4ZMCA

Crystal structure of the pmftn variant e130a soaked in iron (5 min)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
157
structure length
156
Chain Sequence
b'EELLDLFNRQVTQEFTASQVYLSASIWFDQNDWEGMAAYMLAESAEEREHGLGFVDFANKRNIPIELQAVPAPVSAEWSSPEDVWQSILELEQANTRSLLNLAEAASTCHDFAVMAFLNPFHLQQVNAEDKIGSILAKVTDENRTPGLLRSLDVVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferritin
publication title A Diatom Ferritin Optimized for Iron Oxidation but Not Iron Storage.
pubmed doi rcsb
source organism Pseudo-nitzschia multiseries
molecule tags Oxidoreductase
total genus 70
structure length 156
sequence length 157
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2015-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4zmcA00
1TKPA 5IX6A 2FG4A 3RE7A 4TOCA 3ISEA 1F30A 3E6RA 2CN6A 4MKUA 2RBDA 3BVKA 2C41A 3RD0A 4CVPA 4RC5B 3PVTB 2G4HA 2CHIA 2Z6MA 3Q4NA 4LYUA 4KVSA 2ZG7X 3AF9X 3PVYA 3F33A 5JACA 3WVWA 4TO9A 5J9VA 1VEQA 3KX9A 5CZUA 2QQYA 3BVFA 3KA6A 1S3QA 2CLUA 1GWGA 4TOBA 3FVBA 4EVDA 5CMRA 5FFBA 4CVTA 1TK6A 4A25A 1SQ3A 2YJJA 4IXKA 5ERKA 2XJNA 1EUMA 3BVIA 1HRSA 1JKVA 2XJMA 4ZL5A 3IS7A 2XKQA 3Q4QA 4IWKA 1VELA 2C2JA 3QD8A 1TKOA 2ZG9X 2GS4A 2V15A 1H96A 3E1LA 2V2OA 3RBCA 1RCCA 5ERJA 2IU2A 1F33A 5I4JA 4ZKHA 3PVRB 3E1PA 1SOFA 3BT5A 4REUA 2IB0A 1QGHA 3E2CA 2CEIA 3FI6A 2C6RA 2X170 1VLGA 4U3GA 4PG1A 2Z90A 3F37A 4YKHA 4CVRA 3IQ1A 4RC7B 3AK9A 4ML5A 4MN9A 5HJFA 5C6FA 4II4A 3SHXA 1YUZA 2HR5A 4TOFA 5FFEA 2BK6A 3U90A 1BCFA 1QYBA 5GOUA 3AJPA 3NOZX 3KA9A 3SH6A 1RCGA 4MJYA 3AJOA 5FEJA 1RCDA 2GYDA 4E6KA 5FFAA 4CYAA 3F38A 4ERUA 4EVEA 1XZ1A 2BJYA 3GVYA 2V2SA 5GN8A 2CLBA 2JD60 4DASA 3QZ3A 4CVSA 1JI5A 2Y3QA 5K53A 2V2NA 5E2DA 1VEIA 5FFCA 3GE4A 5D8SA 5JKLG 3R2RA 3BVLA 4XKSA 3IS8A 4RC6A 1YUXA 3WVVA 3EZ0A 2V2LA 2F7NA 1Z4AA 4IWJA 1IERA 3F35A 4LPJA 4ISPA 4PG0A 1FHAA 1S2ZA 1JGCA 2WTLA 4CY9A 1NF6A 5LS9A 4ZMCA 4R42A 3KA8A 2V2RA 3BVEA 1RYTA 4DYXA 2FKZA 4M34A 1RCIA 2V2IA 5JKLA 1UMNA 3EGMA 1KRQA 1LKPA 2HTNA 3PWQC 2JD70 4CYBA 4MUDA 4ZLWA 3R2MA 1LKOA 1S30A 2Z5RA 2IY4A 4OYNA 3OJ5A 2V2PA 1DVBA 4RC5A 4ZL6A 3PVTA 2VZBA 1VJXA 4ETRA 4TOGA 1YV1A 3PW8A 4Z3BA 3KA4A 3NP2X 4KVQA 3AF7X 4DYYA 1AEWA 4DZ0A 2BKCA 2WLUA 4ZKXA 5LG8A 4TOHA 2CHPA 3R2KA 3F34A 3ISFA 3A9QA 1LB3A 1UVHA 5HJHA 4RC8A 3PVYB 2D5KA 3VNXA 4AM5A 3R2LA 4EVBA 1L8HA 2YW7A 4PGKA 5D8XA 3E6SA 3F36A 1JI4A 2W0OA 2GYQA 4TOAA 3KXUA 4M32A 3TA8A 3KA3A 2UX1A 3AK8A 3E1OA 3FSEA 3E1JA 1JIGA 3Q4OA 3QB9A 4KVRA 3PZAA 3PW1A 3O7RA 2PYBA 1NFVA 2CIHA 3R2OA 2FFXJ 3ERZA 5CMQA 3WNWA 5D8OA 2FL0A 3PVRA 4ISMA 2XGWA 3EZUA 1NF4A 4ITTA 4M35A 1OTKA 1XZ3A 2ZA6A 1TJOA 2FZFA 1L8IA 4LPNA 2XJOA 4LQHA 5HQOA 3R2SA 1ZS3A 4RC7A 5K52A 3H7GA 3PW8C 1RCEA 4Z5SA 4CMYA 2V2JA 3QHCA 5E1UA 3HIUA 4XGSA 4QUWA 1BFRA 5D8PA 3UOIA 1R03A 4LQJA 1J30A 3E1NA 4Y08A 2QF9A 3RGDA 1Z6OA 3A68A 1O9RA 4XKTA 1O9IA 4DE6A 4AM4A 3O7SA 5LBHA 2FJCA 4II4B 4XKUA 2YJKA 5AXSA 2ITBA 5JKMG 4ZJKA 