2YW6A

Structural studies of n terminal deletion mutant of dps from mycobacterium smegmatis
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
148
structure length
148
Chain Sequence
DKKASDVADLLQKQLSTYNDLHLTLKHVHWNVVGPNFIGVHEMIDPQVELVRGYADEVAERIATLGKSPKGTPGAIIKDRTWDDYSVERDTVQAHLAALDLVYNGVIEDTRKSIEKLEDLDLVSQDLLIAHAGELEKFQWFVRAHLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DNA protection during starvation protein
publication title Role of N and C-terminal Tails in DNA Binding and Assembly in Dps: Structural Studies of Mycobacterium smegmatis Dps Deletion Mutants
pubmed doi rcsb
source organism Mycobacterium smegmatis
total genus 62
structure length 148
sequence length 148
chains with identical sequence B, C
ec nomenclature ec 1.16.-.-:
pdb deposition date 2007-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2yw6A00
3AF9X 4QUWA 2VXXA 1JTSA 2QQYA 5JKMG 3E1JA 1FHAA 2XGWA 3R2HA 3AF8X 5E1UA 4RC8A 4CYBA 3E1MA 3PWQC 3UOIA 1SOFA 2IY4A 3F37A 3GHQA 2C2JA 5FFEA 1LB3A 2Y3QA 1NFVA 2BK6A 4CVTA 4RC6A 2FKZA 3F34A 4DYXA 4REUA 3WNWA 2OH3A 3AK8A 2CN6A 3GE4A 5D8PA 5HJHA 2V2SA 1TKPA 3F39A 4EVCA 2JD70 5GU0X 5FFAA 3R2SA 1JREA 1S3QA 3Q4QA 3ERZA 3EGMA 2IU2A 1ZUJA 2W0OA 2Z5RA 4TOCA 4XGSA 1L8IA 5FFBA 4RC7A 4E6KA 2FFXJ 4MN9A 2GS4A 3IQ1A 5LG2A 1MFRA 3AK9A 1JKUA 1BCFA 1NNQA 2ZA6A 3PVYB 2HTNA 2HR5A 4ISPA 2WTLA 1JI4A 1GWGA 3RGDA 4ISMA 4A25A 1ZS3A 2V2NA 4CVRA 2Z5QA 3IS8A 3PVRB 4TOGA 3KX9A 1BG7A 1YV1A 3QB9A 1RCDA 3QHBA 2VXIA 2YW7A 5LBHA 4CVSA 3TA8A 4EVEA 3QHCA 2CIHA 3R2RA 3NP2X 4PG0A 4XKTA 3IS7A 1BFRA 4DYYA 2XJNA 1Z6OM 5J8SA 3QD8A 3PW1B 1XZ3A 2FG8A 4LQJA 1IERA 2RBDA 4ZKHA 5GOUA 2V2MA 4LQVA 3KA8A 4Z3BA 3HIUA 3AJPA 3E1PA 3QVDA 4XKUA 4M34A 5CMRA 5HJFA 5HQOA 3E1OA 4EVDA 3O7SA 4ZKWA 1QGHA 4TOBA 5LS9A 1OTKA 4MJYA 1EUMA 5E2DA 2V2JA 4R42A 4LQHA 1VEQA 2V2PA 4ETRA 3A9QA 5I4JA 1LKOA 