4ZMCA

Crystal structure of the pmftn variant e130a soaked in iron (5 min)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
157
structure length
156
Chain Sequence
EELLDLFNRQVTQEFTASQVYLSASIWFDQNDWEGMAAYMLAESAEEREHGLGFVDFANKRNIPIELQAVPAPVSAEWSSPEDVWQSILELEQANTRSLLNLAEAASTCHDFAVMAFLNPFHLQQVNAEDKIGSILAKVTDENRTPGLLRSLDVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ferritin
publication title A Diatom Ferritin Optimized for Iron Oxidation but Not Iron Storage.
pubmed doi rcsb
source organism Pseudo-nitzschia multiseries
total genus 70
structure length 156
sequence length 157
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2015-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4zmcA00
1F33A 3PW1A 3F38A 1UVHA 3F39A 5AXSA 4XGSA 5FFDA 4ZJKA 2JD80 2YJKA 2VXIA 3OJ5A 2FKZA 1HRSA 3IS7A 2D5KA 5D8YA 2CN7A 4Z3BA 3PWQC 1JKUA 1NF4A 1JI4A 2C2JA 3UNOA 4RC5A 3E1LA 1LKMA 1O9RA 3UOFA 4ETRA 4MJYA 1RCCA 3KA9A 3F37A 4TOGA 5JKMG 2F7NA 4LYXA 3AK8A 1F30A 1JKVA 1RYTA 3BVIA 3E1PA 5K53A 4RC7A 1TJOA 1L8HA 1J30A 4XKUA 3QZ3A 4PG1A 2VXXA 5E2DA 3AF9X 1QYBA 3R2OA 4U3GA 3BVFA 3HIUA 3KA4A 2XJNA 3FSEA 3RAVA 1RCDA 3UOIA 4A25A 3GE4A 2V2NA 4ZKWA 4Z5SA 5HJFA 1LB3A 4AM2A 5K52A 2XJOA 2V2IA 3NP0X 4ZTTA 4LPNA 4LQVA 4MKUA 3PVYB 4DZ0A 3WVUA 4YKHA 3BVEA 5GOUA 4REUA 4IXKA 2WTLA 4KVQA 4LQHA 2QQYA 5LS9A 2ZA8A 3KWOA 5LBHA 3E1JA 5GU2X 5GN8B 5I4JA 1XZ1A 4CVRA 4Y08A 3ES3A 1LKPA 5ERJA 1VELA 3PVYA 4E6KA 2V2PA 1L8IA 5E1UA 5FFBA 4DI0A 2IY4A 3OGHA 2XJMA 3KA6A 1Z4AA 3BVLA 2FG8A 5GN8A 3WVVA 1SQ3A 2FG4A 3AF8X 3KX9A 3TA8A 1RCEA 2BW1A 4TO9A 3AK9A 4M35A 3WNWA 1JIGA 4TODA 1RCIA 5GU1X 3ISFA 4LQNA 4CYBA 2JD60 5HJHA 2W0OA 3AJPA 2C6RA 4ZKXA 3F36A 3NOZX 5JKLA 3E1NA 3QB9A 4DE6A 1DPSA 1UMNA 3R2HA 2YW6A 1DVBA 3Q4OA 4ZLWA 2CHPA 1VEQA 1FHAA 4DYXA 4TOHA 1AEWA 4XKTA 4PGIA 3QVDA 4LQJA 3E6SA 1TKPA 2XGWA 3O7SA 1GWGA 1Z6OM 4QUWA 2QF9A 1DATA 3QHCA 3AJOA 4ITTA 1S30A 4ERUA 4LPMA 5LG8A 4ISPA 3GHQA 3R2MA 3E1OA 3PZAA 2GYDA 3SHXA 4CY9A 4TW3A 4M34A 3EGMA 1O9IA 1YUZA 2C2FA 2CLUA 3PVRB 4TOBA 3E6RA 4OYNA 4CMYA 3WVWA 2Z5QA 2CIHA 2V2MA 1N1QA 5FFAA 4MY7A 1XZ3A 4II4B 5D8PA 4DYYA 4IWJA 2GS4A 5LG2A 2V15A 1ZS3A 2CF7A 2WLAA 3T9JA 5D8XA 5GU0X 5JKMA 5D8SA 1TK6A 3PVRA 3BVKA 1KRQA 4MUDA 2BJYA 4XKSA 4IWKA 4M32A 2Z6MA 3PW8A 2V2SA 2FFXJ 3Q4RA 2FHAA 3SH6A 3VNXA 4CVSA 4II4A 1JTSA 1JYBA 2HTNA 3IQ1A 5JACA 3KXUA 2CEIA 5FFCA 3E2CA 2V2OA 1BCFA 4ZL5A 5CMRA 2XKQA 2BKCA 3HL1A 4ZMCA 2C41A 3RE7A 4PGKA 2IB0A 3R2RA 3RD0A 4CYAA 4CVPA 3PWQA 1NFVA 2YJJA 2ZA6A 2JD70 2OC5A 3F33A 3PW1B 2ZURX 3AJQA 4AM4A 4ZKHA 1MFRA 1YUXA 3KA8A 2UX1A 1B71A 4M33A 3GVYA 5GU3X 4LPJA 1EUMA 3H7GA 3PVTB 2Z90A 1OTKA 5D8RA 4EVCA 4DASA 2Z5PA 2CLBA 1R03A 2RBDA 3F34A 2ZG9X 5J8WA 3PWFA 4RC6B 3U90A 3SE1A 1RCGA 2C2UA 1NF6A 3FI6A 3ISEA 3A68A 4DYZA 1QGHA 1ZUJA 4RC7B 3BT5A 1H96A 3PVTA 2Y3QA 3SIDA 4KVSA 2V2RA 5J8SA 3QHBA 5FEJA 3KA3A 4TOFA 3R2KA 1NNQA 4RC6A 3R2SA 5HQOA 3ERZA 