5D8RA 1MOJA 3QHBA 3SE1A 5LG2A 4LYXA 3AJQA 5J8WA 2YW6A 4ZKWA 4DYUA 1ZUJA 4AM2A 4CMYV 5J93A 4LQNA 2ZG8X 4TW3A 3T9JA 2C2FA 3PW1B 4PGIA 5GN8B 4ZTTA 3WVUA 2V2MA 3BKNA 3E1QA 2CF7A 1IESA 5JKMA 3F39A 4EVCA 2C2UA 3UNOA 5GU2X 1JREA 5D8YA 3F32A 3ES3A 3MPSA 3R2HA 5FFDA 2Z5PA 1NNQA 1DPSA 2JD80 1N1QA 2Z5QA 3NP0X 2ZA8A 3Q4RA 2ZURX 2OH3A 3E1MA 2BW1A 2VXXA 4RC6B 1LKMA 4TODA 2FG8A 2OC5A 2WLAA 4ITWA 3QVDA 3KWOA 3HL1A 2FHAA 4DI0A 4P18A 3OGHA 3GHQA 3UOFA 4MY7A 1JTSA 3RAVA 5GU0X 3PWQA 1B71A 2ZA7A 5GU1X 4LPMA 1BG7A 4DYZA 1DATA 3AF8X 2CN7A 2VXIA 1JYBA 1MFRA 4M33A 3SIDA 1JKUA 1Z6OM 4LQVA 5GU3X 5J8SA 3PWFA 5D8QA 4TOEA
chains in the Genus database with same CATH superfamily
1TKPA 5IX6A 2FG4A 4KXRB 3RE7A 3DBYA 4TOCA 3ISEA 1F30A 3E6RA 2CN6A 4MKUA 2RBDA 4W4LB 2AR0A 3BVKA 2C41A 3RD0A 4CVPA 4RC5B 3PVTB 2G4HA 2CHIA 2Z6MA 3Q4NA 4LYUA 4KVSA 2ZG7X 3AF9X 3PVYA 2V8UA 3F33A 5JACA 3WVWA 4TO9A 5J9VA 1VEQA 3KX9A 5CZUA 4YVZA 4W4KB 2QQYA 3BVFA 3KA6A 1S3QA 2CLUA 1GWGA 4TOBA 3FVBA 4EVDA 5CMRA 5FFBA 4CVTA 1TK6A 4X0JA 4A25A 1SQ3A 2YJJA 4IXKA 5ERKA 2XJNA 1EUMA 3BVIA 3JZ9A 1HRSA 1JKVA 2XJMA 4ZL5A 2N02A 3IS7A 2XKQA 3Q4QA 4IWKA 1VELA 2C2JA 3QD8A 1TKOA 4YXMA 2ZG9X 2GS4A 2V15A 1H96A 4WJG4 3E1LA 5HU6D 2V2OA 3RBCA 1RCCA 5ERJA 2IU2A 1F33A 5I4JA 4ZKHA 3PVRB 3E1PA 1SOFA 3BT5A 4REUA 2IB0A 1QGHA 3E2CA 2CEIA 2G38B 3FI6A 2C6RA 2X170 1VLGA 4U3GA 4PG1A 2Z90A 3F37A 4YKHA 4CVRA 3IQ1A 4RC7B 3AK9A 4ML5A 4MN9A 5HJFA 3C23A 5C6FA 4II4A 3SHXA 1YUZA 2HR5A 4TOFA 5FFEA 2BK6A 3U90A 1BCFA 1QYBA 2V8TA 3AJPA 5GOUA 3NOZX 3KA9A 3SH6A 1RCGA 4MJYA 3AJOA 5FEJA 1RCDA 2GYDA 4E6KA 5FFAA 4CYAA 3F38A 4ERUA 2WWXB 2CWLA 4EVEA 1XZ1A 2BJYA 3GVYA 2V2SA 5GN8A 2CLBA 2JD60 4DASA 3QZ3A 4CVSA 1JI5A 2Y3QA 5K53A 2V2NA 5E2DA 1VEIA 5FFCA 3GE4A 5D8SA 5JKLG 3R2RA 3BVLA 4XKSA 3IS8A 4RC6A 1YUXA 3C1YA 3WVVA 3EZ0A 2V2LA 2F7NA 1Z4AA 4IWJA 1IERA 3F35A 4LPJA 4ISPA 4PG0A 1FHAA 1S2ZA 3GGYA 1JGCA 2WTLA 4CY9A 1NF6A 5LS9A 4ZMCA 4MXPA 4R42A 2OKCA 3KA8A 2V2RA 3BVEA 1RYTA 4DYXA 2FKZA 4M34A 1RCIA 2V2IA 5JKLA 1UMNA 3EGMA 5JDOB 1KRQA 3C1ZA 1LKPA 2HTNA 3PWQC 2JD70 3KHKA 4CYBA 4MUDA 4ZLWA 3R2MA 3M6JA 1LKOA 1S30A 2Z5RA 2IY4A 4OYNA 3OJ5A 2V2PA 3L0MA 1DVBA 4RC5A 4ZL6A 3PVTA 2VZBA 1VJXA 4ETRA 4TOGA 1YV1A 3PW8A 4Z3BA 4YXJA 3KA4A 3NP2X 4KVQA 3AF7X 4DYYA 1AEWA 4DZ0A 2BKCA 2WLUA 4ZKXA 5LG8A 4TOHA 2CHPA 3R2KA 3F34A 3ISFA 3A9QA 1LB3A 1UVHA 5HJHA 4RC8A 3PVYB 2D5KA 3VNXA 4AM5A 3R2LA 4EVBA 1L8HA 3LKDA 2YW7A 4PGKA 5D8XA 3E6SA 3F36A 1JI4A 2W0OA 2GYQA 4TOAA 3KXUA 4M32A 3TA8A 3KA3A 2UX1A 3AK8A 3C21A 3E1OA 3FSEA 3JZAB 3E1JA 1JIGA 3Q4OA 3QB9A 4KVRA 3PZAA 3PW1A 3O7RA 2PYBA 1NFVA 2CIHA 3R2OA 2FFXJ 3ERZA 5CMQA 3WNWA 5D8OA 2FL0A 3PVRA 4ISMA 3FRSA 2XGWA 3EZUA 1NF4A 4ITTA 4M35A 1OTKA 1XZ3A 3VV9A 2ZA6A 1TJOA 2FZFA 1L8IA 4LPNA 2XJOA 4LQHA 5HQOA 3R2SA 1ZS3A 4RC7A 5K52A 3H7GA 3V3KB 3PW8C 1RCEA 4Z5SA 4CMYA 2V2JA 3QHCA 5E1UA 3D19A 3HIUA 4XGSA 4QUWA 1BFRA 5D8PA 3UOIA 1R03A 4LQJA 1J30A 