3WVVA 5D8OA 2XKQA 4LYXA 4M32A 3H7GA 3PVRA 3UNOA 3E2CA 4TOFA 5ERJA 1NF4A 2Z90A 3E1NA 3O7RA 1F33A 3BVLA 5D8RA 3UOFA 4DYUA 1O9IA 4EVBA 4KVRA 1H96A 4PGKA 3R2LA 4ZMCA 3BVFA 3FVBA 2IB0A 1AEWA 2G4HA 3OGHA 5GN8B 4ML5A 2VZBA 3Q4NA 5JKLA 4ZL6A 1RCEA 3F38A 4YKHA 3ISFA 3PW1A 5AXSA 4CVPA 1IESA 1N1QA 4ZL5A 4TOAA 4LYUA 3PZAA 4KVQA 4AM4A 3E6SA 3AJQA 3FI6A 5JKMA 3KA4A 1S2ZA 5CZUA 2UX1A 3PVTB 4TOEA 2Z5PA 5GU2X 3WVWA 4DE6A 3ES3A 2BKCA 1MOJA 4LPNA 4ITWA 3RD0A 2V2OA 1YUZA 5K53A 5LG8A 1LKPA 2ZA8A 4OYNA 3SE1A 2FG4A 2YJKA 3RAVA 1TKOA 3BKNA 2OC5A 4M33A 5J93A 1DVBA 4TOHA 2C2FA 3T9JA 3E1LA 3PW8A 3R2KA 3NP0X 2ITBA 1JKVA 1Z4AA 3KWOA 4ITTA 3BT5A 3RE7A 5GN8A 4MUDA 4II4B 4AM5A 1TJOA 3E1QA 4Y08A 4KVSA 5JACA 2V2IA 2CHIA 4ZLWA 4IWKA 5JKLG 2FL0A 3WVUA 4MY7A 5CMQA 3PVYA 2V15A 4IXKA 4IWJA 1JIGA 3SHXA 4ZJKA 3R2OA 3VNXA 1RCIA 1TK6A 3PW8C 4AM2A 5D8XA 3RBCA 4CMYA 5ERKA 2FJCA 4XKSA 2V2RA 3PVTA 1B71A 2ZG8X 1XZ1A 3ISEA 3F36A 1HRSA 1YUXA 1DATA 2Z6MA 2CEIA 4LPMA 4M35A 1VLGA 2X170 5C6FA 5FFDA 3SH6A 2GYQA 2XJMA 3AJOA 4ZKXA 4RC5B 3HL1A 2ZG9X 1VEIA 3AF7X 2GYDA 2V2LA 3KA9A 3SIDA 4DASA 5J9VA 1DPSA 2C41A 2PYBA 3GVYA 4CY9A 1JYBA 3E6RA 3EZUA 4II4A 2F7NA 2CLBA 2YW6A 1Z6OA 2ZG7X 4DI0A 4CMYV 2ZURX 1RCCA 3EZ0A 5K52A 2BJYA 3OJ5A 1UMNA 2FZFA 1KRQA 1VJXA 2CN7A 3Q4RA 1R03A 5FEJA 5FFCA 4LPJA 1UVHA 2JD80 4TO9A 2FHAA 4CYAA 2CF7A 2CHPA 3F32A 4PGIA 1LKMA 2JD60 1JGCA 1J30A 4TODA 4RC6B 2WLUA 4MKUA 4ERUA 2YJJA 5D8QA 5D8SA 5GU3X 2D5KA 1L8HA 3R2MA 4PG1A 3Q4OA 1F30A 1VELA 3A68A 2XJOA 2C6RA 4TW3A 2ZA7A 3BVIA 3NOZX 1JI5A 4P18A 3KA3A 2BW1A 1NF6A 3MPSA 3QZ3A 4DZ0A 1QYBA 3BVKA 3F33A 4RC5A 1RYTA 5GU1X 4U3GA 1S30A 3PWFA 1SQ3A 3BVEA 3FSEA 3PWQA 3KXUA 3KA6A 4DYZA 5D8YA 1RCGA 4RC7B 4LQNA 2WLAA 4ZTTA 1O9RA 2CLUA 4Z5SA 3U90A 5IX6A 2C2UA 2QF9A 5J8WA 3F35A
chains in the Genus database with same CATH superfamily
3AF9X 4QUWA 2VXXA 1JTSA 2QQYA 5JKMG 3E1JA 1FHAA 2XGWA 5JDOA 3R2HA 3AF8X 5E1UA 4RC8A 4CYBA 3E1MA 3PWQC 3UOIA 1SOFA 2IY4A 3N6OA 3F37A 3GHQA 2C2JA 5FFEA 1LB3A 2Y3QA 1NFVA 2BK6A 4CVTA 4RC6A 2FKZA 3F34A 4DYXA 3C23A 4REUA 3WNWA 2OH3A 3AK8A 2CN6A 3GE4A 5D8PA 5HJHA 2V2SA 1TKPA 3F39A 4EVCA 2JD70 5GU0X 5FFAA 4YXMA 3R2SA 1JREA 1S3QA 3Q4QA 3ERZA 3EGMA 2IU2A 1ZUJA 3VVAA 2W0OA 2Z5RA 4TOCA 4XGSA 1L8IA 5FFBA 4RC7A 4E6KA 3LKDA 2FFXJ 4MN9A 2GS4A 3IQ1A 5LG2A 1MFRA 3AK9A 1JKUA 1BCFA 1NNQA 2ZA6A 3PVYB 2HTNA 2HR5A 4W4LB 4ISPA 2WTLA 1JI4A 1GWGA 3RGDA 4ISMA 4A25A 1ZS3A 2V2NA 4CVRA 2Z5QA 3IS8A 3PVRB 4TOGA 3KX9A 1BG7A 1YV1A 3QB9A 2Y44A 1RCDA 3QHBA 3W54A 2VXIA 2YW7A 5LBHA 4CVSA 3TA8A 4EVEA 3QHCA 2CIHA 3R2RA 3NP2X 4PG0A 4XKTA 3IS7A 1BFRA 4DYYA 2XJNA 1Z6OM 5J8SA 3QD8A 3PW1B 1XZ3A 2FG8A 4LQJA 1IERA 2RBDA 4ZKHA 5GOUA 2V2MA 4LQVA 3KA8A 4Z3BA 3HIUA 3AJPA 3E1PA 3QVDA 4X0JA 4XKUA 4M34A 5CMRA 5HJFA 5HQOA 3E1OA 4EVDA 3O7SA 3D19A 4ZKWA 1QGHA 4TOBA 5LS9A 1OTKA 4MJYA 1EUMA 5E2DA 2V2JA 4R42A 4LQHA 1VEQA 2V2PA 4ETRA 3A9QA 5I4JA 1LKOA 3WVVA 5D8OA 2XKQA 4LYXA 4M32A 3H7GA 3PVRA 3UNOA 3E2CA 4TOFA 5ERJA 1NF4A 2Z90A 3E1NA 3O7RA 1F33A 3BVLA 5D8RA 3UOFA 4DYUA 1O9IA 4EVBA 4KVRA 1H96A 4PGKA 3R2LA 4ZMCA 3BVFA 3JZ9A 3KDQA 3FVBA 2IB0A 1AEWA 2G4HA 3OGHA 5GN8B 4ML5A 2VZBA 3Q4NA 5JKLA 4ZL6A 3GGYA 1RCEA 3F38A 4YKHA 3ISFA 3PW1A 5AXSA 4CVPA 1IESA 1N1QA 4ZL5A 4TOAA 4LYUA 3PZAA 4KVQA 4AM4A 3E6SA 3AJQA 3FI6A 5JKMA 3KA4A 1S2ZA 5CZUA 2UX1A 3PVTB 4TOEA 2Z5PA 5GU2X 3WVWA 4DE6A 3ES3A 2BKCA 1MOJA 4LPNA 4ITWA 3RD0A 2V2OA 1YUZA 5K53A 5LG8A 1LKPA 2ZA8A 4OYNA 3SE1A 2FG4A 2YJKA 3RAVA 1TKOA 3BKNA 2OC5A 4M33A 5J93A 1DVBA 4TOHA 2C2FA 3JZAB 3T9JA 3E1LA 3M6JA 3PW8A 3R2KA 3C1YA 3NP0X 4WJG4 2ITBA 3C1ZA 1JKVA 1Z4AA 3KWOA 4ITTA 3BT5A 3RE7A 5GN8A 2OKCA 4MUDA 4II4B 4AM5A 1TJOA 3E1QA 5HU6D 4Y08A 4KVSA 5JACA 2V2IA 2CHIA 2MGYA 4ZLWA 4IWKA 5JKLG 2FL0A 3WVUA 4MY7A 5CMQA 3PVYA 