2YJJA

Structure of dps from microbacterium arborescens in the low iron form
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
149
structure length
149
Chain Sequence
ADPEVAAAAAQFLTPVVHKMQALVVNGKQAHWNVRGSNFIAIHELLDSVVAHAQDYADTAAERIVALGLPIDSRVSTMAEKTSTAVPAGFAQWQDEIKAIVSDIDAALVDLQAAIDGLDEVDLTSQDVAIEIKRGVDKDRWFLLAHLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords AFP
publication title Structure and Mechanism of Iron Translocation by a Dps Protein from Microbacterium Arborescens.
pubmed doi rcsb
total genus 63
structure length 149
sequence length 149
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2011-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2yjjA00
1EUMA 4ETRA 3H7GA 1RCGA 4REUA 1S2ZA 1IERA 3Q4OA 3SIDA 4RC7A 2GYDA 3WNWA 2YJJA 2W0OA 2C2FA 2JD60 3E6RA 2YW7A 3Q4RA 1L8IA 3ISEA 3PVYA 3AJQA 3QHBA 1AEWA 4ZKXA 3EZUA 4LPNA 5D8PA 3A9QA 5CZUA 2FHAA 4YKHA 4OYNA 1F30A 2WLAA 1Z4AA 1UVHA 3T9JA 2V2IA 1BG7A 4E6KA 5JKLG 4DYZA 2CN6A 2PYBA 3BVIA 1TKPA 4ZLWA 1TJOA 1B71A 4CMYV 3NP0X 4DYXA 4LQHA 4RC6A 2WTLA 3BVKA 4U3GA 4TOEA 2VZBA 3F34A 3RAVA 1LB3A 3R2KA 3PVTA 3O7RA 4MUDA 5GOUA 1H96A 1ZUJA 4M33A 1SOFA 3GVYA 4DI0A 2V2MA 2V2JA 1JKVA 3PW8A 4DE6A 1TKOA 3R2RA 5JKLA 3F32A 3NP2X 5GN8B 2Z5PA 3BVLA 3E1QA 3PW1A 4M32A 1LKPA 2VXIA 4TO9A 1MOJA 3AF9X 5E2DA 5FFAA 5ERKA 5I4JA 1F33A 3QB9A 3BVEA 5IX6A 4ZMCA 2OH3A 5FFDA 5LG8A 4AM5A 5E1UA 2ZG9X 3RGDA 2XGWA 1JREA 2V2LA 2ZG8X 1BFRA 2Z6MA 4CVRA 3F33A 2IU2A 3F39A 1NFVA 2ZG7X 4ITTA 2OC5A 1DVBA 4MY7A 2Y3QA 5AXSA 2ZURX 5J8SA 1QYBA 5D8YA 3RD0A 1JIGA 2CHPA 1S3QA 2XKQA 5HJHA 5D8OA 1O9RA 4ERUA 3EGMA 5FFBA 4Z5SA 5FFCA 3SE1A 3E1LA 3FVBA 3OGHA 2C2JA 3RBCA 4DYUA 4TOBA 3U90A 4II4A 2CN7A 3KA3A 4RC5B 5JKMA 2CLBA 3PVRA 3KA6A 1R03A 1Z6OA 3BKNA 4LQVA 3NOZX 4EVEA 5GU1X 2FL0A 3RE7A 3QHCA 3BVFA 4KVRA 4ISPA 3E1MA 4CVTA 4ZTTA 1BCFA 3UOFA 3HIUA 3MPSA 3KA4A 1UMNA 3BT5A 2QF9A 3HL1A 3R2MA 3TA8A 4RC7B 4MJYA 3AK8A 2JD70 1RCCA 4CY9A 1HRSA 1RCDA 3PVYB 5GU2X 5D8QA 3R2OA 4P18A 4XGSA 2ZA8A 1SQ3A 1VELA 1LKOA 4ISMA 5GU0X 5J93A 5J8WA 3E1JA 3KA9A 2BJYA 4QUWA 3UOIA 3IQ1A 2FKZA 3ES3A 4CVPA 2WLUA 4CMYA 2V2PA 1RCEA 4XKUA 1DATA 2UX1A 4TOAA 3E2CA 3PZAA 1NF4A 2HR5A 4AM4A 5JKMG 5GU3X 3F36A 4CYBA 3PVTB 3E6SA 3IS7A 3VNXA 3ERZA 5C6FA 4ZL6A 1VEQA 2CHIA 4TOGA 1RYTA 3WVUA 1JI5A 3FI6A 2V2RA 2C2UA 4PGKA 4ZL5A 1ZS3A 4EVBA 4LPJA 2CF7A 4RC8A 1XZ1A 2GS4A 5D8RA 1RCIA 4EVDA 5D8SA 5CMQA 1S30A 3QD8A 4R42A 4ML5A 4ZKWA 1Z6OM 2ITBA 3R2HA 4MKUA 5D8XA 2IY4A 2V2SA 4KVQA 4Z3BA 3KX9A 5K52A 1DPSA 1GWGA 1MFRA 5ERJA 2JD80 2V15A 4Y08A 2GYQA 4PG0A 4XKSA 2CIHA 3PWFA 2C41A 2BK6A 4ITWA 2Z5QA 3WVVA 2BW1A 1NNQA 2XJMA 1VLGA 3E1PA 1TK6A 3PW8C 4TOFA 4KVSA 1OTKA 2V2OA 3QVDA 4XKTA 1IESA 4M35A 5HJFA 4A25A 4DZ0A 4DYYA 3GE4A 3Q4QA 3F35A 1KRQA 5LS9A 1L8HA 3ISFA 4II4B 2YJKA 2FFXJ 1JI4A 2QQYA 5GN8A 4TW3A 3KXUA 3E1OA 2Z90A 4DASA 2CLUA 2FG4A 3PVRB 3EZ0A 1LKMA 1NF6A 4IWKA 4PGIA 1JYBA 