3E1NA 4Y08A 2QF9A 3RGDA 1Z6OA 3A68A 1O9RA 4XKTA 1O9IA 4DE6A 4AM4A 2MGYA 3O7SA 5LBHA 3KDQA 2FJCA 4II4B 4XKUA 2YJKA 5AXSA 2ITBA 5JKMG 4ZJKA 5D8RA 1MOJA 3QHBA 3SE1A 5LG2A 4LYXA 4E40A 3AJQA 5J8WA 2YW6A 4ZKWA 4DYUA 1ZUJA 4AM2A 4CMYV 5J93A 3VVAA 4LQNA 2ZG8X 4TW3A 3T9JA 2C2FA 3PW1B 4PGIA 5GN8B 4ZTTA 3WVUA 2V2MA 3BKNA 3W54A 3E1QA 2CF7A 1IESA 5JKMA 3F39A 4EVCA 2C2UA 3UNOA 5GU2X 1JREA 5D8YA 3F32A 3ES3A 3MPSA 3R2HA 5FFDA 2Z5PA 1NNQA 1DPSA 2Y44A 2JD80 1N1QA 2Z5QA 3NP0X 2ZA8A 3Q4RA 2ZURX 2OH3A 3E1MA 2BW1A 2VXXA 4RC6B 1LKMA 4TODA 2FG8A 2OC5A 2WLAA 4ITWA 3QVDA 3KWOA 3HL1A 2FHAA 4DI0A 4P18A 3OGHA 3GHQA 5JDOA 3UOFA 4MY7A 1JTSA 3GGZA 3RAVA 5GU0X 3PWQA 1B71A 2ZA7A 3N6OA 5GU1X 4LPMA 1BG7A 4DYZA 1DATA 3AF8X 2CN7A 2VXIA 1JYBA 1MFRA 3FRRA 4M33A 3UFBA 3SIDA 1JKUA 1Z6OM 4LQVA 5GU3X 5J8SA 3PWFA 5D8QA 4TOEA
chains in the Genus database with same CATH topology
1TKPA 5IX6A 2FG4A 4KXRB 3RE7A 3DBYA 4TOCA 3ISEA 1F30A 3E6RA 2CN6A 4MKUA 2RBDA 4W4LB 2AR0A 3BVKA 2C41A 3RD0A 4CVPA 4RC5B 3PVTB 2G4HA 2CHIA 2Z6MA 3Q4NA 4LYUA 4KVSA 2ZG7X 3AF9X 3PVYA 2V8UA 3F33A 5JACA 3WVWA 4TO9A 5J9VA 1VEQA 3KX9A 5CZUA 4YVZA 4W4KB 2QQYA 3BVFA 3KA6A 1S3QA 2CLUA 1GWGA 4TOBA 3FVBA 4EVDA 5CMRA 5FFBA 4CVTA 1TK6A 4X0JA 4A25A 1SQ3A 2YJJA 4IXKA 5ERKA 2XJNA 1EUMA 3BVIA 3JZ9A 1HRSA 1JKVA 2XJMA 4ZL5A 2N02A 3IS7A 2XKQA 3Q4QA 4IWKA 1VELA 2C2JA 3QD8A 1TKOA 4YXMA 2ZG9X 2GS4A 2V15A 1H96A 4WJG4 3E1LA 5HU6D 2V2OA 3RBCA 1RCCA 5ERJA 2IU2A 1F33A 5I4JA 4ZKHA 3PVRB 3E1PA 1SOFA 3BT5A 4REUA 2IB0A 1QGHA 3E2CA 2CEIA 2G38B 3FI6A 2C6RA 2X170 1VLGA 4U3GA 4PG1A 2Z90A 3F37A 4YKHA 4CVRA 3IQ1A 4RC7B 3AK9A 4ML5A 4MN9A 5HJFA 3C23A 5C6FA 4II4A 3SHXA 1YUZA 2HR5A 4TOFA 5FFEA 2BK6A 3U90A 1BCFA 1QYBA 2V8TA 3AJPA 5GOUA 3NOZX 3KA9A 3SH6A 1RCGA 4MJYA 3AJOA 5FEJA 1RCDA 2GYDA 4E6KA 5FFAA 4CYAA 3F38A 4ERUA 2WWXB 2CWLA 4EVEA 1XZ1A 2BJYA 3GVYA 2V2SA 5GN8A 2CLBA 2JD60 4DASA 3QZ3A 4CVSA 1JI5A 2Y3QA 5K53A 2V2NA 5E2DA 1VEIA 5FFCA 3GE4A 5D8SA 5JKLG 3R2RA 3BVLA 4XKSA 3IS8A 4RC6A 1YUXA 3C1YA 3WVVA 3EZ0A 2V2LA 2F7NA 1Z4AA 4IWJA 1IERA 3F35A 4LPJA 4ISPA 4PG0A 1FHAA 1S2ZA 3GGYA 1JGCA 2WTLA 4CY9A 1NF6A 5LS9A 4ZMCA 4MXPA 4R42A 2OKCA 3KA8A 2V2RA 3BVEA 1RYTA 4DYXA 2FKZA 4M34A 1RCIA 2V2IA 5JKLA 1UMNA 3EGMA 5JDOB 1KRQA 3C1ZA 1LKPA 2HTNA 3PWQC 2JD70 3KHKA 4CYBA 4MUDA 4ZLWA 3R2MA 3M6JA 1LKOA 1S30A 2Z5RA 2IY4A 4OYNA 3OJ5A 2V2PA 3L0MA 1DVBA 4RC5A 4ZL6A 3PVTA 2VZBA 1VJXA 4ETRA 4TOGA 1YV1A 3PW8A 4Z3BA 4YXJA 3KA4A 3NP2X 4KVQA 3AF7X 4DYYA 1AEWA 4DZ0A 2BKCA 2WLUA 4ZKXA 5LG8A 4TOHA 2CHPA 3R2KA 3F34A 3ISFA 3A9QA 1LB3A 1UVHA 5HJHA 4RC8A 3PVYB 2D5KA 3VNXA 4AM5A 3R2LA 4EVBA 1L8HA 3LKDA 2YW7A 4PGKA 5D8XA 3E6SA 3F36A 1JI4A 2W0OA 2GYQA 4TOAA 3KXUA 4M32A 3TA8A 3KA3A 2UX1A 3AK8A 3C21A 3E1OA 3FSEA 3JZAB 3E1JA 1JIGA 3Q4OA 3QB9A 4KVRA 3PZAA 3PW1A 3O7RA 2PYBA 1NFVA 2CIHA 3R2OA 2FFXJ 3ERZA 5CMQA 3WNWA 5D8OA 2FL0A 3PVRA 4ISMA 3FRSA 2XGWA 3EZUA 1NF4A 4ITTA 4M35A 1OTKA 1XZ3A 