1O9RA

The x-ray crystal structure of agrobacterium tumefaciens dps, a member of the family that protect dna without binding
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
162
structure length
162
Chain Sequence
b'MKTHKTKNDLPSNAKSTVIGILNESLASVIDLALVTKQAHWNLKGPQFIAVHELLDTFRTQLDNHGDTIAERVVQLGGTALGSLQAVSSTTKLKAYPTDIYKIHDHLDALIERYGEVANMIRKAIDDSDEAGDPTTADIFTAASRDLDKSLWFLEAHVQEKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AGROBACTERIUM TUMEFACIENS DPS
publication title The Dps Protein of Agrobacterium Tumefaciens Does not Bind to DNA But Protects It Toward Oxidative Cleavage: X-Ray Crystal Structure, Iron Binding, and Hydroxyl-Radical Scavenging Properties
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Iron-binding protein
total genus 65
structure length 162
sequence length 162
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2002-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1o9rA00
1QYBA 3F35A 4PG0A 4II4A 4II4B 1TK6A 2ZA6A 2X170 3PZAA 5GU0X 4ZKWA 2HTNA 3RGDA 1NF4A 2GYQA 2W0OA 3PVYA 3PVYB 2YW7A 5D8YA 4IXKA 3T9JA 4TOBA 1VLGA 2IU2A 5C6FA 3ISEA 1OTKA 5FEJA 4LQVA 1L8IA 5D8PA 2XJMA 5JKLA 1XZ1A 3QVDA 2XKQA 2V2LA 1S2ZA 2FKZA 3E6SA 4CVSA 4EVBA 1Z6OM 3R2HA 4LQNA 3R2RA 5J8SA 4CVPA 3AF7X 1BCFA 1TKPA 4M33A 2Z90A 4Z3BA 3SIDA 1Z4AA 1VEQA 4XKUA 4ITWA 1TKOA 3E1LA 1J30A 5GU3X 3F39A 1IESA 4LYUA 2IB0A 2CN7A 2OH3A 1R03A 5FFDA 1KRQA 1O9IA 5I4JA 4ZTTA 4KVSA 2C2JA 3PW1A 1RCDA 3PW1B 3AF8X 4DE6A 5ERJA 3Q4NA 4ETRA 4KVQA 2Z5QA 4PG1A 1FHAA 2BKCA 3AK9A 3Q4RA 1JI5A 3AJQA 3QHCA 2WLAA 1BFRA 4TW3A 4LQJA 4TOHA 3SHXA 3E1JA 2YJJA 1JI4A 3O7SA 3PW8C 3SH6A 2VXIA 3R2SA 2D5KA 5CZUA 1H96A 4ZMCA 5FFCA 2WLUA 3KX9A 3PVRA 2V2OA 3GE4A 3PVRB 3ES3A 2C6RA 3TA8A 4ZJKA 1L8HA 2XJNA 4PGKA 2ZG9X 4MUDA 2CEIA 1JKVA 3BVIA 3UOIA 5IX6A 3GHQA 1RYTA 4U3GA 4M34A 1RCIA 3IQ1A 1B71A 4CYAA 1YUZA 4ZLWA 2JD80 3PWQA 3E1NA 4CVTA 3KA6A 3O7RA 3R2LA 3U90A 4CYBA 3R2KA 1ZUJA 4LPJA 1EUMA 1IERA 4REUA 3KA4A 5FFAA 4ISMA 5FFBA 3MPSA 4DASA 2HR5A 3AF9X 3BT5A 1MOJA 1O9RA 3AJOA 3EZUA 4OYNA 5D8RA 3F32A 3OGHA 3BVKA 4XKSA 4ZKHA 3FSEA 5JKMG 2V2SA 3NP2X 4XGSA 1JIGA 5GOUA 1JTSA 1Z6OA 4ZL5A 3PVTA 3PWQC 3WVVA 1VELA 2UX1A 2CN6A 4EVCA 1JKUA 5GN8A 1RCGA 5CMQA 5GN8B 4IWKA 1BG7A 4LPMA 4RC7A 3RAVA 4RC7B 2C41A 3E1OA 4CVRA 1HRSA 5GU2X 2CF7A 4EVEA 4DZ0A 4TOAA 4DYYA 2C2UA 3E1PA 1DVBA 4ISPA 4RC8A 2V2IA 5D8XA 5D8OA 1SOFA 3UOFA 5LBHA 5LS9A 3A68A 2XGWA 1GWGA 3NOZX 3KWOA 1S30A 2BW1A 3ISFA 1TJOA 1RCEA 3Q4OA 5CMRA 4ITTA 5J9VA 3OJ5A 2G4HA 5K53A 1JYBA 1S3QA 4IWJA 3KA3A 4M35A 4P18A 4AM2A 3BKNA 4MKUA 2ZG7X 2FG8A 4CMYV 2CIHA 1AEWA 5ERKA 3GVYA 1DPSA 2ZG8X 3WVUA 2V15A 1YUXA 2FFXJ 2GS4A 2BJYA 2JD60 4LQHA 2Z5PA 2V2MA 3VNXA 2CHPA 2XJOA 3QD8A 1QGHA 2V2PA 2VZBA 3H7GA 1YV1A 2IY4A 1JGCA 2V2RA 3QHBA 4Y08A 1LKMA 3Q4QA 4TOEA 2FG4A 2RBDA 5JKLG 1UVHA 2WTLA 3WVWA 5LG2A 4LPNA 4YKHA 1JREA 3FVBA 2Y3QA 3E6RA 3KA8A 4TOGA 5LG8A 5K52A 3HIUA 3A9QA 4M32A 3KA9A 