2HTNA 4IXKA 2C6RA 2V2NA 3GHQA 3KWOA 3OJ5A 2F7NA 2G4HA 4MN9A 2XJOA 3PWQC 1J30A 3E1NA 1YV1A 1O9IA 5LBHA 5CMRA 4TOCA 2Z5RA 4M34A 2RBDA 1JTSA 2D5KA 4LYUA 2IB0A 1VEIA 3Q4NA 4CVSA 4CYAA 4IWJA 3QZ3A 1XZ3A 4RC6B 1FHAA 1QGHA 1JKUA 1VJXA 5LG2A 4LQNA 3AJPA 3SHXA 3SH6A 4ZJKA 2ZA7A 3AF7X 4ZKHA 2XJNA 3UNOA 1N1QA 2YW6A 2CEIA 2BKCA 2X170 4TOHA 3F38A 4LYXA 4RC5A 4LPMA 3O7SA 3PW1B 3F37A 5HQOA 1JGCA 3AJOA 4EVCA 5FEJA 3IS8A 4PG1A 2FG8A 4TODA 3R2LA 3A68A 3AF8X 4LQJA 1YUXA 3R2SA 2FZFA 3AK9A 4AM2A 3KA8A 2ZA6A 2FJCA 3PWQA 5JACA 5K53A 2VXXA 5FFEA 3WVWA 5J9VA 1YUZA 3FSEA
chains in the Genus database with same CATH superfamily
1EUMA 4ETRA 3H7GA 1RCGA 4REUA 3GGYA 1S2ZA 1IERA 3Q4OA 3SIDA 4RC7A 2GYDA 3WNWA 2YJJA 2W0OA 2C2FA 2JD60 3E6RA 2YW7A 3DBYA 3Q4RA 1L8IA 3ISEA 3PVYA 3AJQA 3QHBA 1AEWA 4ZKXA 3EZUA 4LPNA 5D8PA 3A9QA 5CZUA 2FHAA 4YKHA 4OYNA 1F30A 2WLAA 1Z4AA 1UVHA 3T9JA 2V2IA 1BG7A 4E6KA 5JKLG 4DYZA 2CN6A 2PYBA 3BVIA 1TKPA 4ZLWA 4YVZA 1TJOA 1B71A 4CMYV 3NP0X 3FRRA 4DYXA 4LQHA 4RC6A 4W4LB 3M6JA 2WTLA 3BVKA 4U3GA 4TOEA 3KHKA 2VZBA 3F34A 3RAVA 1LB3A 3R2KA 3PVTA 3O7RA 4MUDA 5GOUA 1H96A 1ZUJA 4M33A 1SOFA 3GVYA 4DI0A 2V2MA 2V2JA 1JKVA 3PW8A 2OKCA 4DE6A 1TKOA 3R2RA 5JKLA 3F32A 3NP2X 5GN8B 2Z5PA 3BVLA 3E1QA 3PW1A 4M32A 1LKPA 2VXIA 4TO9A 1MOJA 3AF9X 5E2DA 5FFAA 5ERKA 5I4JA 1F33A 3QB9A 3BVEA 5IX6A 4W4KB 4ZMCA 2OH3A 3D19A 5FFDA 2V8UA 3VVAA 5LG8A 4AM5A 5E1UA 2ZG9X 3RGDA 2XGWA 1JREA 2V2LA 2ZG8X 1BFRA 2Z6MA 4CVRA 3F33A 2IU2A 3F39A 1NFVA 2ZG7X 4ITTA 2OC5A 1DVBA 4MY7A 2Y3QA 5AXSA 2ZURX 5J8SA 1QYBA 5D8YA 3RD0A 1JIGA 2CHPA 1S3QA 2XKQA 5HJHA 5D8OA 1O9RA 4ERUA 3EGMA 5FFBA 4Z5SA 5FFCA 3SE1A 3E1LA 3FVBA 3OGHA 2C2JA 3RBCA 4DYUA 4TOBA 3U90A 3C1YA 4II4A 3GGZA 3JZ9A 2CN7A 3KA3A 4RC5B 5JKMA 2CLBA 3PVRA 3KA6A 1R03A 1Z6OA 3BKNA 4LQVA 3C1ZA 3NOZX 4EVEA 5GU1X 2FL0A 3RE7A 3QHCA 3VV9A 3BVFA 4KVRA 4ISPA 3E1MA 4CVTA 2N02A 4ZTTA 1BCFA 3UOFA 3HIUA 3L0MA 3MPSA 3KA4A 1UMNA 3BT5A 2QF9A 3HL1A 3R2MA 3TA8A 3JZAB 3UFBA 4RC7B 4MJYA 3AK8A 2JD70 1RCCA 4CY9A 1HRSA 1RCDA 3PVYB 5GU2X 4YXMA 5D8QA 3R2OA 2WWXB 4P18A 4XGSA 2ZA8A 1SQ3A 1VELA 1LKOA 4ISMA 5GU0X 5J93A 5J8WA 5JDOA 3E1JA 3KA9A 2BJYA 4QUWA 3UOIA 3IQ1A 2FKZA 3ES3A 4CVPA 2WLUA 4CMYA 2V2PA 1RCEA 4XKUA 1DATA 2UX1A 4TOAA 3E2CA 3PZAA 2Y44A 2CWLA 1NF4A 3KDQA 2HR5A 4AM4A 5JKMG 5GU3X 3F36A 4CYBA 3PVTB 3E6SA 3IS7A 4WJG4 3VNXA 3ERZA 5C6FA 4ZL6A 1VEQA 2CHIA 4TOGA 1RYTA 3WVUA 1JI5A 3FI6A 2V2RA 2C2UA 4PGKA 4ZL5A 5HU6D 1ZS3A 4EVBA 4LPJA 2CF7A 4RC8A 1XZ1A 2GS4A 5D8RA 1RCIA 3LKDA 3N6OA 3W54A 4EVDA 5D8SA 5CMQA 1S30A 3QD8A 4R42A 4ML5A 3V3KB 4ZKWA 1Z6OM 2ITBA 3C21A 3R2HA 4MKUA 5D8XA 2IY4A 2V2SA 4KVQA 4Z3BA 3KX9A 2G38B 5K52A 1DPSA 1GWGA 1MFRA 5ERJA 2JD80 2V15A 4MXPA 4Y08A 2GYQA 4PG0A 4XKSA 2CIHA 3PWFA 2C41A 2BK6A 4ITWA 2Z5QA 3WVVA 2BW1A 1NNQA 2XJMA 4KXRB 1VLGA 3E1PA 1TK6A 3PW8C 4TOFA 4KVSA 1OTKA 2V2OA 3QVDA 4XKTA 1IESA 2V8TA 4M35A 5HJFA 4A25A 4DZ0A 4DYYA 3GE4A 3Q4QA 