2V15A 4IXKA 4IWJA 1JIGA 3SHXA 4ZJKA 3R2OA 3VNXA 1RCIA 1TK6A 3PW8C 4AM2A 3KHKA 5D8XA 3RBCA 2WWXB 4CMYA 5ERKA 4YXJA 3DBYA 2FJCA 4XKSA 2V2RA 3PVTA 1B71A 2ZG8X 1XZ1A 3ISEA 3F36A 1HRSA 1YUXA 1DATA 2Z6MA 2AR0A 2CEIA 4LPMA 4M35A 1VLGA 2X170 5C6FA 5FFDA 3SH6A 2GYQA 2XJMA 3AJOA 4ZKXA 4RC5B 3HL1A 2ZG9X 1VEIA 3AF7X 2GYDA 2V2LA 3KA9A 3SIDA 4DASA 5J9VA 1DPSA 2C41A 2PYBA 3GVYA 4CY9A 1JYBA 3C21A 2V8UA 3E6RA 3EZUA 3V3KB 4II4A 2F7NA 2CLBA 2CWLA 2YW6A 1Z6OA 2ZG7X 4DI0A 4CMYV 2ZURX 2V8TA 1RCCA 3EZ0A 5K52A 2BJYA 3OJ5A 1UMNA 2FZFA 5JDOB 1KRQA 1VJXA 2CN7A 3Q4RA 1R03A 5FEJA 3VV9A 5FFCA 3GGZA 1UVHA 2JD80 4LPJA 4TO9A 2FHAA 4CYAA 2CF7A 2CHPA 3F32A 4PGIA 1LKMA 2JD60 4W4KB 1JGCA 1J30A 4TODA 4RC6B 2WLUA 4MKUA 4ERUA 2YJJA 5D8QA 5D8SA 4KXRB 5GU3X 2D5KA 1L8HA 3R2MA 4PG1A 3Q4OA 1F30A 1VELA 2G38B 3A68A 2XJOA 2C6RA 4TW3A 2ZA7A 3BVIA 3NOZX 1JI5A 4P18A 3KA3A 2BW1A 1NF6A 3MPSA 3QZ3A 4DZ0A 1QYBA 3BVKA 3F33A 4RC5A 1RYTA 5GU1X 4U3GA 1S30A 3UFBA 3PWFA 1SQ3A 3FRRA 3BVEA 2N02A 3FSEA 3PWQA 3KXUA 3KA6A 4DYZA 5D8YA 1RCGA 4MXPA 4RC7B 4LQNA 2WLAA 4ZTTA 3L0MA 1O9RA 2CLUA 4E40A 4YVZA 4Z5SA 3FRSA 3U90A 5IX6A 2C2UA 2QF9A 5J8WA 3F35A
chains in the Genus database with same CATH topology
3AF9X 4QUWA 2VXXA 1JTSA 2QQYA 5JKMG 3E1JA 1FHAA 2XGWA 5JDOA 3R2HA 3AF8X 5E1UA 4RC8A 4CYBA 3E1MA 3PWQC 3UOIA 1SOFA 2IY4A 3N6OA 3F37A 3GHQA 2C2JA 5FFEA 1LB3A 2Y3QA 1NFVA 2BK6A 4CVTA 4RC6A 2FKZA 3F34A 4DYXA 3C23A 4REUA 3WNWA 2OH3A 3AK8A 2CN6A 3GE4A 5D8PA 5HJHA 2V2SA 1TKPA 3F39A 4EVCA 2JD70 5GU0X 5FFAA 4YXMA 3R2SA 1JREA 1S3QA 3Q4QA 3ERZA 3EGMA 2IU2A 1ZUJA 3VVAA 2W0OA 2Z5RA 4TOCA 4XGSA 1L8IA 5FFBA 4RC7A 4E6KA 3LKDA 2FFXJ 4MN9A 2GS4A 3IQ1A 5LG2A 1MFRA 3AK9A 1JKUA 1BCFA 1NNQA 2ZA6A 3PVYB 2HTNA 2HR5A 4W4LB 4ISPA 2WTLA 1JI4A 1GWGA 3RGDA 4ISMA 4A25A 1ZS3A 2V2NA 4CVRA 2Z5QA 3IS8A 3PVRB 4TOGA 3KX9A 1BG7A 1YV1A 3QB9A 2Y44A 1RCDA 3QHBA 3W54A 