3VV9A 2ZA6A 1TJOA 2FZFA 1L8IA 4LPNA 2XJOA 4LQHA 5HQOA 3R2SA 1ZS3A 4RC7A 5K52A 3H7GA 3V3KB 3PW8C 1RCEA 4Z5SA 4CMYA 2V2JA 3QHCA 5E1UA 3D19A 3HIUA 4XGSA 4QUWA 1BFRA 5D8PA 3UOIA 1R03A 4LQJA 1J30A 3E1NA 4Y08A 2QF9A 3RGDA 1Z6OA 3A68A 1O9RA 4XKTA 1O9IA 4DE6A 4AM4A 2MGYA 3O7SA 5LBHA 3KDQA 2FJCA 4II4B 4XKUA 2YJKA 5AXSA 2ITBA 5JKMG 4ZJKA 5D8RA 1MOJA 3QHBA 3SE1A 5LG2A 4LYXA 4E40A 3AJQA 5J8WA 2YW6A 4ZKWA 4DYUA 1ZUJA 4AM2A 4CMYV 5J93A 3VVAA 4LQNA 2ZG8X 4TW3A 3T9JA 2C2FA 3PW1B 4PGIA 5GN8B 4ZTTA 3WVUA 2V2MA 3BKNA 3W54A 3E1QA 2CF7A 1IESA 5JKMA 3F39A 4EVCA 2C2UA 3UNOA 5GU2X 1JREA 5D8YA 3F32A 3ES3A 3MPSA 3R2HA 5FFDA 2Z5PA 1NNQA 1DPSA 2Y44A 2JD80 1N1QA 2Z5QA 3NP0X 2ZA8A 3Q4RA 2ZURX 2OH3A 3E1MA 2BW1A 2VXXA 4RC6B 1LKMA 4TODA 2FG8A 2OC5A 2WLAA 4ITWA 3QVDA 3KWOA 3HL1A 2FHAA 4DI0A 4P18A 3OGHA 3GHQA 5JDOA 3UOFA 4MY7A 1JTSA 3GGZA 3RAVA 5GU0X 3PWQA 1B71A 2ZA7A 3N6OA 5GU1X 4LPMA 1BG7A 4DYZA 1DATA 3AF8X 2CN7A 2VXIA 1JYBA 1MFRA 3FRRA 4M33A 3UFBA 3SIDA 1JKUA 1Z6OM 4LQVA 5GU3X 5J8SA 3PWFA 5D8QA 4TOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TKP A;  5IX6 A;  2FG4 A;  3RE7 A;  4TOC A;  3ISE A;  1F30 A;  3E6R A;  2CN6 A;  4MKU A;  2RBD A;  3BVK A;  2C41 A;  3RD0 A;  4CVP A;  4RC5 B;  3PVT B;  2G4H A;  2CHI A;  2Z6M A;  3Q4N A;  4LYU A;  4KVS A;  2ZG7 X;  3AF9 X;  3PVY A;  3F33 A;  5JAC A;  3WVW A;  4TO9 A;  5J9V A;  1VEQ A;  3KX9 A;  5CZU A;  2QQY A;  3BVF A;  3KA6 A;  1S3Q A;  2CLU A;  1GWG A;  4TOB A;  3FVB A;  4EVD A;  5CMR A;  5FFB A;  4CVT A;  1TK6 A;  4A25 A;  1SQ3 A;  2YJJ A;  4IXK A;  5ERK A;  2XJN A;  1EUM A;  3BVI A;  1HRS A;  1JKV A;  2XJM A;  4ZL5 A;  3IS7 A;  2XKQ A;  3Q4Q A;  4IWK A;  1VEL A;  2C2J A;  3QD8 A;  1TKO A;  2ZG9 X;  2GS4 A;  2V15 A;  1H96 A;  3E1L A;  2V2O A;  3RBC A;  1RCC A;  5ERJ A;  2IU2 A;  1F33 A;  5I4J A;  4ZKH A;  3PVR B;  3E1P A;  1SOF A;  3BT5 A;  4REU A;  2IB0 A;  1QGH A;  3E2C A;  2CEI A;  3FI6 A;  2C6R A;  2X17 0;  1VLG A;  4U3G A;  4PG1 A;  2Z90 A;  3F37 A;  4YKH A;  4CVR A;  3IQ1 A;  4RC7 B;  3AK9 A;  4ML5 A;  4MN9 A;  5HJF A;  5C6F A;  4II4 A;  3SHX A;  1YUZ A;  2HR5 A;  4TOF A;  5FFE A;  2BK6 A;  3U90 A;  1BCF A;  1QYB A;  5GOU A;  3AJP A;  3NOZ X;  3KA9 A;  3SH6 A;  1RCG A;  4MJY A;  3AJO A;  5FEJ A;  1RCD A;  2GYD A;  4E6K A;  5FFA A;  4CYA A;  3F38 A;  4ERU A;  4EVE A;  1XZ1 A;  2BJY A;  3GVY A;  2V2S A;  5GN8 A;  2CLB A;  2JD6 0;  4DAS A;  3QZ3 A;  4CVS A;  1JI5 A;  2Y3Q A;  5K53 A;  2V2N A;  5E2D A;  1VEI A;  5FFC A;  3GE4 A;  5D8S A;  5JKL G;  3R2R A;  3BVL A;  4XKS A;  3IS8 A;  4RC6 A;  1YUX A;  3WVV A;  3EZ0 A;  2V2L A;  2F7N A;  1Z4A A;  4IWJ A;  1IER A;  3F35 A;  4LPJ A;  4ISP A;  4PG0 A;  1FHA A;  1S2Z A;  1JGC A;  2WTL A;  4CY9 A;  1NF6 A;  5LS9 A;  4ZMC A;  4R42 A;  3KA8 A;  2V2R A;  3BVE A;  1RYT A;  4DYX A;  2FKZ A;  4M34 A;  1RCI A;  2V2I A;  5JKL A;  1UMN A;  3EGM A;  1KRQ A;  1LKP A;  2HTN A;  3PWQ C;  2JD7 0;  4CYB A;  4MUD A;  4ZLW A;  3R2M A;  1LKO A;  1S30 A;  2Z5R A;  2IY4 A;  4OYN A;  3OJ5 A;  2V2P A;  1DVB A;  4RC5 A;  4ZL6 A;  3PVT A;  2VZB A;  1VJX A;  4ETR A;  4TOG A;  1YV1 A;  3PW8 A;  4Z3B A;  3KA4 A;  3NP2 X;  4KVQ A;  3AF7 X;  4DYY A;  1AEW A;  4DZ0 A;  2BKC A;  2WLU A;  4ZKX A;  5LG8 A;  4TOH A;  2CHP A;  3R2K A;  3F34 A;  3ISF A;  3A9Q A;  1LB3 A;  1UVH A;  5HJH A;  4RC8 A;  3PVY B;  2D5K A;  3VNX A;  4AM5 A;  3R2L A;  4EVB A;  1L8H A;  2YW7 A;  4PGK A;  5D8X A;  3E6S A;  3F36 A;  1JI4 A;  2W0O A;  2GYQ A;  4TOA A;  3KXU A;  4M32 A;  3TA8 A;  3KA3 A;  2UX1 A;  3AK8 A;  3E1O A;  3FSE A;  3E1J A;  1JIG A;  3Q4O A;  3QB9 A;  4KVR A;  3PZA A;  3PW1 A;  3O7R A;  2PYB A;  1NFV A;  2CIH A;  3R2O A;  2FFX J;  3ERZ A;  5CMQ A;  3WNW A;  5D8O A;  2FL0 A;  3PVR A;  4ISM A;  2XGW A;  3EZU A;  1NF4 A;  4ITT A;  4M35 A;  1OTK A;  1XZ3 A;  2ZA6 A;  1TJO A;  2FZF A;  1L8I A;  4LPN A;  2XJO A;  4LQH A;  5HQO A;  3R2S A;  1ZS3 A;  4RC7 A;  5K52 A;  3H7G A;  3PW8 C;  1RCE A;  4Z5S A;  4CMY A;  2V2J A;  3QHC A;  5E1U A;  3HIU A;  4XGS A;  4QUW A;  1BFR A;  5D8P A;  3UOI A;  1R03 A;  4LQJ A;  1J30 A;  3E1N A;  4Y08 A;  2QF9 A;  3RGD A;  1Z6O A;  3A68 A;  1O9R A;  4XKT A;  1O9I A;  4DE6 A;  4AM4 A;  3O7S A;  5LBH A;  2FJC A;  4II4 B;  4XKU A;  2YJK A;  5AXS A;  2ITB A;  5JKM G;  4ZJK A;  5D8R A;  1MOJ A;  3QHB A;  3SE1 A;  5LG2 A;  4LYX A;  3AJQ A;  5J8W A;  2YW6 A;  4ZKW A;  4DYU A;  1ZUJ A;  4AM2 A;  4CMY V;  5J93 A;  4LQN A;  2ZG8 X;  4TW3 A;  3T9J A;  2C2F A;  3PW1 B;  4PGI A;  5GN8 B;  4ZTT A;  3WVU A;  2V2M A;  3BKN A;  3E1Q A;  2CF7 A;  1IES A;  5JKM A;  3F39 A;  4EVC A;  2C2U A;  3UNO A;  5GU2 X;  1JRE A;  5D8Y A;  3F32 A;  3ES3 A;  3MPS A;  3R2H A;  5FFD A;  2Z5P A;  1NNQ A;  1DPS A;  2JD8 0;  1N1Q A;  2Z5Q A;  3NP0 X;  2ZA8 A;  3Q4R A;  2ZUR X;  2OH3 A;  3E1M A;  2BW1 A;  2VXX A;  4RC6 B;  1LKM A;  4TOD A;  2FG8 A;  2OC5 A;  2WLA A;  4ITW A;  3QVD A;  3KWO A;  3HL1 A;  2FHA A;  4DI0 A;  4P18 A;  3OGH A;  3GHQ A;  3UOF A;  4MY7 A;  1JTS A;  3RAV A;  5GU0 X;  3PWQ A;  1B71 A;  2ZA7 A;  5GU1 X;  4LPM A;  1BG7 A;  4DYZ A;  1DAT A;  3AF8 X;  2CN7 A;  2VXI A;  1JYB A;  1MFR A;  4M33 A;  3SID A;  1JKU A;  1Z6O M;  4LQV A;  5GU3 X;  5J8S A;  3PWF A;  5D8Q A;  4TOE A; 
#chains in the Genus database with same CATH topology
 1TKP A;  5IX6 A;  2FG4 A;  4KXR B;  3RE7 A;  3DBY A;  4TOC A;  3ISE A;  1F30 A;  3E6R A;  2CN6 A;  4MKU A;  2RBD A;  4W4L B;  2AR0 A;  3BVK A;  2C41 A;  3RD0 A;  4CVP A;  4RC5 B;  3PVT B;  2G4H A;  2CHI A;  2Z6M A;  3Q4N A;  4LYU A;  4KVS A;  2ZG7 X;  3AF9 X;  3PVY A;  2V8U A;  3F33 A;  5JAC A;  3WVW A;  4TO9 A;  5J9V A;  1VEQ A;  3KX9 A;  5CZU A;  4YVZ A;  4W4K B;  2QQY A;  3BVF A;  3KA6 A;  1S3Q A;  2CLU A;  1GWG A;  4TOB A;  3FVB A;  4EVD A;  5CMR A;  5FFB A;  4CVT A;  1TK6 A;  4X0J A;  4A25 A;  1SQ3 A;  