4ZL6A 1BFRA 4PG0A 1IERA 3O7RA 2ZG7X 4LYUA 1IESA 3F35A 2FL0A 4TOCA 2YW7A 3E1QA 3R2LA 3RBCA 5J9VA 1S2ZA 5CZUA 3Q4NA 1JI5A 5C6FA 4DYUA 4P18A 3E1MA 2X170 2V2JA 3EZ0A 3Q4QA 5ERKA 2V2LA 1LKOA 1TKOA 2WLUA 4ISMA 5D8QA 1YV1A 1SOFA 3BKNA 4TOEA 4TOAA 2Z5RA 5J93A 1VJXA 3EZUA 3A9QA 4CVTA 2ZA7A 4ML5A 3NP2X 5JKLG 2FZFA 3IS8A 1VEIA 2OH3A 5D8OA 3QD8A 2ZG8X 3FVBA 4ITWA 3AF7X 4RC8A 3RGDA 2HR5A 2GYQA 2FJCA 4CMYV 4EVEA 1S3QA 3MPSA 4MN9A 4KVRA 5CMQA 1VLGA 4R42A 5IX6A 3F32A 1JGCA 2CN6A 4EVBA 2IU2A 3PW8C 2CHIA 4EVDA 5FFEA 4RC5B 2BK6A 2G4HA 2VZBA 2ITBA 2PYBA 1MOJA 1JREA 1BG7A 1Z6OA 4AM5A
chains in the Genus database with same CATH superfamily
1F33A 3PW1A 3F38A 1UVHA 3F39A 5AXSA 4XGSA 5FFDA 4ZJKA 2JD80 2YJKA 2VXIA 3OJ5A 3L0MA 2FKZA 1HRSA 3IS7A 2D5KA 5D8YA 2CN7A 4Z3BA 3PWQC 1JKUA 1NF4A 1JI4A 4X0JA 2C2JA 3UNOA 3C23A 4RC5A 3E1LA 1LKMA 1O9RA 3UOFA 4ETRA 5HU6D 4MJYA 1RCCA 3KA9A 4WJG4 3F37A 4TOGA 5JKMG 2F7NA 4LYXA 3AK8A 1F30A 1JKVA 1RYTA 3BVIA 3E1PA 3VVAA 5K53A 4RC7A 1TJOA 1L8HA 1J30A 4XKUA 3QZ3A 4PG1A 2VXXA 5E2DA 3AF9X 3C1ZA 1QYBA 3R2OA 4U3GA 3BVFA 3HIUA 3KA4A 2XJNA 3FSEA 3RAVA 1RCDA 3UOIA 4A25A 3GE4A 2V2NA 4ZKWA 4Z5SA 5HJFA 1LB3A 4AM2A 3KHKA 2Y44A 5K52A 2XJOA 2V2IA 3NP0X 4ZTTA 4LPNA 4LQVA 4MKUA 3PVYB 4DZ0A 3WVUA 4YKHA 3BVEA 5GOUA 4REUA 4IXKA 2WTLA 4KVQA 4LQHA 2QQYA 5LS9A 2G38B 2ZA8A 3KWOA 3FRSA 5LBHA 3E1JA 5GU2X 2MGYA 5GN8B 5I4JA 1XZ1A 4CVRA 4Y08A 3ES3A 1LKPA 5ERJA 1VELA 3PVYA 4E6KA 2V2PA 1L8IA 4W4KB 5E1UA 5FFBA 4DI0A 2IY4A 3OGHA 3V3KB 2XJMA 3KA6A 1Z4AA 3BVLA 2FG8A 5GN8A 3WVVA 1SQ3A 2FG4A 4YVZA 3AF8X 3KX9A 3TA8A 1RCEA 2BW1A 4TO9A 3AK9A 4M35A 3WNWA 1JIGA 4TODA 1RCIA 5GU1X 3ISFA 4LQNA 4CYBA 2JD60 5HJHA 2W0OA 3AJPA 2C6RA 4ZKXA 3F36A 3NOZX 5JKLA 3E1NA 3QB9A 4DE6A 1DPSA 1UMNA 3R2HA 2YW6A 5JDOB 1DVBA 3Q4OA 4ZLWA 2CHPA 1VEQA 1FHAA 4DYXA 4TOHA 1AEWA 4XKTA 4PGIA 3QVDA 4LQJA 3E6SA 1TKPA 2XGWA 3O7SA 1GWGA 1Z6OM 4QUWA 2QF9A 1DATA 3QHCA 3AJOA 4ITTA 3VV9A 1S30A 5JDOA 4ERUA 4LPMA 5LG8A 4ISPA 3GHQA 3R2MA 3E1OA 3PZAA 3C1YA 2GYDA 3SHXA 2WWXB 4CY9A 4TW3A 4M34A 3EGMA 1O9IA 3FRRA 1YUZA 4E40A 2C2FA 2CLUA 3PVRB 4TOBA 3E6RA 4OYNA 4CMYA 3WVWA 2Z5QA 2CIHA 2V2MA 1N1QA 2CWLA 5FFAA 4MY7A 1XZ3A 4II4B 4YXJA 5D8PA 4DYYA 4IWJA 2GS4A 2OKCA 5LG2A 2V15A 1ZS3A 2CF7A 2WLAA 3T9JA 5D8XA 5GU0X 5JKMA 5D8SA 1TK6A 2V8TA 3PVRA 3BVKA 4KXRB 1KRQA 4MUDA 2BJYA 4XKSA 3M6JA 4IWKA 4M32A 2Z6MA 3PW8A 2V2SA 2FFXJ 3Q4RA 2FHAA 3SH6A 3VNXA 4CVSA 4II4A 1JTSA 1JYBA 2HTNA 3IQ1A 5JACA 3KXUA 2CEIA 5FFCA 3E2CA 2V2OA 1BCFA 4ZL5A 5CMRA 2XKQA 2BKCA 3HL1A 4ZMCA 2C41A 3RE7A 3C21A 2IB0A 4PGKA 3R2RA 3RD0A 4CYAA 4CVPA 3PWQA 1NFVA 2YJJA 2ZA6A 2JD70 2OC5A 3F33A 3PW1B 2ZURX 3AJQA 3W54A 4AM4A 3UFBA 4ZKHA 1MFRA 1YUXA 3KA8A 3JZ9A 2UX1A 1B71A 4M33A 3GVYA 5GU3X 4LPJA 1EUMA 3H7GA 3PVTB 2Z90A 1OTKA 5D8RA 4EVCA 4DASA 2Z5PA 3GGYA 3LKDA 2CLBA 1R03A 2RBDA 3F34A 2ZG9X 5J8WA 3PWFA 4RC6B 3U90A 3SE1A 1RCGA 2C2UA 1NF6A 3FI6A 3ISEA 3A68A 4DYZA 