1NFVA 4QUWA 2Z5RA 3E2CA 2F7NA 1XZ3A 3PVTB 2GYDA 4TOFA 4ERUA 3EGMA 4Z5SA 1VJXA 4AM5A 1LKOA 2ZA7A 5D8SA 3WNWA 5HJHA 3BVLA 1LB3A 2FL0A 3RD0A 5J8WA 4RC5A 2CLBA 2CLUA 5AXSA 2YW6A 4RC5B 1N1QA 4LYXA 4CMYA 2BK6A 2ZURX 3EZ0A 5JKMA 4A25A 3UNOA 3QB9A 3R2OA 3F37A 3PWFA 4MN9A 3IS7A 3AJPA 4AM4A 3R2MA 3E1MA 3HL1A 4CY9A 3FI6A 2FJCA 3IS8A 2VXXA 4ZL6A 5JACA 4R42A 5HQOA 3E1QA 4DI0A 3F34A 4TOCA 3RBCA 3F36A 1NNQA 5FFEA 5GU1X 2V2JA 3PW8A 5D8QA 2PYBA 2FZFA 4RC6A 2Z6MA 1F30A 4RC6B 4TO9A 1NF6A 3F33A 2ZA8A 5J93A 3F38A 2C2FA 4PGIA 5E1UA 4TODA 2V2NA 2QF9A 3BVFA 1UMNA 3AK8A 4ML5A 5HJFA 5E2DA 1DATA 1LKPA 2JD70 4DYZA 4MJYA 2CHIA 1F33A 1VEIA 2ITBA 4XKTA 4DYUA 1RCCA 3NP0X 3BVEA 3KXUA 3QZ3A 4MY7A 3ERZA 1ZS3A 4EVDA 2FHAA 2QQYA 2OC5A 4E6KA 2YJKA 4ZKXA 3RE7A 1MFRA 3SE1A 4KVRA 4DYXA 1SQ3A
chains in the Genus database with same CATH superfamily
1QYBA 3F35A 4PG0A 4II4A 4II4B 1TK6A 2ZA6A 3GGYA 2X170 3PZAA 5GU0X 4ZKWA 2HTNA 3RGDA 1NF4A 2GYQA 2W0OA 3PVYA 3PVYB 2YW7A 5D8YA 4IXKA 3T9JA 4TOBA 1VLGA 2IU2A 5C6FA 3ISEA 1OTKA 5FEJA 4LQVA 1L8IA 5D8PA 3C1ZA 2XJMA 5JKLA 1XZ1A 3JZ9A 3QVDA 2V8TA 2XKQA 2V2LA 3GGZA 1S2ZA 2CWLA 2FKZA 3E6SA 4CVSA 4EVBA 1Z6OM 3R2HA 4LQNA 3R2RA 4E40A 5J8SA 4CVPA 3AF7X 4W4LB 1BCFA 1TKPA 4M33A 2Z90A 4Z3BA 3SIDA 1Z4AA 1VEQA 4XKUA 4ITWA 1TKOA 3E1LA 1J30A 5GU3X 3F39A 1IESA 4LYUA 2IB0A 2CN7A 2OH3A 4YXJA 1R03A 5FFDA 1KRQA 1O9IA 5I4JA 4ZTTA 4KVSA 2C2JA 3PW1A 1RCDA 3PW1B 3AF8X 4DE6A 5ERJA 3Q4NA 4ETRA 4KVQA 2Z5QA 3D19A 4PG1A 1FHAA 2BKCA 3AK9A 3Q4RA 1JI5A 2V8UA 3AJQA 3QHCA 2WLAA 1BFRA 4TW3A 4LQJA 4TOHA 3SHXA 3E1JA 2YJJA 1JI4A 3O7SA 3PW8C 3SH6A 2VXIA 3R2SA 2D5KA 5CZUA 1H96A 4ZMCA 5FFCA 2WLUA 3KX9A 4YXMA 3PVRA 2V2OA 3GE4A 3PVRB 3ES3A 2C6RA 3TA8A 4ZJKA 1L8HA 2XJNA 4PGKA 2ZG9X 4MUDA 2CEIA 1JKVA 3BVIA 3UOIA 5IX6A 3GHQA 1RYTA 4U3GA 4M34A 1RCIA 3IQ1A 1B71A 4CYAA 1YUZA 4ZLWA 2JD80 4W4KB 3PWQA 3E1NA 4CVTA 3KA6A 3O7RA 3R2LA 3U90A 4CYBA 3R2KA 1ZUJA 4LPJA 1EUMA 1IERA 4REUA 3KA4A 5FFAA 4ISMA 5FFBA 3MPSA 4DASA 2HR5A 3AF9X 3BT5A 1MOJA 1O9RA 3AJOA 3EZUA 4OYNA 5D8RA 3F32A 3OGHA 3BVKA 4XKSA 4ZKHA 3FSEA 3DBYA 5JKMG 2V2SA 3NP2X 4XGSA 1JIGA 5GOUA 1JTSA 4MXPA 1Z6OA 4ZL5A 3PVTA 3PWQC 3WVVA 3N6OA 1VELA 2UX1A 2CN6A 4EVCA 1JKUA 3C21A 5GN8A 1RCGA 5CMQA 5GN8B 4IWKA 1BG7A 4LPMA 4RC7A 3RAVA 4RC7B 4YVZA 3C1YA 2C41A 3E1OA 4CVRA 1HRSA 5GU2X 2CF7A 4EVEA 4DZ0A 4TOAA 4DYYA 2C2UA 3JZAB 3E1PA 5HU6D 1DVBA 4ISPA 4RC8A 2V2IA 5D8XA 5D8OA 1SOFA 3UOFA 5LBHA 5LS9A 3A68A 2XGWA 1GWGA 3NOZX 3KWOA 1S30A 2BW1A 2Y44A 3ISFA 1TJOA 2AR0A 1RCEA 3Q4OA 5CMRA 4ITTA 5J9VA 3VV9A 3OJ5A 2G4HA 5JDOA 5K53A 5JDOB 1JYBA 1S3QA 4IWJA 3KA3A 4M35A 4P18A 3VVAA 4AM2A 3BKNA 4MKUA 2ZG7X 2FG8A 4CMYV 2CIHA 1AEWA 5ERKA 3GVYA 1DPSA 2ZG8X 3WVUA 2V15A 1YUXA 2FFXJ 2GS4A 2BJYA 2JD60 3C23A 4LQHA 2Z5PA 3LKDA 2V2MA 3VNXA 2CHPA 2XJOA 3QD8A 1QGHA 2V2PA 2VZBA 3H7GA 1YV1A 2IY4A 1JGCA 2V2RA 3KDQA 3QHBA 3W54A 4Y08A 1LKMA 3Q4QA 4TOEA 2FG4A 2RBDA 5JKLG 1UVHA 2WTLA 3KHKA 3WVWA 5LG2A 