2VXIA 2YW7A 5LBHA 4CVSA 3TA8A 4EVEA 3QHCA 2CIHA 3R2RA 3NP2X 4PG0A 4XKTA 3IS7A 1BFRA 4DYYA 2XJNA 1Z6OM 5J8SA 3QD8A 3PW1B 1XZ3A 2FG8A 4LQJA 1IERA 2RBDA 4ZKHA 5GOUA 2V2MA 4LQVA 3KA8A 4Z3BA 3HIUA 3AJPA 3E1PA 3QVDA 4X0JA 4XKUA 4M34A 5CMRA 5HJFA 5HQOA 3E1OA 4EVDA 3O7SA 3D19A 4ZKWA 1QGHA 4TOBA 5LS9A 1OTKA 4MJYA 1EUMA 5E2DA 2V2JA 4R42A 4LQHA 1VEQA 2V2PA 4ETRA 3A9QA 5I4JA 1LKOA 3WVVA 5D8OA 2XKQA 4LYXA 4M32A 3H7GA 3PVRA 3UNOA 3E2CA 4TOFA 5ERJA 1NF4A 2Z90A 3E1NA 3O7RA 1F33A 3BVLA 5D8RA 3UOFA 4DYUA 1O9IA 4EVBA 4KVRA 1H96A 4PGKA 3R2LA 4ZMCA 3BVFA 3JZ9A 3KDQA 3FVBA 2IB0A 1AEWA 2G4HA 3OGHA 5GN8B 4ML5A 2VZBA 3Q4NA 5JKLA 4ZL6A 3GGYA 1RCEA 3F38A 4YKHA 3ISFA 3PW1A 5AXSA 4CVPA 1IESA 1N1QA 4ZL5A 4TOAA 4LYUA 3PZAA 4KVQA 4AM4A 3E6SA 3AJQA 3FI6A 5JKMA 3KA4A 1S2ZA 5CZUA 2UX1A 3PVTB 4TOEA 2Z5PA 5GU2X 3WVWA 4DE6A 3ES3A 2BKCA 1MOJA 4LPNA 4ITWA 3RD0A 2V2OA 1YUZA 5K53A 5LG8A 1LKPA 2ZA8A 4OYNA 3SE1A 2FG4A 2YJKA 3RAVA 1TKOA 3BKNA 2OC5A 4M33A 5J93A 1DVBA 4TOHA 2C2FA 3JZAB 3T9JA 3E1LA 3M6JA 3PW8A 3R2KA 3C1YA 3NP0X 4WJG4 2ITBA 3C1ZA 1JKVA 1Z4AA 3KWOA 4ITTA 3BT5A 3RE7A 5GN8A 2OKCA 4MUDA 4II4B 4AM5A 1TJOA 3E1QA 5HU6D 4Y08A 4KVSA 5JACA 2V2IA 2CHIA 2MGYA 4ZLWA 4IWKA 5JKLG 2FL0A 3WVUA 4MY7A 5CMQA 3PVYA 2V15A 4IXKA 4IWJA 1JIGA 3SHXA 4ZJKA 3R2OA 3VNXA 1RCIA 1TK6A 3PW8C 4AM2A 3KHKA 5D8XA 3RBCA 2WWXB 4CMYA 5ERKA 4YXJA 3DBYA 2FJCA 4XKSA 2V2RA 3PVTA 1B71A 2ZG8X 1XZ1A 3ISEA 3F36A 1HRSA 1YUXA 1DATA 2Z6MA 2AR0A 2CEIA 4LPMA 4M35A 1VLGA 2X170 5C6FA 5FFDA 3SH6A 2GYQA 2XJMA 3AJOA 4ZKXA 4RC5B 3HL1A 2ZG9X 1VEIA 3AF7X 2GYDA 2V2LA 3KA9A 3SIDA 4DASA 5J9VA 1DPSA 2C41A 2PYBA 3GVYA 4CY9A 1JYBA 3C21A 2V8UA 3E6RA 3EZUA 3V3KB 4II4A 2F7NA 2CLBA 2CWLA 2YW6A 1Z6OA 2ZG7X 4DI0A 4CMYV 2ZURX 2V8TA 1RCCA 3EZ0A 5K52A 2BJYA 3OJ5A 1UMNA 2FZFA 5JDOB 1KRQA 1VJXA 2CN7A 3Q4RA 1R03A 5FEJA 3VV9A 5FFCA 3GGZA 1UVHA 2JD80 4LPJA 4TO9A 2FHAA 