3F35A 1KRQA 5LS9A 1L8HA 3ISFA 4II4B 2YJKA 2FFXJ 1JI4A 2QQYA 5GN8A 4TW3A 3KXUA 3E1OA 2Z90A 4DASA 2CLUA 2FG4A 3PVRB 3EZ0A 1LKMA 1NF6A 4IWKA 4PGIA 2AR0A 1JYBA 2HTNA 4IXKA 4X0JA 2C6RA 2V2NA 3GHQA 3KWOA 3OJ5A 3FRSA 2F7NA 2G4HA 4MN9A 2XJOA 3PWQC 1J30A 3E1NA 1YV1A 4E40A 1O9IA 5LBHA 5CMRA 4TOCA 2Z5RA 4M34A 2RBDA 1JTSA 2D5KA 4LYUA 2IB0A 1VEIA 3Q4NA 4CVSA 4CYAA 4IWJA 3QZ3A 1XZ3A 4RC6B 1FHAA 1QGHA 1JKUA 1VJXA 2MGYA 5LG2A 4LQNA 3AJPA 3SHXA 3SH6A 4ZJKA 2ZA7A 3AF7X 4ZKHA 2XJNA 3UNOA 4YXJA 1N1QA 2YW6A 2CEIA 2BKCA 2X170 4TOHA 3F38A 3C23A 4LYXA 4RC5A 4LPMA 3O7SA 3PW1B 5JDOB 3F37A 5HQOA 1JGCA 3AJOA 4EVCA 5FEJA 3IS8A 4PG1A 2FG8A 4TODA 3R2LA 3A68A 3AF8X 4LQJA 1YUXA 3R2SA 2FZFA 3AK9A 4AM2A 3KA8A 2ZA6A 2FJCA 3PWQA 5JACA 5K53A 2VXXA 5FFEA 3WVWA 5J9VA 1YUZA 3FSEA
chains in the Genus database with same CATH topology
1EUMA 4ETRA 3H7GA 1RCGA 4REUA 3GGYA 1S2ZA 1IERA 3Q4OA 3SIDA 4RC7A 2GYDA 3WNWA 2YJJA 2W0OA 2C2FA 2JD60 3E6RA 2YW7A 3DBYA 3Q4RA 1L8IA 3ISEA 3PVYA 3AJQA 3QHBA 1AEWA 4ZKXA 3EZUA 4LPNA 5D8PA 3A9QA 5CZUA 2FHAA 4YKHA 4OYNA 1F30A 2WLAA 1Z4AA 1UVHA 3T9JA 2V2IA 1BG7A 4E6KA 5JKLG 4DYZA 2CN6A 2PYBA 3BVIA 1TKPA 4ZLWA 4YVZA 1TJOA 1B71A 4CMYV 3NP0X 3FRRA 4DYXA 4LQHA 4RC6A 4W4LB 3M6JA 2WTLA 3BVKA 4U3GA 4TOEA 3KHKA 2VZBA 3F34A 3RAVA 1LB3A 3R2KA 3PVTA 3O7RA 4MUDA 5GOUA 1H96A 1ZUJA 4M33A 1SOFA 3GVYA 4DI0A 2V2MA 2V2JA 1JKVA 3PW8A 2OKCA 4DE6A 1TKOA 3R2RA 5JKLA 3F32A 3NP2X 5GN8B 2Z5PA 3BVLA 3E1QA 3PW1A 4M32A 1LKPA 2VXIA 4TO9A 1MOJA 3AF9X 5E2DA 5FFAA 5ERKA 5I4JA 1F33A 3QB9A 3BVEA 5IX6A 4W4KB 4ZMCA 2OH3A 3D19A 5FFDA 2V8UA 3VVAA 5LG8A 4AM5A 5E1UA 2ZG9X 3RGDA 2XGWA 1JREA 2V2LA 2ZG8X 1BFRA 2Z6MA 4CVRA 3F33A 2IU2A 3F39A 1NFVA 2ZG7X 4ITTA 2OC5A 1DVBA 4MY7A 2Y3QA 5AXSA 2ZURX 5J8SA 1QYBA 5D8YA 3RD0A 1JIGA 2CHPA 1S3QA 2XKQA 5HJHA 5D8OA 1O9RA 4ERUA 3EGMA 5FFBA 4Z5SA 5FFCA 3SE1A 3E1LA 3FVBA 3OGHA 2C2JA 3RBCA 4DYUA 4TOBA 3U90A 3C1YA 4II4A 3GGZA 3JZ9A 2CN7A 3KA3A 4RC5B 5JKMA 2CLBA 3PVRA 3KA6A 1R03A 1Z6OA 3BKNA 4LQVA 3C1ZA 3NOZX 4EVEA 5GU1X 2FL0A 3RE7A 3QHCA 3VV9A 3BVFA 4KVRA 4ISPA 3E1MA 4CVTA 2N02A 4ZTTA 1BCFA 3UOFA 3HIUA 3L0MA 3MPSA 3KA4A 1UMNA 3BT5A 2QF9A 3HL1A 3R2MA 3TA8A 3JZAB 3UFBA 4RC7B 4MJYA 3AK8A 2JD70 1RCCA 4CY9A 1HRSA 1RCDA 3PVYB 5GU2X 4YXMA 5D8QA 3R2OA 2WWXB 4P18A 4XGSA 2ZA8A 1SQ3A 1VELA 1LKOA 4ISMA 5GU0X 5J93A 5J8WA 5JDOA 3E1JA 3KA9A 2BJYA 4QUWA 3UOIA 3IQ1A 2FKZA 3ES3A 4CVPA 2WLUA 4CMYA 2V2PA 1RCEA 4XKUA 1DATA 2UX1A 4TOAA 3E2CA 3PZAA 2Y44A 2CWLA 1NF4A 3KDQA 2HR5A 4AM4A 5JKMG 5GU3X 3F36A 4CYBA 3PVTB 3E6SA 3IS7A 4WJG4 3VNXA 3ERZA 5C6FA 4ZL6A 1VEQA 2CHIA 4TOGA 1RYTA 3WVUA 1JI5A 3FI6A 2V2RA 2C2UA 4PGKA 4ZL5A 5HU6D 1ZS3A 4EVBA 4LPJA 2CF7A 4RC8A 1XZ1A 2GS4A 5D8RA 1RCIA 3LKDA 3N6OA 3W54A 4EVDA 5D8SA 5CMQA 1S30A 3QD8A 4R42A 4ML5A 3V3KB 4ZKWA 1Z6OM 2ITBA 3C21A 3R2HA 4MKUA 5D8XA 2IY4A 2V2SA 4KVQA 4Z3BA 3KX9A 2G38B 5K52A 1DPSA 1GWGA 1MFRA 5ERJA 2JD80 2V15A 4MXPA 4Y08A 