4LPNA 2N02A 4YKHA 1JREA 3FVBA 2Y3QA 3E6RA 3KA8A 3L0MA 4TOGA 5LG8A 5K52A 3HIUA 3A9QA 4M32A 3KA9A 1NFVA 4QUWA 2Z5RA 3E2CA 4KVRA 2F7NA 1XZ3A 3PVTB 2GYDA 4TOFA 3FRRA 4ERUA 3EGMA 4Z5SA 1VJXA 4AM5A 1LKOA 2ZA7A 5D8SA 3WNWA 5HJHA 3BVLA 1LB3A 2FL0A 3V3KB 3RD0A 5J8WA 4RC5A 2CLBA 2CLUA 5AXSA 2YW6A 4RC5B 1N1QA 4LYXA 4CMYA 2BK6A 2ZURX 3EZ0A 5JKMA 4A25A 3UNOA 3QB9A 3R2OA 3F37A 3PWFA 4MN9A 3IS7A 3AJPA 4AM4A 3R2MA 3E1MA 3HL1A 4CY9A 3UFBA 3FI6A 2FJCA 3IS8A 2VXXA 4ZL6A 5JACA 4R42A 5HQOA 3E1QA 4DI0A 3F34A 4TOCA 3RBCA 3F36A 1NNQA 5FFEA 3M6JA 5GU1X 2V2JA 3PW8A 5D8QA 2PYBA 2FZFA 4RC6A 2Z6MA 1F30A 4RC6B 4TO9A 1NF6A 3FRSA 3F33A 5J93A 3F38A 2C2FA 4PGIA 5E1UA 4KXRB 4TODA 2V2NA 2G38B 2QF9A 3BVFA 4X0JA 1UMNA 2MGYA 3AK8A 4ML5A 5HJFA 5E2DA 1DATA 1LKPA 2JD70 4DYZA 4MJYA 2CHIA 1F33A 1VEIA 2ITBA 4XKTA 4DYUA 1RCCA 3NP0X 3BVEA 3KXUA 3QZ3A 4MY7A 2WWXB 3ERZA 1ZS3A 4EVDA 2FHAA 4WJG4 2QQYA 2OC5A 4E6KA 2YJKA 4ZKXA 3RE7A 1MFRA 3SE1A 2OKCA 2ZA8A 4DYXA 1SQ3A
chains in the Genus database with same CATH topology
1QYBA 3F35A 4PG0A 4II4A 4II4B 1TK6A 2ZA6A 3GGYA 2X170 3PZAA 5GU0X 4ZKWA 2HTNA 3RGDA 1NF4A 2GYQA 2W0OA 3PVYA 3PVYB 2YW7A 5D8YA 4IXKA 3T9JA 4TOBA 1VLGA 2IU2A 5C6FA 3ISEA 1OTKA 5FEJA 4LQVA 1L8IA 5D8PA 3C1ZA 2XJMA 5JKLA 1XZ1A 3JZ9A 3QVDA 2V8TA 2XKQA 2V2LA 3GGZA 1S2ZA 2CWLA 2FKZA 3E6SA 4CVSA 4EVBA 1Z6OM 3R2HA 4LQNA 3R2RA 4E40A 5J8SA 4CVPA 3AF7X 4W4LB 1BCFA 1TKPA 4M33A 2Z90A 4Z3BA 3SIDA 1Z4AA 1VEQA 4XKUA 4ITWA 1TKOA 3E1LA 1J30A 5GU3X 3F39A 1IESA 4LYUA 2IB0A 2CN7A 2OH3A 4YXJA 1R03A 5FFDA 1KRQA 1O9IA 5I4JA 4ZTTA 4KVSA 2C2JA 3PW1A 1RCDA 3PW1B 3AF8X 4DE6A 5ERJA 3Q4NA 4ETRA 4KVQA 2Z5QA 3D19A 4PG1A 1FHAA 2BKCA 3AK9A 3Q4RA 1JI5A 2V8UA 3AJQA 3QHCA 2WLAA 1BFRA 4TW3A 4LQJA 4TOHA 3SHXA 3E1JA 2YJJA 1JI4A 3O7SA 3PW8C 3SH6A 2VXIA 3R2SA 2D5KA 5CZUA 1H96A 4ZMCA 5FFCA 2WLUA 3KX9A 4YXMA 3PVRA 2V2OA 3GE4A 3PVRB 3ES3A 2C6RA 3TA8A 4ZJKA 1L8HA 2XJNA 4PGKA 2ZG9X 4MUDA 2CEIA 1JKVA 3BVIA 3UOIA 5IX6A 3GHQA 1RYTA 4U3GA 4M34A 1RCIA 3IQ1A 1B71A 4CYAA 1YUZA 4ZLWA 2JD80 4W4KB 3PWQA 3E1NA 4CVTA 3KA6A 3O7RA 3R2LA 3U90A 4CYBA 3R2KA 1ZUJA 4LPJA 1EUMA 1IERA 4REUA 3KA4A 5FFAA 4ISMA 5FFBA 3MPSA 4DASA 2HR5A 3AF9X 3BT5A 1MOJA 1O9RA 3AJOA 3EZUA 4OYNA 5D8RA 3F32A 3OGHA 3BVKA 4XKSA 4ZKHA 3FSEA 3DBYA 5JKMG 2V2SA 3NP2X 4XGSA 1JIGA 5GOUA 1JTSA 4MXPA 1Z6OA 4ZL5A 3PVTA 3PWQC 3WVVA 3N6OA 1VELA 2UX1A 2CN6A 4EVCA 1JKUA 3C21A 5GN8A 1RCGA 5CMQA 5GN8B 4IWKA 1BG7A 4LPMA 4RC7A 3RAVA 4RC7B 4YVZA 3C1YA 2C41A 3E1OA 4CVRA 1HRSA 5GU2X 2CF7A 4EVEA 4DZ0A 4TOAA 4DYYA 2C2UA 3JZAB 3E1PA 5HU6D 1DVBA 4ISPA 4RC8A 2V2IA 5D8XA 5D8OA 1SOFA 3UOFA 5LBHA 5LS9A 3A68A 2XGWA 1GWGA 3NOZX 3KWOA 1S30A 2BW1A 2Y44A 3ISFA 1TJOA 2AR0A 1RCEA 3Q4OA 5CMRA 4ITTA 5J9VA 3VV9A 3OJ5A 2G4HA 5JDOA 5K53A 5JDOB 1JYBA 1S3QA 4IWJA 3KA3A 4M35A 4P18A 3VVAA 4AM2A 3BKNA 4MKUA 2ZG7X 2FG8A 4CMYV 2CIHA 1AEWA 5ERKA 3GVYA 1DPSA 2ZG8X 3WVUA 2V15A 1YUXA 2FFXJ 2GS4A 2BJYA 2JD60 3C23A 4LQHA 2Z5PA 3LKDA 