4CYAA 2CF7A 2CHPA 3F32A 4PGIA 1LKMA 2JD60 4W4KB 1JGCA 1J30A 4TODA 4RC6B 2WLUA 4MKUA 4ERUA 2YJJA 5D8QA 5D8SA 4KXRB 5GU3X 2D5KA 1L8HA 3R2MA 4PG1A 3Q4OA 1F30A 1VELA 2G38B 3A68A 2XJOA 2C6RA 4TW3A 2ZA7A 3BVIA 3NOZX 1JI5A 4P18A 3KA3A 2BW1A 1NF6A 3MPSA 3QZ3A 4DZ0A 1QYBA 3BVKA 3F33A 4RC5A 1RYTA 5GU1X 4U3GA 1S30A 3UFBA 3PWFA 1SQ3A 3FRRA 3BVEA 2N02A 3FSEA 3PWQA 3KXUA 3KA6A 4DYZA 5D8YA 1RCGA 4MXPA 4RC7B 4LQNA 2WLAA 4ZTTA 3L0MA 1O9RA 2CLUA 4E40A 4YVZA 4Z5SA 3FRSA 3U90A 5IX6A 2C2UA 2QF9A 5J8WA 3F35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AF9 X;  4QUW A;  2VXX A;  1JTS A;  2QQY A;  5JKM G;  3E1J A;  1FHA A;  2XGW A;  3R2H A;  3AF8 X;  5E1U A;  4RC8 A;  4CYB A;  3E1M A;  3PWQ C;  3UOI A;  1SOF A;  2IY4 A;  3F37 A;  3GHQ A;  2C2J A;  5FFE A;  1LB3 A;  2Y3Q A;  1NFV A;  2BK6 A;  4CVT A;  4RC6 A;  2FKZ A;  3F34 A;  4DYX A;  4REU A;  3WNW A;  2OH3 A;  3AK8 A;  2CN6 A;  3GE4 A;  5D8P A;  5HJH A;  2V2S A;  1TKP A;  3F39 A;  4EVC A;  2JD7 0;  5GU0 X;  5FFA A;  3R2S A;  1JRE A;  1S3Q A;  3Q4Q A;  3ERZ A;  3EGM A;  2IU2 A;  1ZUJ A;  2W0O A;  2Z5R A;  4TOC A;  4XGS A;  1L8I A;  5FFB A;  4RC7 A;  4E6K A;  2FFX J;  4MN9 A;  2GS4 A;  3IQ1 A;  5LG2 A;  1MFR A;  3AK9 A;  1JKU A;  1BCF A;  1NNQ A;  2ZA6 A;  3PVY B;  2HTN A;  2HR5 A;  4ISP A;  2WTL A;  1JI4 A;  1GWG A;  3RGD A;  4ISM A;  4A25 A;  1ZS3 A;  2V2N A;  4CVR A;  2Z5Q A;  3IS8 A;  3PVR B;  4TOG A;  3KX9 A;  1BG7 A;  1YV1 A;  3QB9 A;  1RCD A;  3QHB A;  2VXI A;  2YW7 A;  5LBH A;  4CVS A;  3TA8 A;  4EVE A;  3QHC A;  2CIH A;  3R2R A;  3NP2 X;  4PG0 A;  4XKT A;  3IS7 A;  1BFR A;  4DYY A;  2XJN A;  1Z6O M;  5J8S A;  3QD8 A;  3PW1 B;  1XZ3 A;  2FG8 A;  4LQJ A;  1IER A;  2RBD A;  4ZKH A;  5GOU A;  2V2M A;  4LQV A;  3KA8 A;  4Z3B A;  3HIU A;  3AJP A;  3E1P A;  3QVD A;  4XKU A;  4M34 A;  5CMR A;  5HJF A;  5HQO A;  3E1O A;  