1QGHA 1ZUJA 4RC7B 3BT5A 1H96A 3PVTA 2Y3QA 3SIDA 4KVSA 2V2RA 5J8SA 3QHBA 5FEJA 3KA3A 4TOFA 3R2KA 1NNQA 4RC6A 3R2SA 5HQOA 3ERZA 4ZL6A 1BFRA 4MXPA 4PG0A 3GGZA 1IERA 3O7RA 2ZG7X 4LYUA 1IESA 3F35A 2FL0A 4TOCA 2YW7A 3E1QA 3R2LA 3RBCA 5J9VA 1S2ZA 5CZUA 3Q4NA 2V8UA 4YXMA 1JI5A 5C6FA 4DYUA 3D19A 4P18A 3E1MA 2X170 2V2JA 3EZ0A 3Q4QA 5ERKA 2V2LA 3KDQA 1LKOA 1TKOA 2WLUA 4ISMA 3DBYA 5D8QA 1YV1A 1SOFA 3BKNA 4TOEA 4TOAA 2Z5RA 5J93A 1VJXA 3EZUA 2AR0A 3A9QA 4CVTA 3N6OA 2ZA7A 4ML5A 3NP2X 5JKLG 2FZFA 3IS8A 1VEIA 2OH3A 5D8OA 3QD8A 2ZG8X 3FVBA 4ITWA 4W4LB 3AF7X 4RC8A 3RGDA 2HR5A 2GYQA 2FJCA 4CMYV 4EVEA 1S3QA 3MPSA 4MN9A 4KVRA 5CMQA 1VLGA 3JZAB 4R42A 5IX6A 3F32A 1JGCA 2CN6A 4EVBA 2IU2A 3PW8C 2CHIA 4EVDA 5FFEA 4RC5B 2BK6A 2G4HA 2VZBA 2ITBA 2PYBA 1MOJA 1JREA 2N02A 1BG7A 1Z6OA 4AM5A
chains in the Genus database with same CATH topology
1F33A 3PW1A 3F38A 1UVHA 3F39A 5AXSA 4XGSA 5FFDA 4ZJKA 2JD80 2YJKA 2VXIA 3OJ5A 3L0MA 2FKZA 1HRSA 3IS7A 2D5KA 5D8YA 2CN7A 4Z3BA 3PWQC 1JKUA 1NF4A 1JI4A 4X0JA 2C2JA 3UNOA 3C23A 4RC5A 3E1LA 1LKMA 1O9RA 3UOFA 4ETRA 5HU6D 4MJYA 1RCCA 3KA9A 4WJG4 3F37A 4TOGA 5JKMG 2F7NA 4LYXA 3AK8A 1F30A 1JKVA 1RYTA 3BVIA 3E1PA 3VVAA 5K53A 4RC7A 1TJOA 1L8HA 1J30A 4XKUA 3QZ3A 4PG1A 2VXXA 5E2DA 3AF9X 3C1ZA 1QYBA 3R2OA 4U3GA 3BVFA 3HIUA 3KA4A 2XJNA 3FSEA 3RAVA 1RCDA 3UOIA 4A25A 3GE4A 2V2NA 4ZKWA 4Z5SA 5HJFA 1LB3A 4AM2A 3KHKA 2Y44A 5K52A 2XJOA 2V2IA 3NP0X 4ZTTA 4LPNA 4LQVA 4MKUA 3PVYB 4DZ0A 3WVUA 4YKHA 3BVEA 5GOUA 4REUA 4IXKA 2WTLA 4KVQA 4LQHA 2QQYA 5LS9A 2G38B 2ZA8A 3KWOA 3FRSA 5LBHA 3E1JA 5GU2X 2MGYA 5GN8B 5I4JA 1XZ1A 4CVRA 4Y08A 3ES3A 1LKPA 5ERJA 1VELA 3PVYA 4E6KA 2V2PA 1L8IA 4W4KB 5E1UA 5FFBA 4DI0A 2IY4A 3OGHA 3V3KB 2XJMA 3KA6A 1Z4AA 3BVLA 2FG8A 5GN8A 3WVVA 1SQ3A 2FG4A 4YVZA 3AF8X 3KX9A 3TA8A 1RCEA 2BW1A 4TO9A 3AK9A 4M35A 3WNWA 1JIGA 4TODA 1RCIA 5GU1X 3ISFA 4LQNA 4CYBA 2JD60 5HJHA 2W0OA 3AJPA 2C6RA 4ZKXA 3F36A 3NOZX 5JKLA 3E1NA 3QB9A 4DE6A 1DPSA 1UMNA 3R2HA 2YW6A 5JDOB 1DVBA 3Q4OA 4ZLWA 2CHPA 1VEQA 1FHAA 4DYXA 4TOHA 1AEWA 4XKTA 4PGIA 3QVDA 4LQJA 3E6SA 1TKPA 2XGWA 3O7SA 1GWGA 1Z6OM 4QUWA 2QF9A 1DATA 3QHCA 3AJOA 4ITTA 3VV9A 1S30A 5JDOA 4ERUA 4LPMA 5LG8A 4ISPA 3GHQA 3R2MA 3E1OA 3PZAA 3C1YA 2GYDA 3SHXA 2WWXB 4CY9A 4TW3A 4M34A 3EGMA 1O9IA 3FRRA 1YUZA 4E40A 2C2FA 2CLUA 3PVRB 4TOBA 3E6RA 4OYNA 4CMYA 3WVWA 2Z5QA 2CIHA 2V2MA 1N1QA 2CWLA 5FFAA 4MY7A 1XZ3A 4II4B 4YXJA 5D8PA 4DYYA 4IWJA 2GS4A 2OKCA 5LG2A 2V15A 1ZS3A 2CF7A 2WLAA 3T9JA 5D8XA 5GU0X 5JKMA 5D8SA 1TK6A 2V8TA 3PVRA 3BVKA 4KXRB 1KRQA 4MUDA 2BJYA 4XKSA 3M6JA 4IWKA 4M32A 2Z6MA 3PW8A 2V2SA 2FFXJ 3Q4RA 2FHAA 3SH6A 3VNXA 4CVSA 4II4A 1JTSA 1JYBA 2HTNA 3IQ1A 5JACA 3KXUA 2CEIA 5FFCA 3E2CA 2V2OA 1BCFA 4ZL5A 5CMRA 2XKQA 2BKCA 3HL1A 4ZMCA 2C41A 3RE7A 3C21A 2IB0A 4PGKA 3R2RA 3RD0A 4CYAA 4CVPA 3PWQA 1NFVA 2YJJA 2ZA6A 2JD70 2OC5A 3F33A 3PW1B 2ZURX 3AJQA 3W54A 4AM4A 3UFBA 4ZKHA 1MFRA 1YUXA 3KA8A 3JZ9A 2UX1A 1B71A 