2V2MA 3VNXA 2CHPA 2XJOA 3QD8A 1QGHA 2V2PA 2VZBA 3H7GA 1YV1A 2IY4A 1JGCA 2V2RA 3KDQA 3QHBA 3W54A 4Y08A 1LKMA 3Q4QA 4TOEA 2FG4A 2RBDA 5JKLG 1UVHA 2WTLA 3KHKA 3WVWA 5LG2A 4LPNA 2N02A 4YKHA 1JREA 3FVBA 2Y3QA 3E6RA 3KA8A 3L0MA 4TOGA 5LG8A 5K52A 3HIUA 3A9QA 4M32A 3KA9A 1NFVA 4QUWA 2Z5RA 3E2CA 4KVRA 2F7NA 1XZ3A 3PVTB 2GYDA 4TOFA 3FRRA 4ERUA 3EGMA 4Z5SA 1VJXA 4AM5A 1LKOA 2ZA7A 5D8SA 3WNWA 5HJHA 3BVLA 1LB3A 2FL0A 3V3KB 3RD0A 5J8WA 4RC5A 2CLBA 2CLUA 5AXSA 2YW6A 4RC5B 1N1QA 4LYXA 4CMYA 2BK6A 2ZURX 3EZ0A 5JKMA 4A25A 3UNOA 3QB9A 3R2OA 3F37A 3PWFA 4MN9A 3IS7A 3AJPA 4AM4A 3R2MA 3E1MA 3HL1A 4CY9A 3UFBA 3FI6A 2FJCA 3IS8A 2VXXA 4ZL6A 5JACA 4R42A 5HQOA 3E1QA 4DI0A 3F34A 4TOCA 3RBCA 3F36A 1NNQA 5FFEA 3M6JA 5GU1X 2V2JA 3PW8A 5D8QA 2PYBA 2FZFA 4RC6A 2Z6MA 1F30A 4RC6B 4TO9A 1NF6A 3FRSA 3F33A 5J93A 3F38A 2C2FA 4PGIA 5E1UA 4KXRB 4TODA 2V2NA 2G38B 2QF9A 3BVFA 4X0JA 1UMNA 2MGYA 3AK8A 4ML5A 5HJFA 5E2DA 1DATA 1LKPA 2JD70 4DYZA 4MJYA 2CHIA 1F33A 1VEIA 2ITBA 4XKTA 4DYUA 1RCCA 3NP0X 3BVEA 3KXUA 3QZ3A 4MY7A 2WWXB 3ERZA 1ZS3A 4EVDA 2FHAA 4WJG4 2QQYA 2OC5A 4E6KA 2YJKA 4ZKXA 3RE7A 1MFRA 3SE1A 2OKCA 2ZA8A 4DYXA 1SQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QYB A;  3F35 A;  4PG0 A;  4II4 A;  4II4 B;  1TK6 A;  2ZA6 A;  2X17 0;  3PZA A;  5GU0 X;  4ZKW A;  2HTN A;  3RGD A;  1NF4 A;  2GYQ A;  2W0O A;  3PVY A;  3PVY B;  2YW7 A;  5D8Y A;  4IXK A;  3T9J A;  4TOB A;  1VLG A;  2IU2 A;  5C6F A;  3ISE A;  1OTK A;  5FEJ A;  4LQV A;  1L8I A;  5D8P A;  2XJM A;  5JKL A;  1XZ1 A;  3QVD A;  2XKQ A;  2V2L A;  1S2Z A;  2FKZ A;  3E6S A;  4CVS A;  4EVB A;  1Z6O M;  3R2H A;  4LQN A;  3R2R A;  5J8S A;  4CVP A;  3AF7 X;  1BCF A;  1TKP A;  4M33 A;  2Z90 A;  4Z3B A;  3SID A;  1Z4A A;  1VEQ A;  4XKU A;  4ITW A;  1TKO A;  3E1L A;  1J30 A;  5GU3 X;  3F39 A;  1IES A;  4LYU A;  2IB0 A;  2CN7 A;  2OH3 A;  1R03 A;  5FFD A;  1KRQ A;  1O9I A;  5I4J A;  4ZTT A;  4KVS A;  2C2J A;  3PW1 A;  1RCD A;  3PW1 B;  3AF8 X;  4DE6 A;  5ERJ A;  3Q4N A;  4ETR A;  4KVQ A;  2Z5Q A;  4PG1 A;  1FHA A;  2BKC A;  3AK9 A;  3Q4R A;  1JI5 A;  3AJQ A;  3QHC A;  2WLA A;  1BFR A;  4TW3 A;  4LQJ A;  4TOH A;  3SHX A;  3E1J A;  2YJJ A;  1JI4 A;  3O7S A;  3PW8 C;  3SH6 A;  2VXI A;  3R2S A;  2D5K A;  5CZU A;  1H96 A;  4ZMC A;  5FFC A;  2WLU A;  3KX9 A;  3PVR A;  2V2O A;  3GE4 A;  3PVR B;  3ES3 A;  2C6R A;  3TA8 A;  4ZJK A;  1L8H A;  2XJN A;  4PGK A;  2ZG9 X;  4MUD A;  2CEI A;  1JKV A;  3BVI A;  3UOI A;  5IX6 A;  3GHQ A;  1RYT A;  4U3G A;  4M34 A;  1RCI A;  3IQ1 A;  1B71 A;  4CYA A;  1YUZ A;  4ZLW A;  2JD8 0;  3PWQ A;  3E1N A;  4CVT A;  3KA6 A;  3O7R A;  3R2L A;  3U90 A;  4CYB A;  3R2K A;  1ZUJ A;  4LPJ A;  1EUM A;  1IER A;  4REU A;  3KA4 A;  5FFA A;  4ISM A;  5FFB A;  3MPS A;  4DAS A;  2HR5 A;  3AF9 X;  3BT5 A;  1MOJ A;  1O9R A;  3AJO A;  3EZU A;  4OYN A;  5D8R A;  3F32 A;  3OGH A;  3BVK A;  4XKS A;  4ZKH A;  3FSE A;  5JKM G;  2V2S A;  3NP2 X;  