2GYQA 4PG0A 4XKSA 2CIHA 3PWFA 2C41A 2BK6A 4ITWA 2Z5QA 3WVVA 2BW1A 1NNQA 2XJMA 4KXRB 1VLGA 3E1PA 1TK6A 3PW8C 4TOFA 4KVSA 1OTKA 2V2OA 3QVDA 4XKTA 1IESA 2V8TA 4M35A 5HJFA 4A25A 4DZ0A 4DYYA 3GE4A 3Q4QA 3F35A 1KRQA 5LS9A 1L8HA 3ISFA 4II4B 2YJKA 2FFXJ 1JI4A 2QQYA 5GN8A 4TW3A 3KXUA 3E1OA 2Z90A 4DASA 2CLUA 2FG4A 3PVRB 3EZ0A 1LKMA 1NF6A 4IWKA 4PGIA 2AR0A 1JYBA 2HTNA 4IXKA 4X0JA 2C6RA 2V2NA 3GHQA 3KWOA 3OJ5A 3FRSA 2F7NA 2G4HA 4MN9A 2XJOA 3PWQC 1J30A 3E1NA 1YV1A 4E40A 1O9IA 5LBHA 5CMRA 4TOCA 2Z5RA 4M34A 2RBDA 1JTSA 2D5KA 4LYUA 2IB0A 1VEIA 3Q4NA 4CVSA 4CYAA 4IWJA 3QZ3A 1XZ3A 4RC6B 1FHAA 1QGHA 1JKUA 1VJXA 2MGYA 5LG2A 4LQNA 3AJPA 3SHXA 3SH6A 4ZJKA 2ZA7A 3AF7X 4ZKHA 2XJNA 3UNOA 4YXJA 1N1QA 2YW6A 2CEIA 2BKCA 2X170 4TOHA 3F38A 3C23A 4LYXA 4RC5A 4LPMA 3O7SA 3PW1B 5JDOB 3F37A 5HQOA 1JGCA 3AJOA 4EVCA 5FEJA 3IS8A 4PG1A 2FG8A 4TODA 3R2LA 3A68A 3AF8X 4LQJA 1YUXA 3R2SA 2FZFA 3AK9A 4AM2A 3KA8A 2ZA6A 2FJCA 3PWQA 5JACA 5K53A 2VXXA 5FFEA 3WVWA 5J9VA 1YUZA 3FSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EUM A;  4ETR A;  3H7G A;  1RCG A;  4REU A;  1S2Z A;  1IER A;  3Q4O A;  3SID A;  4RC7 A;  2GYD A;  3WNW A;  2YJJ A;  2W0O A;  2C2F A;  2JD6 0;  3E6R A;  2YW7 A;  3Q4R A;  1L8I A;  3ISE A;  3PVY A;  3AJQ A;  3QHB A;  1AEW A;  4ZKX A;  3EZU A;  4LPN A;  5D8P A;  3A9Q A;  5CZU A;  2FHA A;  4YKH A;  4OYN A;  1F30 A;  2WLA A;  1Z4A A;  1UVH A;  3T9J A;  2V2I A;  1BG7 A;  4E6K A;  5JKL G;  4DYZ A;  2CN6 A;  2PYB A;  3BVI A;  1TKP A;  4ZLW A;  1TJO A;  1B71 A;  4CMY V;  3NP0 X;  4DYX A;  4LQH A;  4RC6 A;  2WTL A;  3BVK A;  4U3G A;  4TOE A;  2VZB A;  3F34 A;  3RAV A;  1LB3 A;  3R2K A;  3PVT A;  3O7R A;  4MUD A;  5GOU A;  1H96 A;  1ZUJ A;  4M33 A;  1SOF A;  3GVY A;  4DI0 A;  2V2M A;  2V2J A;  1JKV A;  3PW8 A;  4DE6 A;  1TKO A;  3R2R A;  5JKL A;  3F32 A;  3NP2 X;  5GN8 B;  2Z5P A;  3BVL A;  3E1Q A;  3PW1 A;  4M32 A;  1LKP A;  2VXI A;  4TO9 A;  1MOJ A;  3AF9 X;  5E2D A;  5FFA A;  5ERK A;  5I4J A;  1F33 A;  3QB9 A;  3BVE A;  5IX6 A;  4ZMC A;  2OH3 A;  5FFD A;  5LG8 A;  4AM5 A;  5E1U A;  2ZG9 X;  3RGD A;  2XGW A;  1JRE A;  2V2L A;  2ZG8 X;  1BFR A;  2Z6M A;  4CVR A;  3F33 A;  2IU2 A;  3F39 A;  1NFV A;  2ZG7 X;  4ITT A;  2OC5 A;  1DVB A;  4MY7 A;  2Y3Q A;  5AXS A;  2ZUR X;  5J8S A;  1QYB A;  5D8Y A;  3RD0 A;  1JIG A;  2CHP A;  1S3Q A;  2XKQ A;  5HJH A;  5D8O A;  1O9R A;  4ERU A;  3EGM A;  5FFB A;  4Z5S A;  5FFC A;  3SE1 A;  3E1L A;  3FVB A;  3OGH A;  2C2J A;  3RBC A;  4DYU A;  4TOB A;  3U90 A;  4II4 A;  2CN7 A;  3KA3 A;  4RC5 B;  5JKM A;  2CLB A;  3PVR A;  3KA6 A;  1R03 A;  1Z6O A;  3BKN A;  4LQV A;  3NOZ X;  4EVE A;  5GU1 X;  2FL0 A;  3RE7 A;  3QHC A;  3BVF A;  4KVR A;  4ISP A;  3E1M A;  4CVT A;  4ZTT A;  1BCF A;  3UOF A;  3HIU A;  3MPS A;  3KA4 A;  1UMN A;  3BT5 A;  2QF9 A;  3HL1 A;  3R2M A;  3TA8 A;  4RC7 B;  4MJY A;  3AK8 A;  2JD7 0;  1RCC A;  4CY9 A;  1HRS