2YJJ A;  4IXK A;  5ERK A;  2XJN A;  1EUM A;  3BVI A;  3JZ9 A;  1HRS A;  1JKV A;  2XJM A;  4ZL5 A;  2N02 A;  3IS7 A;  2XKQ A;  3Q4Q A;  4IWK A;  1VEL A;  2C2J A;  3QD8 A;  1TKO A;  4YXM A;  2ZG9 X;  2GS4 A;  2V15 A;  1H96 A;  4WJG 4;  3E1L A;  5HU6 D;  2V2O A;  3RBC A;  1RCC A;  5ERJ A;  2IU2 A;  1F33 A;  5I4J A;  4ZKH A;  3PVR B;  3E1P A;  1SOF A;  3BT5 A;  4REU A;  2IB0 A;  1QGH A;  3E2C A;  2CEI A;  2G38 B;  3FI6 A;  2C6R A;  2X17 0;  1VLG A;  4U3G A;  4PG1 A;  2Z90 A;  3F37 A;  4YKH A;  4CVR A;  3IQ1 A;  4RC7 B;  3AK9 A;  4ML5 A;  4MN9 A;  5HJF A;  3C23 A;  5C6F A;  4II4 A;  3SHX A;  1YUZ A;  2HR5 A;  4TOF A;  5FFE A;  2BK6 A;  3U90 A;  1BCF A;  1QYB A;  2V8T A;  3AJP A;  5GOU A;  3NOZ X;  3KA9 A;  3SH6 A;  1RCG A;  4MJY A;  3AJO A;  5FEJ A;  1RCD A;  2GYD A;  4E6K A;  5FFA A;  4CYA A;  3F38 A;  4ERU A;  2WWX B;  2CWL A;  4EVE A;  1XZ1 A;  2BJY A;  3GVY A;  2V2S A;  5GN8 A;  2CLB A;  2JD6 0;  4DAS A;  3QZ3 A;  4CVS A;  1JI5 A;  2Y3Q A;  5K53 A;  2V2N A;  5E2D A;  1VEI A;  5FFC A;  3GE4 A;  5D8S A;  5JKL G;  3R2R A;  3BVL A;  4XKS A;  3IS8 A;  4RC6 A;  1YUX A;  3C1Y A;  3WVV A;  3EZ0 A;  2V2L A;  2F7N A;  1Z4A A;  4IWJ A;  1IER A;  3F35 A;  4LPJ A;  4ISP A;  4PG0 A;  1FHA A;  1S2Z A;  3GGY A;  1JGC A;  2WTL A;  4CY9 A;  1NF6 A;  5LS9 A;  4ZMC A;  4MXP A;  4R42 A;  2OKC A;  3KA8 A;  2V2R A;  3BVE A;  1RYT A;  4DYX A;  2FKZ A;  4M34 A;  1RCI A;  2V2I A;  5JKL A;  1UMN A;  3EGM A;  5JDO B;  1KRQ A;  3C1Z A;  1LKP A;  2HTN A;  3PWQ C;  2JD7 0;  3KHK A;  4CYB A;  4MUD A;  4ZLW A;  3R2M A;  3M6J A;  1LKO A;  1S30 A;  2Z5R A;  2IY4 A;  4OYN A;  3OJ5 A;  2V2P A;  3L0M A;  1DVB A;  4RC5 A;  4ZL6 A;  3PVT A;  2VZB A;  1VJX A;  4ETR A;  4TOG A;  1YV1 A;  3PW8 A;  4Z3B A;  4YXJ A;  3KA4 A;  3NP2 X;  4KVQ A;  3AF7 X;  4DYY A;  1AEW A;  4DZ0 A;  2BKC A;  2WLU A;  4ZKX A;  5LG8 A;  4TOH A;  2CHP A;  3R2K A;  3F34 A;  3ISF A;  3A9Q A;  1LB3 A;  1UVH A;  5HJH A;  4RC8 A;  3PVY B;  2D5K A;  3VNX A;  4AM5 A;  3R2L A;  4EVB A;  1L8H A;  3LKD A;  2YW7 A;  4PGK A;  5D8X A;  3E6S A;  3F36 A;  1JI4 A;  2W0O A;  2GYQ A;  4TOA A;  3KXU A;  4M32 A;  3TA8 A;  3KA3 A;  2UX1 A;  3AK8 A;  3C21 A;  3E1O A;  3FSE A;  3JZA B;  3E1J A;  1JIG A;  3Q4O A;  3QB9 A;  4KVR A;  3PZA A;  3PW1 A;  3O7R A;  2PYB A;  1NFV A;  2CIH A;  3R2O A;  2FFX J;  3ERZ A;  5CMQ A;  3WNW A;  5D8O A;  2FL0 A;  3PVR A;  4ISM A;  3FRS A;  2XGW A;  3EZU A;  1NF4 A;  4ITT A;  4M35 A;  1OTK A;  1XZ3 A;  3VV9 A;  2ZA6 A;  1TJO A;  2FZF A;  1L8I A;  4LPN A;  2XJO A;  4LQH A;  5HQO A;  3R2S A;  1ZS3 A;  4RC7 A;  5K52 A;  3H7G A;  3V3K B;  3PW8 C;  1RCE A;  4Z5S A;  4CMY A;  2V2J A;  3QHC A;  5E1U A;  3D19 A;  3HIU A;  4XGS A;  4QUW A;  1BFR A;  5D8P A;  3UOI A;  1R03 A;  4LQJ A;  1J30 A;  3E1N A;  4Y08 A;  2QF9 A;  3RGD A;  1Z6O A;  3A68 A;  1O9R A;  4XKT A;  1O9I A;  4DE6 A;  4AM4 A;  2MGY A;  