4XGS A;  1JIG A;  5GOU A;  1JTS A;  1Z6O A;  4ZL5 A;  3PVT A;  3PWQ C;  3WVV A;  1VEL A;  2UX1 A;  2CN6 A;  4EVC A;  1JKU A;  5GN8 A;  1RCG A;  5CMQ A;  5GN8 B;  4IWK A;  1BG7 A;  4LPM A;  4RC7 A;  3RAV A;  4RC7 B;  2C41 A;  3E1O A;  4CVR A;  1HRS A;  5GU2 X;  2CF7 A;  4EVE A;  4DZ0 A;  4TOA A;  4DYY A;  2C2U A;  3E1P A;  1DVB A;  4ISP A;  4RC8 A;  2V2I A;  5D8X A;  5D8O A;  1SOF A;  3UOF A;  5LBH A;  5LS9 A;  3A68 A;  2XGW A;  1GWG A;  3NOZ X;  3KWO A;  1S30 A;  2BW1 A;  3ISF A;  1TJO A;  1RCE A;  3Q4O A;  5CMR A;  4ITT A;  5J9V A;  3OJ5 A;  2G4H A;  5K53 A;  1JYB A;  1S3Q A;  4IWJ A;  3KA3 A;  4M35 A;  4P18 A;  4AM2 A;  3BKN A;  4MKU A;  2ZG7 X;  2FG8 A;  4CMY V;  2CIH A;  1AEW A;  5ERK A;  3GVY A;  1DPS A;  2ZG8 X;  3WVU A;  2V15 A;  1YUX A;  2FFX J;  2GS4 A;  2BJY A;  2JD6 0;  4LQH A;  2Z5P A;  2V2M A;  3VNX A;  2CHP A;  2XJO A;  3QD8 A;  1QGH A;  2V2P A;  2VZB A;  3H7G A;  1YV1 A;  2IY4 A;  1JGC A;  2V2R A;  3QHB A;  4Y08 A;  1LKM A;  3Q4Q A;  4TOE A;  2FG4 A;  2RBD A;  5JKL G;  1UVH A;  2WTL A;  3WVW A;  5LG2 A;  4LPN A;  4YKH A;  1JRE A;  3FVB A;  2Y3Q A;  3E6R A;  3KA8 A;  4TOG A;  5LG8 A;  5K52 A;  3HIU A;  3A9Q A;  4M32 A;  3KA9 A;  1NFV A;  4QUW A;  2Z5R A;  3E2C A;  2F7N A;  1XZ3 A;  3PVT B;  2GYD A;  4TOF A;  4ERU A;  3EGM A;  4Z5S A;  1VJX A;  4AM5 A;  1LKO A;  2ZA7 A;  5D8S A;  3WNW A;  5HJH A;  3BVL A;  1LB3 A;  2FL0 A;  3RD0 A;  5J8W A;  4RC5 A;  2CLB A;  2CLU A;  5AXS A;  2YW6 A;  4RC5 B;  1N1Q A;  4LYX A;  4CMY A;  2BK6 A;  2ZUR X;  3EZ0 A;  5JKM A;  4A25 A;  3UNO A;  3QB9 A;  3R2O A;  3F37 A;  3PWF A;  4MN9 A;  3IS7 A;  3AJP A;  4AM4 A;  3R2M A;  3E1M A;  3HL1 A;  4CY9 A;  3FI6 A;  2FJC A;  3IS8 A;  2VXX A;  4ZL6 A;  5JAC A;  4R42 A;  5HQO A;  3E1Q A;  4DI0 A;  3F34 A;  4TOC A;  3RBC A;  3F36 A;  1NNQ A;  5FFE A;  5GU1 X;  2V2J A;  3PW8 A;  5D8Q A;  2PYB A;  2FZF A;  4RC6 A;  2Z6M A;  1F30 A;  4RC6 B;  4TO9 A;  1NF6 A;  3F33 A;  2ZA8 A;  5J93 A;  3F38 A;  2C2F A;  4PGI A;  5E1U A;  4TOD A;  2V2N A;  2QF9 A;  3BVF A;  1UMN A;  3AK8 A;  4ML5 A;  5HJF A;  5E2D A;  1DAT A;  1LKP A;  2JD7 0;  4DYZ A;  4MJY A;  2CHI A;  1F33 A;  1VEI A;  2ITB A;  4XKT A;  4DYU A;  1RCC A;  3NP0 X;  3BVE A;  3KXU A;  3QZ3 A;  4MY7 A;  3ERZ A;  1ZS3 A;  4EVD A;  2FHA A;  2QQY A;  2OC5 A;  4E6K A;  2YJK A;  4ZKX A;  3RE7 A;  1MFR A;  3SE1 A;  4KVR A;  4DYX A;  1SQ3 A; 
#chains in the Genus database with same CATH topology
 1QYB A;  3F35 A;  4PG0 A;  4II4 A;  4II4 B;  1TK6 A;  2ZA6 A;  3GGY A;  2X17 0;  3PZA A;  5GU0 X;  4ZKW A;  2HTN A;  3RGD A;  1NF4 A;  2GYQ A;  2W0O A;  3PVY A;  3PVY B;  2YW7 A;  5D8Y A;  4IXK A;  3T9J A;  4TOB A;  1VLG A;  2IU2 A;  5C6F A;  3ISE A;  1OTK A;  5FEJ A;  4LQV A;  1L8I A;  5D8P A;  3C1Z A;  2XJM A;  5JKL A;  1XZ1 A;  3JZ9 A;  3QVD A;  2V8T A;  2XKQ A;  2V2L A;  3GGZ A;  1S2Z A;  2CWL A;  2FKZ A;  3E6S A;  4CVS A;  4EVB A;  1Z6O