A;  3AF9 X;  5LBH A;  5D8P A;  2ITB A;  4OYN A;  1MOJ A;  5ERJ A;  5JKL A;  2C2F A;  3E6R A;  5HJF A;  2IB0 A;  5C6F A;  3E1Q A;  4DZ0 A;  4Z5S A;  4X0J A;  1TJO A;  2FJC A;  3UOI A;  3UNO A;  5ERK A;  2ZA6 A;  3R2M A;  3RD0 A;  2CLU A;  3AJQ A;  4CMY V;  3FI6 A;  1SQ3 A;  2BJY A;  3KHK A;  4MY7 A;  3LKD A;  2V2O A;  1AEW A;  5J8W A;  2IU2 A;  3R2L A;  3RAV A;  2QF9 A;  3BVL A;  3DBY A;  2Z6M A;  3E1N A;  3C23 A;  2W0O A;  4M33 A;  3Q4R A;  5CZU A;  2GYD A;  3T9J A;  3BVK A;  5FFC A;  4A25 A;  3HL1 A;  1B71 A;  5JAC A;  3Q4Q A;  1QYB A;  1IES A;  1OTK A;  5D8Q A;  1RCI A;  1JTS A;  1S3Q A;  2BKC A;  4EVC A;  4ZL6 A;  2V2J A;  3KA8 A;  1LKO A;  3AK8 A;  3OGH A;  4TOF A;  2CLB A;  5IX6 A;  1L8I A;  2C2J A;  3N6O A;  4II4 B;  3BKN A;  2C41 A;  4M32 A;  4YVZ A;  3ISE A;  3AF7 X;  2ZA7 A;  3ISF A;  3KA6 A;  3FRR A;  4DE6 A;  2JD8 0;  3A9Q A;  2UX1 A;  1TKO A;  4R42 A;  4Y08 A;  3RBC A;  4ZJK A;  4U3G A;  4EVD A;  2WWX B;  3M6J A;  4E40 A;  3HIU A;  3QHB A;  4XKS A;  1RCC A;  5JKM G;  4W4K B;  2HTN A;  3AK9 A;  4ML5 A;  2WLU A;  3A68 A;  2QQY A;  2WLA A;  2Y3Q A;  3QD8 A;  3GVY A;  3R2O A;  4QUW A;  2CN6 A;  2ZG9 X;  3JZA B;  1VJX A;  3EZ0 A;  3PVR A;  5FFB A;  3L0M A;  2CF7 A;  3F33 A;  2X17 0;  5J8S A;  3U90 A;  2VXX A;  1JGC A;  1SOF A;  3SID A;  2OC5 A;  3KA3 A;  4TOG A;  2V2N A;  3IQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...