4M33A 3GVYA 5GU3X 4LPJA 1EUMA 3H7GA 3PVTB 2Z90A 1OTKA 5D8RA 4EVCA 4DASA 2Z5PA 3GGYA 3LKDA 2CLBA 1R03A 2RBDA 3F34A 2ZG9X 5J8WA 3PWFA 4RC6B 3U90A 3SE1A 1RCGA 2C2UA 1NF6A 3FI6A 3ISEA 3A68A 4DYZA 1QGHA 1ZUJA 4RC7B 3BT5A 1H96A 3PVTA 2Y3QA 3SIDA 4KVSA 2V2RA 5J8SA 3QHBA 5FEJA 3KA3A 4TOFA 3R2KA 1NNQA 4RC6A 3R2SA 5HQOA 3ERZA 4ZL6A 1BFRA 4MXPA 4PG0A 3GGZA 1IERA 3O7RA 2ZG7X 4LYUA 1IESA 3F35A 2FL0A 4TOCA 2YW7A 3E1QA 3R2LA 3RBCA 5J9VA 1S2ZA 5CZUA 3Q4NA 2V8UA 4YXMA 1JI5A 5C6FA 4DYUA 3D19A 4P18A 3E1MA 2X170 2V2JA 3EZ0A 3Q4QA 5ERKA 2V2LA 3KDQA 1LKOA 1TKOA 2WLUA 4ISMA 3DBYA 5D8QA 1YV1A 1SOFA 3BKNA 4TOEA 4TOAA 2Z5RA 5J93A 1VJXA 3EZUA 2AR0A 3A9QA 4CVTA 3N6OA 2ZA7A 4ML5A 3NP2X 5JKLG 2FZFA 3IS8A 1VEIA 2OH3A 5D8OA 3QD8A 2ZG8X 3FVBA 4ITWA 4W4LB 3AF7X 4RC8A 3RGDA 2HR5A 2GYQA 2FJCA 4CMYV 4EVEA 1S3QA 3MPSA 4MN9A 4KVRA 5CMQA 1VLGA 3JZAB 4R42A 5IX6A 3F32A 1JGCA 2CN6A 4EVBA 2IU2A 3PW8C 2CHIA 4EVDA 5FFEA 4RC5B 2BK6A 2G4HA 2VZBA 2ITBA 2PYBA 1MOJA 1JREA 2N02A 1BG7A 1Z6OA 4AM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F33 A;  3PW1 A;  3F38 A;  1UVH A;  3F39 A;  5AXS A;  4XGS A;  5FFD A;  4ZJK A;  2JD8 0;  2YJK A;  2VXI A;  3OJ5 A;  2FKZ A;  1HRS A;  3IS7 A;  2D5K A;  5D8Y A;  2CN7 A;  4Z3B A;  3PWQ C;  1JKU A;  1NF4 A;  1JI4 A;  2C2J A;  3UNO A;  4RC5 A;  3E1L A;  1LKM A;  1O9R A;  3UOF A;  4ETR A;  4MJY A;  1RCC A;  3KA9 A;  3F37 A;  4TOG A;  5JKM G;  2F7N A;  4LYX A;  3AK8 A;  1F30 A;  1JKV A;  1RYT A;  3BVI A;  3E1P A;  5K53 A;  4RC7 A;  1TJO A;  1L8H A;  1J30 A;  4XKU A;  3QZ3 A;  4PG1 A;  2VXX A;  5E2D A;  3AF9 X;  1QYB A;  3R2O A;  4U3G A;  3BVF A;  3HIU A;  3KA4 A;  2XJN A;  3FSE A;  3RAV A;  1RCD A;  3UOI A;  4A25 A;  3GE4 A;  2V2N A;  4ZKW A;  4Z5S A;  5HJF A;  1LB3 A;  4AM2 A;  5K52 A;  2XJO A;  2V2I A;  3NP0 X;  4ZTT A;  4LPN A;  4LQV A;  4MKU A;  3PVY B;  4DZ0 A;  3WVU A;  4YKH A;  3BVE A;  5GOU A;  4REU A;  4IXK A;  2WTL A;  4KVQ A;  4LQH A;  2QQY A;  5LS9 A;  2ZA8 A;  3KWO A;  5LBH A;  3E1J A;  5GU2 X;  5GN8 B;  5I4J A;  1XZ1 A;  4CVR A;  4Y08 A;  3ES3 A;  1LKP A;  5ERJ A;  1VEL A;  3PVY A;  4E6K A;  2V2P A;  1L8I A;  5E1U A;  5FFB A;  4DI0 A;  2IY4 A;  3OGH A;  2XJM A;  3KA6 A;  1Z4A A;  3BVL A;  2FG8 A;  5GN8 A;  3WVV A;  1SQ3 A;  2FG4 A;  3AF8 X;  3KX9 A;  3TA8 A;  1RCE A;  2BW1 A;  4TO9 A;  3AK9 A;  4M35 A;  3WNW A;  1JIG A;  4TOD A;  1RCI A;  5GU1 X;  3ISF A;  4LQN A;  4CYB A;  2JD6 0;  5HJH A;  2W0O A;  3AJP A;  2C6R A;  4ZKX A;  3F36 A;  3NOZ X;  5JKL A;  3E1N A;  3QB9 A;  4DE6 A;  1DPS A;  1UMN A;  3R2H A;  2YW6 A;  1DVB A;  3Q4O A;  4ZLW A;  2CHP A;  1VEQ A;  1FHA A;  4DYX A;  4TOH A;  1AEW A;  4XKT A;  4PGI A;  3QVD A;  4LQJ A;  3E6S A;  1TKP A;  2XGW A;  3O7S A;  1GWG A;  1Z6O M;  4QUW A;  2QF9 A;  1DAT A;  3QHC A;  3AJO A;  4ITT A;  1S30 A;  4ERU A;  4LPM A;  5LG8 A;  4ISP A;  3GHQ A;  3R2M A;  3E1O A;  3PZA A;  2GYD A;  