M;  3R2H A;  4LQN A;  3R2R A;  4E40 A;  5J8S A;  4CVP A;  3AF7 X;  4W4L B;  1BCF A;  1TKP A;  4M33 A;  2Z90 A;  4Z3B A;  3SID A;  1Z4A A;  1VEQ A;  4XKU A;  4ITW A;  1TKO A;  3E1L A;  1J30 A;  5GU3 X;  3F39 A;  1IES A;  4LYU A;  2IB0 A;  2CN7 A;  2OH3 A;  4YXJ A;  1R03 A;  5FFD A;  1KRQ A;  1O9I A;  5I4J A;  4ZTT A;  4KVS A;  2C2J A;  3PW1 A;  1RCD A;  3PW1 B;  3AF8 X;  4DE6 A;  5ERJ A;  3Q4N A;  4ETR A;  4KVQ A;  2Z5Q A;  3D19 A;  4PG1 A;  1FHA A;  2BKC A;  3AK9 A;  3Q4R A;  1JI5 A;  2V8U A;  3AJQ A;  3QHC A;  2WLA A;  1BFR A;  4TW3 A;  4LQJ A;  4TOH A;  3SHX A;  3E1J A;  2YJJ A;  1JI4 A;  3O7S A;  3PW8 C;  3SH6 A;  2VXI A;  3R2S A;  2D5K A;  5CZU A;  1H96 A;  4ZMC A;  5FFC A;  2WLU A;  3KX9 A;  4YXM A;  3PVR A;  2V2O A;  3GE4 A;  3PVR B;  3ES3 A;  2C6R A;  3TA8 A;  4ZJK A;  1L8H A;  2XJN A;  4PGK A;  2ZG9 X;  4MUD A;  2CEI A;  1JKV A;  3BVI A;  3UOI A;  5IX6 A;  3GHQ A;  1RYT A;  4U3G A;  4M34 A;  1RCI A;  3IQ1 A;  1B71 A;  4CYA A;  1YUZ A;  4ZLW A;  2JD8 0;  4W4K B;  3PWQ A;  3E1N A;  4CVT A;  3KA6 A;  3O7R A;  3R2L A;  3U90 A;  4CYB A;  3R2K A;  1ZUJ A;  4LPJ A;  1EUM A;  1IER A;  4REU A;  3KA4 A;  5FFA A;  4ISM A;  5FFB A;  3MPS A;  4DAS A;  2HR5 A;  3AF9 X;  3BT5 A;  1MOJ A;  1O9R A;  3AJO A;  3EZU A;  4OYN A;  5D8R A;  3F32 A;  3OGH A;  3BVK A;  4XKS A;  4ZKH A;  3FSE A;  3DBY A;  5JKM G;  2V2S A;  3NP2 X;  4XGS A;  1JIG A;  5GOU A;  1JTS A;  4MXP A;  1Z6O A;  4ZL5 A;  3PVT A;  3PWQ C;  3WVV A;  3N6O A;  1VEL A;  2UX1 A;  2CN6 A;  4EVC A;  1JKU A;  3C21 A;  5GN8 A;  1RCG A;  5CMQ A;  5GN8 B;  4IWK A;  1BG7 A;  4LPM A;  4RC7 A;  3RAV A;  4RC7 B;  4YVZ A;  3C1Y A;  2C41 A;  3E1O A;  4CVR A;  1HRS A;  5GU2 X;  2CF7 A;  4EVE A;  4DZ0 A;  4TOA A;  4DYY A;  2C2U A;  3JZA B;  3E1P A;  5HU6 D;  1DVB A;  4ISP A;  4RC8 A;  2V2I A;  5D8X A;  5D8O A;  1SOF A;  3UOF A;  5LBH A;  5LS9 A;  3A68 A;  2XGW A;  1GWG A;  3NOZ X;  3KWO A;  1S30 A;  2BW1 A;  2Y44 A;  3ISF A;  1TJO A;  2AR0 A;  1RCE A;  3Q4O A;  5CMR A;  4ITT A;  5J9V A;  3VV9 A;  3OJ5 A;  2G4H A;  5JDO A;  5K53 A;  5JDO B;  1JYB A;  1S3Q A;  4IWJ A;  3KA3 A;  4M35 A;  4P18 A;  3VVA A;  4AM2 A;  3BKN A;  4MKU A;  2ZG7 X;  2FG8 A;  4CMY V;  2CIH A;  1AEW A;  5ERK A;  3GVY A;  1DPS A;  2ZG8 X;  3WVU A;  2V15 A;  1YUX A;  2FFX J;  2GS4 A;  2BJY A;  2JD6 0;  3C23 A;  4LQH A;  2Z5P A;  3LKD A;  2V2M A;  3VNX A;  2CHP A;  2XJO A;  3QD8 A;  1QGH A;  2V2P A;  2VZB A;  3H7G A;  1YV1 A;  2IY4 A;  1JGC A;  2V2R A;  3KDQ A;  3QHB A;  3W54 A;  4Y08 A;  1LKM A;  3Q4Q A;  4TOE A;  2FG4 A;  2RBD A;  5JKL G;  1UVH A;  2WTL A;  3KHK A;  3WVW A;  5LG2 A;  4LPN A;  2N02 A;  4YKH A;  1JRE A;  3FVB A;  2Y3Q A;  3E6R A;  3KA8 A;  3L0M A;  4TOG A;  5LG8 A;  5K52 A;  3HIU A;  3A9Q A;  4M32 A;  3KA9 A;  1NFV A;  4QUW A;  2Z5R A;  3E2C A;  4KVR A;  2F7N A;  1XZ3 A;  3PVT B;  2GYD A;  4TOF A;  3FRR A;  4ERU A;  3EGM A;  4Z5S A;  