A;  1RCD A;  3PVY B;  5GU2 X;  5D8Q A;  3R2O A;  4P18 A;  4XGS A;  2ZA8 A;  1SQ3 A;  1VEL A;  1LKO A;  4ISM A;  5GU0 X;  5J93 A;  5J8W A;  3E1J A;  3KA9 A;  2BJY A;  4QUW A;  3UOI A;  3IQ1 A;  2FKZ A;  3ES3 A;  4CVP A;  2WLU A;  4CMY A;  2V2P A;  1RCE A;  4XKU A;  1DAT A;  2UX1 A;  4TOA A;  3E2C A;  3PZA A;  1NF4 A;  2HR5 A;  4AM4 A;  5JKM G;  5GU3 X;  3F36 A;  4CYB A;  3PVT B;  3E6S A;  3IS7 A;  3VNX A;  3ERZ A;  5C6F A;  4ZL6 A;  1VEQ A;  2CHI A;  4TOG A;  1RYT A;  3WVU A;  1JI5 A;  3FI6 A;  2V2R A;  2C2U A;  4PGK A;  4ZL5 A;  1ZS3 A;  4EVB A;  4LPJ A;  2CF7 A;  4RC8 A;  1XZ1 A;  2GS4 A;  5D8R A;  1RCI A;  4EVD A;  5D8S A;  5CMQ A;  1S30 A;  3QD8 A;  4R42 A;  4ML5 A;  4ZKW A;  1Z6O M;  2ITB A;  3R2H A;  4MKU A;  5D8X A;  2IY4 A;  2V2S A;  4KVQ A;  4Z3B A;  3KX9 A;  5K52 A;  1DPS A;  1GWG A;  1MFR A;  5ERJ A;  2JD8 0;  2V15 A;  4Y08 A;  2GYQ A;  4PG0 A;  4XKS A;  2CIH A;  3PWF A;  2C41 A;  2BK6 A;  4ITW A;  2Z5Q A;  3WVV A;  2BW1 A;  1NNQ A;  2XJM A;  1VLG A;  3E1P A;  1TK6 A;  3PW8 C;  4TOF A;  4KVS A;  1OTK A;  2V2O A;  3QVD A;  4XKT A;  1IES A;  4M35 A;  5HJF A;  4A25 A;  4DZ0 A;  4DYY A;  3GE4 A;  3Q4Q A;  3F35 A;  1KRQ A;  5LS9 A;  1L8H A;  3ISF A;  4II4 B;  2YJK A;  2FFX J;  1JI4 A;  2QQY A;  5GN8 A;  4TW3 A;  3KXU A;  3E1O A;  2Z90 A;  4DAS A;  2CLU A;  2FG4 A;  3PVR B;  3EZ0 A;  1LKM A;  1NF6 A;  4IWK A;  4PGI A;  1JYB A;  2HTN A;  4IXK A;  2C6R A;  2V2N A;  3GHQ A;  3KWO A;  3OJ5 A;  2F7N A;  2G4H A;  4MN9 A;  2XJO A;  3PWQ C;  1J30 A;  3E1N A;  1YV1 A;  1O9I A;  5LBH A;  5CMR A;  4TOC A;  2Z5R A;  4M34 A;  2RBD A;  1JTS A;  2D5K A;  4LYU A;  2IB0 A;  1VEI A;  3Q4N A;  4CVS A;  4CYA A;  4IWJ A;  3QZ3 A;  1XZ3 A;  4RC6 B;  1FHA A;  1QGH A;  1JKU A;  1VJX A;  5LG2 A;  4LQN A;  3AJP A;  3SHX A;  3SH6 A;  4ZJK A;  2ZA7 A;  3AF7 X;  4ZKH A;  2XJN A;  3UNO A;  1N1Q A;  2YW6 A;  2CEI A;  2BKC A;  2X17 0;  4TOH A;  3F38 A;  4LYX A;  4RC5 A;  4LPM A;  3O7S A;  3PW1 B;  3F37 A;  5HQO A;  1JGC A;  3AJO A;  4EVC A;  5FEJ A;  3IS8 A;  4PG1 A;  2FG8 A;  4TOD A;  3R2L A;  3A68 A;  3AF8 X;  4LQJ A;  1YUX A;  3R2S A;  2FZF A;  3AK9 A;  4AM2 A;  3KA8 A;  2ZA6 A;  2FJC A;  3PWQ A;  5JAC A;  5K53 A;  2VXX A;  5FFE A;  3WVW A;  5J9V A;  1YUZ A;  3FSE A; 
#chains in the Genus database with same CATH topology
 1EUM A;  4ETR A;  3H7G A;  1RCG A;  4REU A;  3GGY A;  1S2Z A;  1IER A;  3Q4O A;  3SID A;  4RC7 A;  2GYD A;  3WNW A;  2YJJ A;  2W0O A;  2C2F A;  2JD6 0;  3E6R A;  2YW7 A;  3DBY A;  3Q4R A;  1L8I A;  3ISE A;  3PVY A;  3AJQ A;  3QHB A;  1AEW A;  4ZKX A;  3EZU A;  4LPN A;  5D8P A;  3A9Q A;  5CZU A;  2FHA A;  4YKH A;  4OYN A;  1F30 A;  2WLA A;  1Z4A A;  1UVH A;  3T9J A;  2V2I A;  1BG7 A;  4E6K A;  5JKL G;  4DYZ A;  2CN6 A;  2PYB A;  3BVI A;  1TKP A;  4ZLW A;  4YVZ A;  1TJO A;  1B71 A;  4CMY V;  3NP0 X;  3FRR A;  4DYX A;  4LQH A;  4RC6 