3SHX A;  4CY9 A;  4TW3 A;  4M34 A;  3EGM A;  1O9I A;  1YUZ A;  2C2F A;  2CLU A;  3PVR B;  4TOB A;  3E6R A;  4OYN A;  4CMY A;  3WVW A;  2Z5Q A;  2CIH A;  2V2M A;  1N1Q A;  5FFA A;  4MY7 A;  1XZ3 A;  4II4 B;  5D8P A;  4DYY A;  4IWJ A;  2GS4 A;  5LG2 A;  2V15 A;  1ZS3 A;  2CF7 A;  2WLA A;  3T9J A;  5D8X A;  5GU0 X;  5JKM A;  5D8S A;  1TK6 A;  3PVR A;  3BVK A;  1KRQ A;  4MUD A;  2BJY A;  4XKS A;  4IWK A;  4M32 A;  2Z6M A;  3PW8 A;  2V2S A;  2FFX J;  3Q4R A;  2FHA A;  3SH6 A;  3VNX A;  4CVS A;  4II4 A;  1JTS A;  1JYB A;  2HTN A;  3IQ1 A;  5JAC A;  3KXU A;  2CEI A;  5FFC A;  3E2C A;  2V2O A;  1BCF A;  4ZL5 A;  5CMR A;  2XKQ A;  2BKC A;  3HL1 A;  4ZMC A;  2C41 A;  3RE7 A;  4PGK A;  2IB0 A;  3R2R A;  3RD0 A;  4CYA A;  4CVP A;  3PWQ A;  1NFV A;  2YJJ A;  2ZA6 A;  2JD7 0;  2OC5 A;  3F33 A;  3PW1 B;  2ZUR X;  3AJQ A;  4AM4 A;  4ZKH A;  1MFR A;  1YUX A;  3KA8 A;  2UX1 A;  1B71 A;  4M33 A;  3GVY A;  5GU3 X;  4LPJ A;  1EUM A;  3H7G A;  3PVT B;  2Z90 A;  1OTK A;  5D8R A;  4EVC A;  4DAS A;  2Z5P A;  2CLB A;  1R03 A;  2RBD A;  3F34 A;  2ZG9 X;  5J8W A;  3PWF A;  4RC6 B;  3U90 A;  3SE1 A;  1RCG A;  2C2U A;  1NF6 A;  3FI6 A;  3ISE A;  3A68 A;  4DYZ A;  1QGH A;  1ZUJ A;  4RC7 B;  3BT5 A;  1H96 A;  3PVT A;  2Y3Q A;  3SID A;  4KVS A;  2V2R A;  5J8S A;  3QHB A;  5FEJ A;  3KA3 A;  4TOF A;  3R2K A;  1NNQ A;  4RC6 A;  3R2S A;  5HQO A;  3ERZ A;  4ZL6 A;  1BFR A;  4PG0 A;  1IER A;  3O7R A;  2ZG7 X;  4LYU A;  1IES A;  3F35 A;  2FL0 A;  4TOC A;  2YW7 A;  3E1Q A;  3R2L A;  3RBC A;  5J9V A;  1S2Z A;  5CZU A;  3Q4N A;  1JI5 A;  5C6F A;  4DYU A;  4P18 A;  3E1M A;  2X17 0;  2V2J A;  3EZ0 A;  3Q4Q A;  5ERK A;  2V2L A;  1LKO A;  1TKO A;  2WLU A;  4ISM A;  5D8Q A;  1YV1 A;  1SOF A;  3BKN A;  4TOE A;  4TOA A;  2Z5R A;  5J93 A;  1VJX A;  3EZU A;  3A9Q A;  4CVT A;  2ZA7 A;  4ML5 A;  3NP2 X;  5JKL G;  2FZF A;  3IS8 A;  1VEI A;  2OH3 A;  5D8O A;  3QD8 A;  2ZG8 X;  3FVB A;  4ITW A;  3AF7 X;  4RC8 A;  3RGD A;  2HR5 A;  2GYQ A;  2FJC A;  4CMY V;  4EVE A;  1S3Q A;  3MPS A;  4MN9 A;  4KVR A;  5CMQ A;  1VLG A;  4R42 A;  5IX6 A;  3F32 A;  1JGC A;  2CN6 A;  4EVB A;  2IU2 A;  3PW8 C;  2CHI A;  4EVD A;  5FFE A;  4RC5 B;  2BK6 A;  2G4H A;  2VZB A;  2ITB A;  2PYB A;  1MOJ A;  1JRE A;  1BG7 A;  1Z6O A;  4AM5 A; 
#chains in the Genus database with same CATH topology
 1F33 A;  3PW1 A;  3F38 A;  1UVH A;  3F39 A;  5AXS A;  4XGS A;  5FFD A;  4ZJK A;  2JD8 0;  2YJK A;  2VXI A;  3OJ5 A;  3L0M A;  2FKZ A;  1HRS A;  3IS7 A;  2D5K A;  5D8Y A;  2CN7 A;  4Z3B A;  3PWQ C;  1JKU A;  1NF4 A;  1JI4 A;  4X0J A;  2C2J A;  3UNO A;  3C23 A;  4RC5 A;  3E1L A;  1LKM A;  1O9R A;  3UOF A;  4ETR A;  5HU6 D;  4MJY A;  1RCC A;  3KA9 A;  4WJG 4;  3F37 A;  4TOG A;  5JKM G;  2F7N A;  4LYX A;  3AK8 A;  1F30 A;  1JKV A;  1RYT A;  3BVI A;  3E1P A;  3VVA A;  5K53 A;  4RC7 A;  1TJO A;  1L8H A;  1J30 A;  4XKU A;  3QZ3 