1VJX A;  4AM5 A;  1LKO A;  2ZA7 A;  5D8S A;  3WNW A;  5HJH A;  3BVL A;  1LB3 A;  2FL0 A;  3V3K B;  3RD0 A;  5J8W A;  4RC5 A;  2CLB A;  2CLU A;  5AXS A;  2YW6 A;  4RC5 B;  1N1Q A;  4LYX A;  4CMY A;  2BK6 A;  2ZUR X;  3EZ0 A;  5JKM A;  4A25 A;  3UNO A;  3QB9 A;  3R2O A;  3F37 A;  3PWF A;  4MN9 A;  3IS7 A;  3AJP A;  4AM4 A;  3R2M A;  3E1M A;  3HL1 A;  4CY9 A;  3UFB A;  3FI6 A;  2FJC A;  3IS8 A;  2VXX A;  4ZL6 A;  5JAC A;  4R42 A;  5HQO A;  3E1Q A;  4DI0 A;  3F34 A;  4TOC A;  3RBC A;  3F36 A;  1NNQ A;  5FFE A;  3M6J A;  5GU1 X;  2V2J A;  3PW8 A;  5D8Q A;  2PYB A;  2FZF A;  4RC6 A;  2Z6M A;  1F30 A;  4RC6 B;  4TO9 A;  1NF6 A;  3FRS A;  3F33 A;  5J93 A;  3F38 A;  2C2F A;  4PGI A;  5E1U A;  4KXR B;  4TOD A;  2V2N A;  2G38 B;  2QF9 A;  3BVF A;  4X0J A;  1UMN A;  2MGY A;  3AK8 A;  4ML5 A;  5HJF A;  5E2D A;  1DAT A;  1LKP A;  2JD7 0;  4DYZ A;  4MJY A;  2CHI A;  1F33 A;  1VEI A;  2ITB A;  4XKT A;  4DYU A;  1RCC A;  3NP0 X;  3BVE A;  3KXU A;  3QZ3 A;  4MY7 A;  2WWX B;  3ERZ A;  1ZS3 A;  4EVD A;  2FHA A;  4WJG 4;  2QQY A;  2OC5 A;  4E6K A;  2YJK A;  4ZKX A;  3RE7 A;  1MFR A;  3SE1 A;  2OKC A;  2ZA8 A;  4DYX A;  1SQ3 A; 
#chains in the Genus database with same CATH homology
 1QYB A;  3F35 A;  4PG0 A;  4II4 A;  4II4 B;  1TK6 A;  2ZA6 A;  3GGY A;  2X17 0;  3PZA A;  5GU0 X;  4ZKW A;  2HTN A;  3RGD A;  1NF4 A;  2GYQ A;  2W0O A;  3PVY A;  3PVY B;  2YW7 A;  5D8Y A;  4IXK A;  3T9J A;  4TOB A;  1VLG A;  2IU2 A;  5C6F A;  3ISE A;  1OTK A;  5FEJ A;  4LQV A;  1L8I A;  5D8P A;  3C1Z A;  2XJM A;  5JKL A;  1XZ1 A;  3JZ9 A;  3QVD A;  2V8T A;  2XKQ A;  2V2L A;  3GGZ A;  1S2Z A;  2CWL A;  2FKZ A;  3E6S A;  4CVS A;  4EVB A;  1Z6O M;  3R2H A;  4LQN A;  3R2R A;  4E40 A;  5J8S A;  4CVP A;  3AF7 X;  4W4L B;  1BCF A;  1TKP A;  4M33 A;  2Z90 A;  4Z3B A;  3SID A;  1Z4A A;  1VEQ A;  4XKU A;  4ITW A;  1TKO A;  3E1L A;  1J30 A;  5GU3 X;  3F39 A;  1IES A;  4LYU A;  2IB0 A;  2CN7 A;  2OH3 A;  4YXJ A;  1R03 A;  5FFD A;  1KRQ A;  1O9I A;  5I4J A;  4ZTT A;  4KVS A;  2C2J A;  3PW1 A;  1RCD A;  3PW1 B;  3AF8 X;  4DE6 A;  5ERJ A;  3Q4N A;  4ETR A;  4KVQ A;  2Z5Q A;  3D19 A;  4PG1 A;  1FHA A;  2BKC A;  3AK9 A;  3Q4R A;  1JI5 A;  2V8U A;  3AJQ A;  3QHC A;  2WLA A;  1BFR A;  4TW3 A;  4LQJ A;  4TOH A;  3SHX A;  3E1J A;  2YJJ A;  1JI4 A;  3O7S A;  3PW8 C;  3SH6 A;  2VXI A;  3R2S A;  2D5K A;  5CZU A;  1H96 A;  4ZMC A;  5FFC A;  2WLU A;  3KX9 A;  4YXM A;  3PVR A;  2V2O A;  3GE4 A;  3PVR B;  3ES3 A;  2C6R A;  3TA8 A;  4ZJK A;  1L8H A;  2XJN A;  4PGK A;  2ZG9 X;  4MUD A;  2CEI A;  1JKV A;  3BVI A;  3UOI A;  5IX6 A;  3GHQ A;  1RYT A;  4U3G A;  4M34 A;  1RCI A;  3IQ1 A;  1B71 A;  4CYA A;  1YUZ A;  4ZLW A;  2JD8 0;  4W4K B;  3PWQ A;  3E1N A;  4CVT A;  3KA6 A;  3O7R A;  3R2L A;  3U90 A;  4CYB A;  3R2K A;  1ZUJ A;  4LPJ A;  1EUM A;  1IER A;  4REU A;  3KA4 A;  5FFA A;  4ISM A;  5FFB A;  3MPS A;  4DAS A;  2HR5 A;  