A;  4W4L B;  3M6J A;  2WTL A;  3BVK A;  4U3G A;  4TOE A;  3KHK A;  2VZB A;  3F34 A;  3RAV A;  1LB3 A;  3R2K A;  3PVT A;  3O7R A;  4MUD A;  5GOU A;  1H96 A;  1ZUJ A;  4M33 A;  1SOF A;  3GVY A;  4DI0 A;  2V2M A;  2V2J A;  1JKV A;  3PW8 A;  2OKC A;  4DE6 A;  1TKO A;  3R2R A;  5JKL A;  3F32 A;  3NP2 X;  5GN8 B;  2Z5P A;  3BVL A;  3E1Q A;  3PW1 A;  4M32 A;  1LKP A;  2VXI A;  4TO9 A;  1MOJ A;  3AF9 X;  5E2D A;  5FFA A;  5ERK A;  5I4J A;  1F33 A;  3QB9 A;  3BVE A;  5IX6 A;  4W4K B;  4ZMC A;  2OH3 A;  3D19 A;  5FFD A;  2V8U A;  3VVA A;  5LG8 A;  4AM5 A;  5E1U A;  2ZG9 X;  3RGD A;  2XGW A;  1JRE A;  2V2L A;  2ZG8 X;  1BFR A;  2Z6M A;  4CVR A;  3F33 A;  2IU2 A;  3F39 A;  1NFV A;  2ZG7 X;  4ITT A;  2OC5 A;  1DVB A;  4MY7 A;  2Y3Q A;  5AXS A;  2ZUR X;  5J8S A;  1QYB A;  5D8Y A;  3RD0 A;  1JIG A;  2CHP A;  1S3Q A;  2XKQ A;  5HJH A;  5D8O A;  1O9R A;  4ERU A;  3EGM A;  5FFB A;  4Z5S A;  5FFC A;  3SE1 A;  3E1L A;  3FVB A;  3OGH A;  2C2J A;  3RBC A;  4DYU A;  4TOB A;  3U90 A;  3C1Y A;  4II4 A;  3GGZ A;  3JZ9 A;  2CN7 A;  3KA3 A;  4RC5 B;  5JKM A;  2CLB A;  3PVR A;  3KA6 A;  1R03 A;  1Z6O A;  3BKN A;  4LQV A;  3C1Z A;  3NOZ X;  4EVE A;  5GU1 X;  2FL0 A;  3RE7 A;  3QHC A;  3VV9 A;  3BVF A;  4KVR A;  4ISP A;  3E1M A;  4CVT A;  2N02 A;  4ZTT A;  1BCF A;  3UOF A;  3HIU A;  3L0M A;  3MPS A;  3KA4 A;  1UMN A;  3BT5 A;  2QF9 A;  3HL1 A;  3R2M A;  3TA8 A;  3JZA B;  3UFB A;  4RC7 B;  4MJY A;  3AK8 A;  2JD7 0;  1RCC A;  4CY9 A;  1HRS A;  1RCD A;  3PVY B;  5GU2 X;  4YXM A;  5D8Q A;  3R2O A;  2WWX B;  4P18 A;  4XGS A;  2ZA8 A;  1SQ3 A;  1VEL A;  1LKO A;  4ISM A;  5GU0 X;  5J93 A;  5J8W A;  5JDO A;  3E1J A;  3KA9 A;  2BJY A;  4QUW A;  3UOI A;  3IQ1 A;  2FKZ A;  3ES3 A;  4CVP A;  2WLU A;  4CMY A;  2V2P A;  1RCE A;  4XKU A;  1DAT A;  2UX1 A;  4TOA A;  3E2C A;  3PZA A;  2Y44 A;  2CWL A;  1NF4 A;  3KDQ A;  2HR5 A;  4AM4 A;  5JKM G;  5GU3 X;  3F36 A;  4CYB A;  3PVT B;  3E6S A;  3IS7 A;  4WJG 4;  3VNX A;  3ERZ A;  5C6F A;  4ZL6 A;  1VEQ A;  2CHI A;  4TOG A;  1RYT A;  3WVU A;  1JI5 A;  3FI6 A;  2V2R A;  2C2U A;  4PGK A;  4ZL5 A;  5HU6 D;  1ZS3 A;  4EVB A;  4LPJ A;  2CF7 A;  4RC8 A;  1XZ1 A;  2GS4 A;  5D8R A;  1RCI A;  3LKD A;  3N6O A;  3W54 A;  4EVD A;  5D8S A;  5CMQ A;  1S30 A;  3QD8 A;  4R42 A;  4ML5 A;  3V3K B;  4ZKW A;  1Z6O M;  2ITB A;  3C21 A;  3R2H A;  4MKU A;  5D8X A;  2IY4 A;  2V2S A;  4KVQ A;  4Z3B A;  3KX9 A;  2G38 B;  5K52 A;  1DPS A;  1GWG A;  1MFR A;  5ERJ A;  2JD8 0;  2V15 A;  4MXP A;  4Y08 A;  2GYQ A;  4PG0 A;  4XKS A;  2CIH A;  3PWF A;  2C41 A;  2BK6 A;  4ITW A;  2Z5Q A;  3WVV A;  2BW1 A;  1NNQ A;  2XJM A;  4KXR B;  1VLG A;  3E1P A;  1TK6 A;  3PW8 C;  4TOF A;  4KVS A;  1OTK A;  2V2O A;  3QVD A;  4XKT A;  1IES A;  2V8T A;  4M35 A;  5HJF A;  4A25 A;  4DZ0 A;  4DYY A;  3GE4 A;  3Q4Q A;  3F35 A;  1KRQ A;  5LS9 A;  1L8H A;  3ISF A;  4II4 B;  2YJK