A;  4PG1 A;  2VXX A;  5E2D A;  3AF9 X;  3C1Z A;  1QYB A;  3R2O A;  4U3G A;  3BVF A;  3HIU A;  3KA4 A;  2XJN A;  3FSE A;  3RAV A;  1RCD A;  3UOI A;  4A25 A;  3GE4 A;  2V2N A;  4ZKW A;  4Z5S A;  5HJF A;  1LB3 A;  4AM2 A;  3KHK A;  2Y44 A;  5K52 A;  2XJO A;  2V2I A;  3NP0 X;  4ZTT A;  4LPN A;  4LQV A;  4MKU A;  3PVY B;  4DZ0 A;  3WVU A;  4YKH A;  3BVE A;  5GOU A;  4REU A;  4IXK A;  2WTL A;  4KVQ A;  4LQH A;  2QQY A;  5LS9 A;  2G38 B;  2ZA8 A;  3KWO A;  3FRS A;  5LBH A;  3E1J A;  5GU2 X;  2MGY A;  5GN8 B;  5I4J A;  1XZ1 A;  4CVR A;  4Y08 A;  3ES3 A;  1LKP A;  5ERJ A;  1VEL A;  3PVY A;  4E6K A;  2V2P A;  1L8I A;  4W4K B;  5E1U A;  5FFB A;  4DI0 A;  2IY4 A;  3OGH A;  3V3K B;  2XJM A;  3KA6 A;  1Z4A A;  3BVL A;  2FG8 A;  5GN8 A;  3WVV A;  1SQ3 A;  2FG4 A;  4YVZ A;  3AF8 X;  3KX9 A;  3TA8 A;  1RCE A;  2BW1 A;  4TO9 A;  3AK9 A;  4M35 A;  3WNW A;  1JIG A;  4TOD A;  1RCI A;  5GU1 X;  3ISF A;  4LQN A;  4CYB A;  2JD6 0;  5HJH A;  2W0O A;  3AJP A;  2C6R A;  4ZKX A;  3F36 A;  3NOZ X;  5JKL A;  3E1N A;  3QB9 A;  4DE6 A;  1DPS A;  1UMN A;  3R2H A;  2YW6 A;  5JDO B;  1DVB A;  3Q4O A;  4ZLW A;  2CHP A;  1VEQ A;  1FHA A;  4DYX A;  4TOH A;  1AEW A;  4XKT A;  4PGI A;  3QVD A;  4LQJ A;  3E6S A;  1TKP A;  2XGW A;  3O7S A;  1GWG A;  1Z6O M;  4QUW A;  2QF9 A;  1DAT A;  3QHC A;  3AJO A;  4ITT A;  3VV9 A;  1S30 A;  5JDO A;  4ERU A;  4LPM A;  5LG8 A;  4ISP A;  3GHQ A;  3R2M A;  3E1O A;  3PZA A;  3C1Y A;  2GYD A;  3SHX A;  2WWX B;  4CY9 A;  4TW3 A;  4M34 A;  3EGM A;  1O9I A;  3FRR A;  1YUZ A;  4E40 A;  2C2F A;  2CLU A;  3PVR B;  4TOB A;  3E6R A;  4OYN A;  4CMY A;  3WVW A;  2Z5Q A;  2CIH A;  2V2M A;  1N1Q A;  2CWL A;  5FFA A;  4MY7 A;  1XZ3 A;  4II4 B;  4YXJ A;  5D8P A;  4DYY A;  4IWJ A;  2GS4 A;  2OKC A;  5LG2 A;  2V15 A;  1ZS3 A;  2CF7 A;  2WLA A;  3T9J A;  5D8X A;  5GU0 X;  5JKM A;  5D8S A;  1TK6 A;  2V8T A;  3PVR A;  3BVK A;  4KXR B;  1KRQ A;  4MUD A;  2BJY A;  4XKS A;  3M6J A;  4IWK A;  4M32 A;  2Z6M A;  3PW8 A;  2V2S A;  2FFX J;  3Q4R A;  2FHA A;  3SH6 A;  3VNX A;  4CVS A;  4II4 A;  1JTS A;  1JYB A;  2HTN A;  3IQ1 A;  5JAC A;  3KXU A;  2CEI A;  5FFC A;  3E2C A;  2V2O A;  1BCF A;  4ZL5 A;  5CMR A;  2XKQ A;  2BKC A;  3HL1 A;  4ZMC A;  2C41 A;  3RE7 A;  3C21 A;  2IB0 A;  4PGK A;  3R2R A;  3RD0 A;  4CYA A;  4CVP A;  3PWQ A;  1NFV A;  2YJJ A;  2ZA6 A;  2JD7 0;  2OC5 A;  3F33 A;  3PW1 B;  2ZUR X;  3AJQ A;  3W54 A;  4AM4 A;  3UFB A;  4ZKH A;  1MFR A;  1YUX A;  3KA8 A;  3JZ9 A;  2UX1 A;  1B71 A;  4M33 A;  3GVY A;  5GU3 X;  4LPJ A;  1EUM A;  3H7G A;  3PVT B;  2Z90 A;  1OTK A;  5D8R A;  4EVC A;  4DAS A;  2Z5P A;  3GGY A;  3LKD A;  2CLB A;  1R03 A;  2RBD A;  3F34 A;  2ZG9 X;  5J8W A;  3PWF A;  4RC6 B;  3U90 A;  3SE1 A;  1RCG A;  2C2U A;  1NF6 A;  3FI6 A;  3ISE A;  3A68 A;  4DYZ A;  1QGH A;  1ZUJ A;  4RC7 B;  3BT5 A;  1H96 A;  3PVT A;  2Y3Q A;  3SID A;  4KVS A;  