3AF9 X;  3BT5 A;  1MOJ A;  1O9R A;  3AJO A;  3EZU A;  4OYN A;  5D8R A;  3F32 A;  3OGH A;  3BVK A;  4XKS A;  4ZKH A;  3FSE A;  3DBY A;  5JKM G;  2V2S A;  3NP2 X;  4XGS A;  1JIG A;  5GOU A;  1JTS A;  4MXP A;  1Z6O A;  4ZL5 A;  3PVT A;  3PWQ C;  3WVV A;  3N6O A;  1VEL A;  2UX1 A;  2CN6 A;  4EVC A;  1JKU A;  3C21 A;  5GN8 A;  1RCG A;  5CMQ A;  5GN8 B;  4IWK A;  1BG7 A;  4LPM A;  4RC7 A;  3RAV A;  4RC7 B;  4YVZ A;  3C1Y A;  2C41 A;  3E1O A;  4CVR A;  1HRS A;  5GU2 X;  2CF7 A;  4EVE A;  4DZ0 A;  4TOA A;  4DYY A;  2C2U A;  3JZA B;  3E1P A;  5HU6 D;  1DVB A;  4ISP A;  4RC8 A;  2V2I A;  5D8X A;  5D8O A;  1SOF A;  3UOF A;  5LBH A;  5LS9 A;  3A68 A;  2XGW A;  1GWG A;  3NOZ X;  3KWO A;  1S30 A;  2BW1 A;  2Y44 A;  3ISF A;  1TJO A;  2AR0 A;  1RCE A;  3Q4O A;  5CMR A;  4ITT A;  5J9V A;  3VV9 A;  3OJ5 A;  2G4H A;  5JDO A;  5K53 A;  5JDO B;  1JYB A;  1S3Q A;  4IWJ A;  3KA3 A;  4M35 A;  4P18 A;  3VVA A;  4AM2 A;  3BKN A;  4MKU A;  2ZG7 X;  2FG8 A;  4CMY V;  2CIH A;  1AEW A;  5ERK A;  3GVY A;  1DPS A;  2ZG8 X;  3WVU A;  2V15 A;  1YUX A;  2FFX J;  2GS4 A;  2BJY A;  2JD6 0;  3C23 A;  4LQH A;  2Z5P A;  3LKD A;  2V2M A;  3VNX A;  2CHP A;  2XJO A;  3QD8 A;  1QGH A;  2V2P A;  2VZB A;  3H7G A;  1YV1 A;  2IY4 A;  1JGC A;  2V2R A;  3KDQ A;  3QHB A;  3W54 A;  4Y08 A;  1LKM A;  3Q4Q A;  4TOE A;  2FG4 A;  2RBD A;  5JKL G;  1UVH A;  2WTL A;  3KHK A;  3WVW A;  5LG2 A;  4LPN A;  2N02 A;  4YKH A;  1JRE A;  3FVB A;  2Y3Q A;  3E6R A;  3KA8 A;  3L0M A;  4TOG A;  5LG8 A;  5K52 A;  3HIU A;  3A9Q A;  4M32 A;  3KA9 A;  1NFV A;  4QUW A;  2Z5R A;  3E2C A;  4KVR A;  2F7N A;  1XZ3 A;  3PVT B;  2GYD A;  4TOF A;  3FRR A;  4ERU A;  3EGM A;  4Z5S A;  1VJX A;  4AM5 A;  1LKO A;  2ZA7 A;  5D8S A;  3WNW A;  5HJH A;  3BVL A;  1LB3 A;  2FL0 A;  3V3K B;  3RD0 A;  5J8W A;  4RC5 A;  2CLB A;  2CLU A;  5AXS A;  2YW6 A;  4RC5 B;  1N1Q A;  4LYX A;  4CMY A;  2BK6 A;  2ZUR X;  3EZ0 A;  5JKM A;  4A25 A;  3UNO A;  3QB9 A;  3R2O A;  3F37 A;  3PWF A;  4MN9 A;  3IS7 A;  3AJP A;  4AM4 A;  3R2M A;  3E1M A;  3HL1 A;  4CY9 A;  3UFB A;  3FI6 A;  2FJC A;  3IS8 A;  2VXX A;  4ZL6 A;  5JAC A;  4R42 A;  5HQO A;  3E1Q A;  4DI0 A;  3F34 A;  4TOC A;  3RBC A;  3F36 A;  1NNQ A;  5FFE A;  3M6J A;  5GU1 X;  2V2J A;  3PW8 A;  5D8Q A;  2PYB A;  2FZF A;  4RC6 A;  2Z6M A;  1F30 A;  4RC6 B;  4TO9 A;  1NF6 A;  3FRS A;  3F33 A;  5J93 A;  3F38 A;  2C2F A;  4PGI A;  5E1U A;  4KXR B;  4TOD A;  2V2N A;  2G38 B;  2QF9 A;  3BVF A;  4X0J A;  1UMN A;  2MGY A;  3AK8 A;  4ML5 A;  5HJF A;  5E2D A;  1DAT A;  1LKP A;  2JD7 0;  4DYZ A;  4MJY A;  2CHI A;  1F33 A;  1VEI A;  2ITB A;  4XKT A;  4DYU A;  1RCC A;  3NP0 X;  3BVE A;  3KXU A;  3QZ3 A;  4MY7 A;  2WWX B;  3ERZ A;  1ZS3 A;  4EVD A;  2FHA A;  4WJG 4;  2QQY A;  2OC5 A;  4E6K A;  2YJK A;  4ZKX A;  3RE7 A;  1MFR A;  3SE1 A;  2OKC A;  2ZA8 A;  4DYX A;  1SQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...