A;  2FFX J;  1JI4 A;  2QQY A;  5GN8 A;  4TW3 A;  3KXU A;  3E1O A;  2Z90 A;  4DAS A;  2CLU A;  2FG4 A;  3PVR B;  3EZ0 A;  1LKM A;  1NF6 A;  4IWK A;  4PGI A;  2AR0 A;  1JYB A;  2HTN A;  4IXK A;  4X0J A;  2C6R A;  2V2N A;  3GHQ A;  3KWO A;  3OJ5 A;  3FRS A;  2F7N A;  2G4H A;  4MN9 A;  2XJO A;  3PWQ C;  1J30 A;  3E1N A;  1YV1 A;  4E40 A;  1O9I A;  5LBH A;  5CMR A;  4TOC A;  2Z5R A;  4M34 A;  2RBD A;  1JTS A;  2D5K A;  4LYU A;  2IB0 A;  1VEI A;  3Q4N A;  4CVS A;  4CYA A;  4IWJ A;  3QZ3 A;  1XZ3 A;  4RC6 B;  1FHA A;  1QGH A;  1JKU A;  1VJX A;  2MGY A;  5LG2 A;  4LQN A;  3AJP A;  3SHX A;  3SH6 A;  4ZJK A;  2ZA7 A;  3AF7 X;  4ZKH A;  2XJN A;  3UNO A;  4YXJ A;  1N1Q A;  2YW6 A;  2CEI A;  2BKC A;  2X17 0;  4TOH A;  3F38 A;  3C23 A;  4LYX A;  4RC5 A;  4LPM A;  3O7S A;  3PW1 B;  5JDO B;  3F37 A;  5HQO A;  1JGC A;  3AJO A;  4EVC A;  5FEJ A;  3IS8 A;  4PG1 A;  2FG8 A;  4TOD A;  3R2L A;  3A68 A;  3AF8 X;  4LQJ A;  1YUX A;  3R2S A;  2FZF A;  3AK9 A;  4AM2 A;  3KA8 A;  2ZA6 A;  2FJC A;  3PWQ A;  5JAC A;  5K53 A;  2VXX A;  5FFE A;  3WVW A;  5J9V A;  1YUZ A;  3FSE A; 
#chains in the Genus database with same CATH homology
 1EUM A;  4ETR A;  3H7G A;  1RCG A;  4REU A;  3GGY A;  1S2Z A;  1IER A;  3Q4O A;  3SID A;  4RC7 A;  2GYD A;  3WNW A;  2YJJ A;  2W0O A;  2C2F A;  2JD6 0;  3E6R A;  2YW7 A;  3DBY A;  3Q4R A;  1L8I A;  3ISE A;  3PVY A;  3AJQ A;  3QHB A;  1AEW A;  4ZKX A;  3EZU A;  4LPN A;  5D8P A;  3A9Q A;  5CZU A;  2FHA A;  4YKH A;  4OYN A;  1F30 A;  2WLA A;  1Z4A A;  1UVH A;  3T9J A;  2V2I A;  1BG7 A;  4E6K A;  5JKL G;  4DYZ A;  2CN6 A;  2PYB A;  3BVI A;  1TKP A;  4ZLW A;  4YVZ A;  1TJO A;  1B71 A;  4CMY V;  3NP0 X;  3FRR A;  4DYX A;  4LQH A;  4RC6 A;  4W4L B;  3M6J A;  2WTL A;  3BVK A;  4U3G A;  4TOE A;  3KHK A;  2VZB A;  3F34 A;  3RAV A;  1LB3 A;  3R2K A;  3PVT A;  3O7R A;  4MUD A;  5GOU A;  1H96 A;  1ZUJ A;  4M33 A;  1SOF A;  3GVY A;  4DI0 A;  2V2M A;  2V2J A;  1JKV A;  3PW8 A;  2OKC A;  4DE6 A;  1TKO A;  3R2R A;  5JKL A;  3F32 A;  3NP2 X;  5GN8 B;  2Z5P A;  3BVL A;  3E1Q A;  3PW1 A;  4M32 A;  1LKP A;  2VXI A;  4TO9 A;  1MOJ A;  3AF9 X;  5E2D A;  5FFA A;  5ERK A;  5I4J A;  1F33 A;  3QB9 A;  3BVE A;  5IX6 A;  4W4K B;  4ZMC A;  2OH3 A;  3D19 A;  5FFD A;  2V8U A;  3VVA A;  5LG8 A;  4AM5 A;  5E1U A;  2ZG9 X;  3RGD A;  2XGW A;  1JRE A;  2V2L A;  2ZG8 X;  1BFR A;  2Z6M A;  4CVR A;  3F33 A;  2IU2 A;  3F39 A;  1NFV A;  2ZG7 X;  4ITT A;  2OC5 A;  1DVB A;  4MY7 A;  2Y3Q A;  5AXS A;  2ZUR X;  5J8S A;  1QYB A;  5D8Y A;  3RD0 A;  1JIG A;  2CHP A;  1S3Q A;  2XKQ A;  5HJH A;  5D8O A;  1O9R A;  4ERU A;  3EGM A;  5FFB A;  4Z5S A;  5FFC A;  3SE1 A;  3E1L A;  3FVB A;  3OGH A;  2C2J A;  3RBC A;  4DYU A;  4TOB A;  3U90 A;  3C1Y A;  4II4 A;  3GGZ A;  3JZ9 A;  2CN7 A;  3KA3 A;  4RC5 B;  5JKM A;  2CLB A;  3PVR A;  3KA6 A;  1R03 A;  1Z6O A;  3BKN A;  4LQV A;  3C1Z