2V2R A;  5J8S A;  3QHB A;  5FEJ A;  3KA3 A;  4TOF A;  3R2K A;  1NNQ A;  4RC6 A;  3R2S A;  5HQO A;  3ERZ A;  4ZL6 A;  1BFR A;  4MXP A;  4PG0 A;  3GGZ A;  1IER A;  3O7R A;  2ZG7 X;  4LYU A;  1IES A;  3F35 A;  2FL0 A;  4TOC A;  2YW7 A;  3E1Q A;  3R2L A;  3RBC A;  5J9V A;  1S2Z A;  5CZU A;  3Q4N A;  2V8U A;  4YXM A;  1JI5 A;  5C6F A;  4DYU A;  3D19 A;  4P18 A;  3E1M A;  2X17 0;  2V2J A;  3EZ0 A;  3Q4Q A;  5ERK A;  2V2L A;  3KDQ A;  1LKO A;  1TKO A;  2WLU A;  4ISM A;  3DBY A;  5D8Q A;  1YV1 A;  1SOF A;  3BKN A;  4TOE A;  4TOA A;  2Z5R A;  5J93 A;  1VJX A;  3EZU A;  2AR0 A;  3A9Q A;  4CVT A;  3N6O A;  2ZA7 A;  4ML5 A;  3NP2 X;  5JKL G;  2FZF A;  3IS8 A;  1VEI A;  2OH3 A;  5D8O A;  3QD8 A;  2ZG8 X;  3FVB A;  4ITW A;  4W4L B;  3AF7 X;  4RC8 A;  3RGD A;  2HR5 A;  2GYQ A;  2FJC A;  4CMY V;  4EVE A;  1S3Q A;  3MPS A;  4MN9 A;  4KVR A;  5CMQ A;  1VLG A;  3JZA B;  4R42 A;  5IX6 A;  3F32 A;  1JGC A;  2CN6 A;  4EVB A;  2IU2 A;  3PW8 C;  2CHI A;  4EVD A;  5FFE A;  4RC5 B;  2BK6 A;  2G4H A;  2VZB A;  2ITB A;  2PYB A;  1MOJ A;  1JRE A;  2N02 A;  1BG7 A;  1Z6O A;  4AM5 A; 
#chains in the Genus database with same CATH homology
 1F33 A;  3PW1 A;  3F38 A;  1UVH A;  3F39 A;  5AXS A;  4XGS A;  5FFD A;  4ZJK A;  2JD8 0;  2YJK A;  2VXI A;  3OJ5 A;  3L0M A;  2FKZ A;  1HRS A;  3IS7 A;  2D5K A;  5D8Y A;  2CN7 A;  4Z3B A;  3PWQ C;  1JKU A;  1NF4 A;  1JI4 A;  4X0J A;  2C2J A;  3UNO A;  3C23 A;  4RC5 A;  3E1L A;  1LKM A;  1O9R A;  3UOF A;  4ETR A;  5HU6 D;  4MJY A;  1RCC A;  3KA9 A;  4WJG 4;  3F37 A;  4TOG A;  5JKM G;  2F7N A;  4LYX A;  3AK8 A;  1F30 A;  1JKV A;  1RYT A;  3BVI A;  3E1P A;  3VVA A;  5K53 A;  4RC7 A;  1TJO A;  1L8H A;  1J30 A;  4XKU A;  3QZ3 A;  4PG1 A;  2VXX A;  5E2D A;  3AF9 X;  3C1Z A;  1QYB A;  3R2O A;  4U3G A;  3BVF A;  3HIU A;  3KA4 A;  2XJN A;  3FSE A;  3RAV A;  1RCD A;  3UOI A;  4A25 A;  3GE4 A;  2V2N A;  4ZKW A;  4Z5S A;  5HJF A;  1LB3 A;  4AM2 A;  3KHK A;  2Y44 A;  5K52 A;  2XJO A;  2V2I A;  3NP0 X;  4ZTT A;  4LPN A;  4LQV A;  4MKU A;  3PVY B;  4DZ0 A;  3WVU A;  4YKH A;  3BVE A;  5GOU A;  4REU A;  4IXK A;  2WTL A;  4KVQ A;  4LQH A;  2QQY A;  5LS9 A;  2G38 B;  2ZA8 A;  3KWO A;  3FRS A;  5LBH A;  3E1J A;  5GU2 X;  2MGY A;  5GN8 B;  5I4J A;  1XZ1 A;  4CVR A;  4Y08 A;  3ES3 A;  1LKP A;  5ERJ A;  1VEL A;  3PVY A;  4E6K A;  2V2P A;  1L8I A;  4W4K B;  5E1U A;  5FFB A;  4DI0 A;  2IY4 A;  3OGH A;  3V3K B;  2XJM A;  3KA6 A;  1Z4A A;  3BVL A;  2FG8 A;  5GN8 A;  3WVV A;  1SQ3 A;  2FG4 A;  4YVZ A;  3AF8 X;  3KX9 A;  3TA8 A;  1RCE A;  2BW1 A;  4TO9 A;  3AK9 A;  4M35 A;  3WNW A;  1JIG A;  4TOD A;  1RCI A;  5GU1 X;  3ISF A;  4LQN A;  4CYB A;  2JD6 0;  5HJH A;  2W0O A;  3AJP A;  2C6R A;  4ZKX A;  3F36 A;  3NOZ X;  5JKL A;  3E1N A;  3QB9 A;  4DE6 A;  1DPS A;  1UMN A;  3R2H A;  2YW6 A;  5JDO B;  1DVB A;  3Q4O A;  4ZLW A;  2CHP A;  1VEQ A;  1FHA A;  