3O7S A;  5LBH A;  3KDQ A;  2FJC A;  4II4 B;  4XKU A;  2YJK A;  5AXS A;  2ITB A;  5JKM G;  4ZJK A;  5D8R A;  1MOJ A;  3QHB A;  3SE1 A;  5LG2 A;  4LYX A;  4E40 A;  3AJQ A;  5J8W A;  2YW6 A;  4ZKW A;  4DYU A;  1ZUJ A;  4AM2 A;  4CMY V;  5J93 A;  3VVA A;  4LQN A;  2ZG8 X;  4TW3 A;  3T9J A;  2C2F A;  3PW1 B;  4PGI A;  5GN8 B;  4ZTT A;  3WVU A;  2V2M A;  3BKN A;  3W54 A;  3E1Q A;  2CF7 A;  1IES A;  5JKM A;  3F39 A;  4EVC A;  2C2U A;  3UNO A;  5GU2 X;  1JRE A;  5D8Y A;  3F32 A;  3ES3 A;  3MPS A;  3R2H A;  5FFD A;  2Z5P A;  1NNQ A;  1DPS A;  2Y44 A;  2JD8 0;  1N1Q A;  2Z5Q A;  3NP0 X;  2ZA8 A;  3Q4R A;  2ZUR X;  2OH3 A;  3E1M A;  2BW1 A;  2VXX A;  4RC6 B;  1LKM A;  4TOD A;  2FG8 A;  2OC5 A;  2WLA A;  4ITW A;  3QVD A;  3KWO A;  3HL1 A;  2FHA A;  4DI0 A;  4P18 A;  3OGH A;  3GHQ A;  5JDO A;  3UOF A;  4MY7 A;  1JTS A;  3GGZ A;  3RAV A;  5GU0 X;  3PWQ A;  1B71 A;  2ZA7 A;  3N6O A;  5GU1 X;  4LPM A;  1BG7 A;  4DYZ A;  1DAT A;  3AF8 X;  2CN7 A;  2VXI A;  1JYB A;  1MFR A;  3FRR A;  4M33 A;  3UFB A;  3SID A;  1JKU A;  1Z6O M;  4LQV A;  5GU3 X;  5J8S A;  3PWF A;  5D8Q A;  4TOE A; 
#chains in the Genus database with same CATH homology
 1TKP A;  5IX6 A;  2FG4 A;  4KXR B;  3RE7 A;  3DBY A;  4TOC A;  3ISE A;  1F30 A;  3E6R A;  2CN6 A;  4MKU A;  2RBD A;  4W4L B;  2AR0 A;  3BVK A;  2C41 A;  3RD0 A;  4CVP A;  4RC5 B;  3PVT B;  2G4H A;  2CHI A;  2Z6M A;  3Q4N A;  4LYU A;  4KVS A;  2ZG7 X;  3AF9 X;  3PVY A;  2V8U A;  3F33 A;  5JAC A;  3WVW A;  4TO9 A;  5J9V A;  1VEQ A;  3KX9 A;  5CZU A;  4YVZ A;  4W4K B;  2QQY A;  3BVF A;  3KA6 A;  1S3Q A;  2CLU A;  1GWG A;  4TOB A;  3FVB A;  4EVD A;  5CMR A;  5FFB A;  4CVT A;  1TK6 A;  4X0J A;  4A25 A;  1SQ3 A;  2YJJ A;  4IXK A;  5ERK A;  2XJN A;  1EUM A;  3BVI A;  3JZ9 A;  1HRS A;  1JKV A;  2XJM A;  4ZL5 A;  2N02 A;  3IS7 A;  2XKQ A;  3Q4Q A;  4IWK A;  1VEL A;  2C2J A;  3QD8 A;  1TKO A;  4YXM A;  2ZG9 X;  2GS4 A;  2V15 A;  1H96 A;  4WJG 4;  3E1L A;  5HU6 D;  2V2O A;  3RBC A;  1RCC A;  5ERJ A;  2IU2 A;  1F33 A;  5I4J A;  4ZKH A;  3PVR B;  3E1P A;  1SOF A;  3BT5 A;  4REU A;  2IB0 A;  1QGH A;  3E2C A;  2CEI A;  2G38 B;  3FI6 A;  2C6R A;  2X17 0;  1VLG A;  4U3G A;  4PG1 A;  2Z90 A;  3F37 A;  4YKH A;  4CVR A;  3IQ1 A;  4RC7 B;  3AK9 A;  4ML5 A;  4MN9 A;  5HJF A;  3C23 A;  5C6F A;  4II4 A;  3SHX A;  1YUZ A;  2HR5 A;  4TOF A;  5FFE A;  2BK6 A;  3U90 A;  1BCF A;  1QYB A;  2V8T A;  3AJP A;  5GOU A;  3NOZ X;  3KA9 A;  3SH6 A;  1RCG A;  4MJY A;  3AJO A;  5FEJ A;  1RCD A;  2GYD A;  4E6K A;  5FFA A;  4CYA A;  3F38 A;  4ERU A;  2WWX B;  2CWL A;  4EVE A;  1XZ1 A;  2BJY A;  3GVY A;  2V2S A;  5GN8 A;  2CLB A;  2JD6 0;  4DAS A;  3QZ3 A;  4CVS A;  1JI5 A;  2Y3Q A;  5K53 A;  2V2N A;  5E2D A;  1VEI A;  5FFC A;  3GE4 A;  5D8S A;  5JKL G;  3R2R A;  3BVL A;  4XKS A;  3IS8 A;  4RC6 A;  1YUX A;  3C1Y A;  3WVV A;  3EZ0 A;  2V2L A;  2F7N A;  1Z4A