A;  3NOZ X;  4EVE A;  5GU1 X;  2FL0 A;  3RE7 A;  3QHC A;  3VV9 A;  3BVF A;  4KVR A;  4ISP A;  3E1M A;  4CVT A;  2N02 A;  4ZTT A;  1BCF A;  3UOF A;  3HIU A;  3L0M A;  3MPS A;  3KA4 A;  1UMN A;  3BT5 A;  2QF9 A;  3HL1 A;  3R2M A;  3TA8 A;  3JZA B;  3UFB A;  4RC7 B;  4MJY A;  3AK8 A;  2JD7 0;  1RCC A;  4CY9 A;  1HRS A;  1RCD A;  3PVY B;  5GU2 X;  4YXM A;  5D8Q A;  3R2O A;  2WWX B;  4P18 A;  4XGS A;  2ZA8 A;  1SQ3 A;  1VEL A;  1LKO A;  4ISM A;  5GU0 X;  5J93 A;  5J8W A;  5JDO A;  3E1J A;  3KA9 A;  2BJY A;  4QUW A;  3UOI A;  3IQ1 A;  2FKZ A;  3ES3 A;  4CVP A;  2WLU A;  4CMY A;  2V2P A;  1RCE A;  4XKU A;  1DAT A;  2UX1 A;  4TOA A;  3E2C A;  3PZA A;  2Y44 A;  2CWL A;  1NF4 A;  3KDQ A;  2HR5 A;  4AM4 A;  5JKM G;  5GU3 X;  3F36 A;  4CYB A;  3PVT B;  3E6S A;  3IS7 A;  4WJG 4;  3VNX A;  3ERZ A;  5C6F A;  4ZL6 A;  1VEQ A;  2CHI A;  4TOG A;  1RYT A;  3WVU A;  1JI5 A;  3FI6 A;  2V2R A;  2C2U A;  4PGK A;  4ZL5 A;  5HU6 D;  1ZS3 A;  4EVB A;  4LPJ A;  2CF7 A;  4RC8 A;  1XZ1 A;  2GS4 A;  5D8R A;  1RCI A;  3LKD A;  3N6O A;  3W54 A;  4EVD A;  5D8S A;  5CMQ A;  1S30 A;  3QD8 A;  4R42 A;  4ML5 A;  3V3K B;  4ZKW A;  1Z6O M;  2ITB A;  3C21 A;  3R2H A;  4MKU A;  5D8X A;  2IY4 A;  2V2S A;  4KVQ A;  4Z3B A;  3KX9 A;  2G38 B;  5K52 A;  1DPS A;  1GWG A;  1MFR A;  5ERJ A;  2JD8 0;  2V15 A;  4MXP A;  4Y08 A;  2GYQ A;  4PG0 A;  4XKS A;  2CIH A;  3PWF A;  2C41 A;  2BK6 A;  4ITW A;  2Z5Q A;  3WVV A;  2BW1 A;  1NNQ A;  2XJM A;  4KXR B;  1VLG A;  3E1P A;  1TK6 A;  3PW8 C;  4TOF A;  4KVS A;  1OTK A;  2V2O A;  3QVD A;  4XKT A;  1IES A;  2V8T A;  4M35 A;  5HJF A;  4A25 A;  4DZ0 A;  4DYY A;  3GE4 A;  3Q4Q A;  3F35 A;  1KRQ A;  5LS9 A;  1L8H A;  3ISF A;  4II4 B;  2YJK A;  2FFX J;  1JI4 A;  2QQY A;  5GN8 A;  4TW3 A;  3KXU A;  3E1O A;  2Z90 A;  4DAS A;  2CLU A;  2FG4 A;  3PVR B;  3EZ0 A;  1LKM A;  1NF6 A;  4IWK A;  4PGI A;  2AR0 A;  1JYB A;  2HTN A;  4IXK A;  4X0J A;  2C6R A;  2V2N A;  3GHQ A;  3KWO A;  3OJ5 A;  3FRS A;  2F7N A;  2G4H A;  4MN9 A;  2XJO A;  3PWQ C;  1J30 A;  3E1N A;  1YV1 A;  4E40 A;  1O9I A;  5LBH A;  5CMR A;  4TOC A;  2Z5R A;  4M34 A;  2RBD A;  1JTS A;  2D5K A;  4LYU A;  2IB0 A;  1VEI A;  3Q4N A;  4CVS A;  4CYA A;  4IWJ A;  3QZ3 A;  1XZ3 A;  4RC6 B;  1FHA A;  1QGH A;  1JKU A;  1VJX A;  2MGY A;  5LG2 A;  4LQN A;  3AJP A;  3SHX A;  3SH6 A;  4ZJK A;  2ZA7 A;  3AF7 X;  4ZKH A;  2XJN A;  3UNO A;  4YXJ A;  1N1Q A;  2YW6 A;  2CEI A;  2BKC A;  2X17 0;  4TOH A;  3F38 A;  3C23 A;  4LYX A;  4RC5 A;  4LPM A;  3O7S A;  3PW1 B;  5JDO B;  3F37 A;  5HQO A;  1JGC A;  3AJO A;  4EVC A;  5FEJ A;  3IS8 A;  4PG1 A;  2FG8 A;  4TOD A;  3R2L A;  3A68 A;  3AF8 X;  4LQJ A;  1YUX A;  3R2S A;  2FZF A;  3AK9 A;  4AM2 A;  3KA8 A;  2ZA6 A;  2FJC A;  3PWQ A;  5JAC A;  5K53 A;  2VXX A;  5FFE A;  3WVW A;  5J9V A;  1YUZ A;  3FSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...