4DYX A;  4TOH A;  1AEW A;  4XKT A;  4PGI A;  3QVD A;  4LQJ A;  3E6S A;  1TKP A;  2XGW A;  3O7S A;  1GWG A;  1Z6O M;  4QUW A;  2QF9 A;  1DAT A;  3QHC A;  3AJO A;  4ITT A;  3VV9 A;  1S30 A;  5JDO A;  4ERU A;  4LPM A;  5LG8 A;  4ISP A;  3GHQ A;  3R2M A;  3E1O A;  3PZA A;  3C1Y A;  2GYD A;  3SHX A;  2WWX B;  4CY9 A;  4TW3 A;  4M34 A;  3EGM A;  1O9I A;  3FRR A;  1YUZ A;  4E40 A;  2C2F A;  2CLU A;  3PVR B;  4TOB A;  3E6R A;  4OYN A;  4CMY A;  3WVW A;  2Z5Q A;  2CIH A;  2V2M A;  1N1Q A;  2CWL A;  5FFA A;  4MY7 A;  1XZ3 A;  4II4 B;  4YXJ A;  5D8P A;  4DYY A;  4IWJ A;  2GS4 A;  2OKC A;  5LG2 A;  2V15 A;  1ZS3 A;  2CF7 A;  2WLA A;  3T9J A;  5D8X A;  5GU0 X;  5JKM A;  5D8S A;  1TK6 A;  2V8T A;  3PVR A;  3BVK A;  4KXR B;  1KRQ A;  4MUD A;  2BJY A;  4XKS A;  3M6J A;  4IWK A;  4M32 A;  2Z6M A;  3PW8 A;  2V2S A;  2FFX J;  3Q4R A;  2FHA A;  3SH6 A;  3VNX A;  4CVS A;  4II4 A;  1JTS A;  1JYB A;  2HTN A;  3IQ1 A;  5JAC A;  3KXU A;  2CEI A;  5FFC A;  3E2C A;  2V2O A;  1BCF A;  4ZL5 A;  5CMR A;  2XKQ A;  2BKC A;  3HL1 A;  4ZMC A;  2C41 A;  3RE7 A;  3C21 A;  2IB0 A;  4PGK A;  3R2R A;  3RD0 A;  4CYA A;  4CVP A;  3PWQ A;  1NFV A;  2YJJ A;  2ZA6 A;  2JD7 0;  2OC5 A;  3F33 A;  3PW1 B;  2ZUR X;  3AJQ A;  3W54 A;  4AM4 A;  3UFB A;  4ZKH A;  1MFR A;  1YUX A;  3KA8 A;  3JZ9 A;  2UX1 A;  1B71 A;  4M33 A;  3GVY A;  5GU3 X;  4LPJ A;  1EUM A;  3H7G A;  3PVT B;  2Z90 A;  1OTK A;  5D8R A;  4EVC A;  4DAS A;  2Z5P A;  3GGY A;  3LKD A;  2CLB A;  1R03 A;  2RBD A;  3F34 A;  2ZG9 X;  5J8W A;  3PWF A;  4RC6 B;  3U90 A;  3SE1 A;  1RCG A;  2C2U A;  1NF6 A;  3FI6 A;  3ISE A;  3A68 A;  4DYZ A;  1QGH A;  1ZUJ A;  4RC7 B;  3BT5 A;  1H96 A;  3PVT A;  2Y3Q A;  3SID A;  4KVS A;  2V2R A;  5J8S A;  3QHB A;  5FEJ A;  3KA3 A;  4TOF A;  3R2K A;  1NNQ A;  4RC6 A;  3R2S A;  5HQO A;  3ERZ A;  4ZL6 A;  1BFR A;  4MXP A;  4PG0 A;  3GGZ A;  1IER A;  3O7R A;  2ZG7 X;  4LYU A;  1IES A;  3F35 A;  2FL0 A;  4TOC A;  2YW7 A;  3E1Q A;  3R2L A;  3RBC A;  5J9V A;  1S2Z A;  5CZU A;  3Q4N A;  2V8U A;  4YXM A;  1JI5 A;  5C6F A;  4DYU A;  3D19 A;  4P18 A;  3E1M A;  2X17 0;  2V2J A;  3EZ0 A;  3Q4Q A;  5ERK A;  2V2L A;  3KDQ A;  1LKO A;  1TKO A;  2WLU A;  4ISM A;  3DBY A;  5D8Q A;  1YV1 A;  1SOF A;  3BKN A;  4TOE A;  4TOA A;  2Z5R A;  5J93 A;  1VJX A;  3EZU A;  2AR0 A;  3A9Q A;  4CVT A;  3N6O A;  2ZA7 A;  4ML5 A;  3NP2 X;  5JKL G;  2FZF A;  3IS8 A;  1VEI A;  2OH3 A;  5D8O A;  3QD8 A;  2ZG8 X;  3FVB A;  4ITW A;  4W4L B;  3AF7 X;  4RC8 A;  3RGD A;  2HR5 A;  2GYQ A;  2FJC A;  4CMY V;  4EVE A;  1S3Q A;  3MPS A;  4MN9 A;  4KVR A;  5CMQ A;  1VLG A;  3JZA B;  4R42 A;  5IX6 A;  3F32 A;  1JGC A;  2CN6 A;  4EVB A;  2IU2 A;  3PW8 C;  2CHI A;  4EVD A;  5FFE A;  4RC5 B;  2BK6 A;  2G4H A;  2VZB A;  2ITB A;  2PYB A;  1MOJ A;  1JRE A;  2N02 A;  1BG7 A;  1Z6O A;  4AM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...