A;  4IWJ A;  1IER A;  3F35 A;  4LPJ A;  4ISP A;  4PG0 A;  1FHA A;  1S2Z A;  3GGY A;  1JGC A;  2WTL A;  4CY9 A;  1NF6 A;  5LS9 A;  4ZMC A;  4MXP A;  4R42 A;  2OKC A;  3KA8 A;  2V2R A;  3BVE A;  1RYT A;  4DYX A;  2FKZ A;  4M34 A;  1RCI A;  2V2I A;  5JKL A;  1UMN A;  3EGM A;  5JDO B;  1KRQ A;  3C1Z A;  1LKP A;  2HTN A;  3PWQ C;  2JD7 0;  3KHK A;  4CYB A;  4MUD A;  4ZLW A;  3R2M A;  3M6J A;  1LKO A;  1S30 A;  2Z5R A;  2IY4 A;  4OYN A;  3OJ5 A;  2V2P A;  3L0M A;  1DVB A;  4RC5 A;  4ZL6 A;  3PVT A;  2VZB A;  1VJX A;  4ETR A;  4TOG A;  1YV1 A;  3PW8 A;  4Z3B A;  4YXJ A;  3KA4 A;  3NP2 X;  4KVQ A;  3AF7 X;  4DYY A;  1AEW A;  4DZ0 A;  2BKC A;  2WLU A;  4ZKX A;  5LG8 A;  4TOH A;  2CHP A;  3R2K A;  3F34 A;  3ISF A;  3A9Q A;  1LB3 A;  1UVH A;  5HJH A;  4RC8 A;  3PVY B;  2D5K A;  3VNX A;  4AM5 A;  3R2L A;  4EVB A;  1L8H A;  3LKD A;  2YW7 A;  4PGK A;  5D8X A;  3E6S A;  3F36 A;  1JI4 A;  2W0O A;  2GYQ A;  4TOA A;  3KXU A;  4M32 A;  3TA8 A;  3KA3 A;  2UX1 A;  3AK8 A;  3C21 A;  3E1O A;  3FSE A;  3JZA B;  3E1J A;  1JIG A;  3Q4O A;  3QB9 A;  4KVR A;  3PZA A;  3PW1 A;  3O7R A;  2PYB A;  1NFV A;  2CIH A;  3R2O A;  2FFX J;  3ERZ A;  5CMQ A;  3WNW A;  5D8O A;  2FL0 A;  3PVR A;  4ISM A;  3FRS A;  2XGW A;  3EZU A;  1NF4 A;  4ITT A;  4M35 A;  1OTK A;  1XZ3 A;  3VV9 A;  2ZA6 A;  1TJO A;  2FZF A;  1L8I A;  4LPN A;  2XJO A;  4LQH A;  5HQO A;  3R2S A;  1ZS3 A;  4RC7 A;  5K52 A;  3H7G A;  3V3K B;  3PW8 C;  1RCE A;  4Z5S A;  4CMY A;  2V2J A;  3QHC A;  5E1U A;  3D19 A;  3HIU A;  4XGS A;  4QUW A;  1BFR A;  5D8P A;  3UOI A;  1R03 A;  4LQJ A;  1J30 A;  3E1N A;  4Y08 A;  2QF9 A;  3RGD A;  1Z6O A;  3A68 A;  1O9R A;  4XKT A;  1O9I A;  4DE6 A;  4AM4 A;  2MGY A;  3O7S A;  5LBH A;  3KDQ A;  2FJC A;  4II4 B;  4XKU A;  2YJK A;  5AXS A;  2ITB A;  5JKM G;  4ZJK A;  5D8R A;  1MOJ A;  3QHB A;  3SE1 A;  5LG2 A;  4LYX A;  4E40 A;  3AJQ A;  5J8W A;  2YW6 A;  4ZKW A;  4DYU A;  1ZUJ A;  4AM2 A;  4CMY V;  5J93 A;  3VVA A;  4LQN A;  2ZG8 X;  4TW3 A;  3T9J A;  2C2F A;  3PW1 B;  4PGI A;  5GN8 B;  4ZTT A;  3WVU A;  2V2M A;  3BKN A;  3W54 A;  3E1Q A;  2CF7 A;  1IES A;  5JKM A;  3F39 A;  4EVC A;  2C2U A;  3UNO A;  5GU2 X;  1JRE A;  5D8Y A;  3F32 A;  3ES3 A;  3MPS A;  3R2H A;  5FFD A;  2Z5P A;  1NNQ A;  1DPS A;  2Y44 A;  2JD8 0;  1N1Q A;  2Z5Q A;  3NP0 X;  2ZA8 A;  3Q4R A;  2ZUR X;  2OH3 A;  3E1M A;  2BW1 A;  2VXX A;  4RC6 B;  1LKM A;  4TOD A;  2FG8 A;  2OC5 A;  2WLA A;  4ITW A;  3QVD A;  3KWO A;  3HL1 A;  2FHA A;  4DI0 A;  4P18 A;  3OGH A;  3GHQ A;  5JDO A;  3UOF A;  4MY7 A;  1JTS A;  3GGZ A;  3RAV A;  5GU0 X;  3PWQ A;  1B71 A;  2ZA7 A;  3N6O A;  5GU1 X;  4LPM A;  1BG7 A;  4DYZ A;  1DAT A;  3AF8 X;  2CN7 A;  2VXI A;  1JYB A;  1MFR A;  3FRR A;  4M33 A;  3UFB A;  3SID A;  1JKU A;  1Z6O M;  4LQV A;  5GU3 X;  5J8S A;  3PWF A;  5D8Q A;  4TOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...