4EVD A;  3O7S A;  4ZKW A;  1QGH A;  4TOB A;  5LS9 A;  1OTK A;  4MJY A;  1EUM A;  5E2D A;  2V2J A;  4R42 A;  4LQH A;  1VEQ A;  2V2P A;  4ETR A;  3A9Q A;  5I4J A;  1LKO A;  3WVV A;  5D8O A;  2XKQ A;  4LYX A;  4M32 A;  3H7G A;  3PVR A;  3UNO A;  3E2C A;  4TOF A;  5ERJ A;  1NF4 A;  2Z90 A;  3E1N A;  3O7R A;  1F33 A;  3BVL A;  5D8R A;  3UOF A;  4DYU A;  1O9I A;  4EVB A;  4KVR A;  1H96 A;  4PGK A;  3R2L A;  4ZMC A;  3BVF A;  3FVB A;  2IB0 A;  1AEW A;  2G4H A;  3OGH A;  5GN8 B;  4ML5 A;  2VZB A;  3Q4N A;  5JKL A;  4ZL6 A;  1RCE A;  3F38 A;  4YKH A;  3ISF A;  3PW1 A;  5AXS A;  4CVP A;  1IES A;  1N1Q A;  4ZL5 A;  4TOA A;  4LYU A;  3PZA A;  4KVQ A;  4AM4 A;  3E6S A;  3AJQ A;  3FI6 A;  5JKM A;  3KA4 A;  1S2Z A;  5CZU A;  2UX1 A;  3PVT B;  4TOE A;  2Z5P A;  5GU2 X;  3WVW A;  4DE6 A;  3ES3 A;  2BKC A;  1MOJ A;  4LPN A;  4ITW A;  3RD0 A;  2V2O A;  1YUZ A;  5K53 A;  5LG8 A;  1LKP A;  2ZA8 A;  4OYN A;  3SE1 A;  2FG4 A;  2YJK A;  3RAV A;  1TKO A;  3BKN A;  2OC5 A;  4M33 A;  5J93 A;  1DVB A;  4TOH A;  2C2F A;  3T9J A;  3E1L A;  3PW8 A;  3R2K A;  3NP0 X;  2ITB A;  1JKV A;  1Z4A A;  3KWO A;  4ITT A;  3BT5 A;  3RE7 A;  5GN8 A;  4MUD A;  4II4 B;  4AM5 A;  1TJO A;  3E1Q A;  4Y08 A;  4KVS A;  5JAC A;  2V2I A;  2CHI A;  4ZLW A;  4IWK A;  5JKL G;  2FL0 A;  3WVU A;  4MY7 A;  5CMQ A;  3PVY A;  2V15 A;  4IXK A;  4IWJ A;  1JIG A;  3SHX A;  4ZJK A;  3R2O A;  3VNX A;  1RCI A;  1TK6 A;  3PW8 C;  4AM2 A;  5D8X A;  3RBC A;  4CMY A;  5ERK A;  2FJC A;  4XKS A;  2V2R A;  3PVT A;  1B71 A;  2ZG8 X;  1XZ1 A;  3ISE A;  3F36 A;  1HRS A;  1YUX A;  1DAT A;  2Z6M A;  2CEI A;  4LPM A;  4M35 A;  1VLG A;  2X17 0;  5C6F A;  5FFD A;  3SH6 A;  2GYQ A;  2XJM A;  3AJO A;  4ZKX A;  4RC5 B;  3HL1 A;  2ZG9 X;  1VEI A;  3AF7 X;  2GYD A;  2V2L A;  3KA9 A;  3SID A;  4DAS A;  5J9V A;  1DPS A;  2C41 A;  2PYB A;  3GVY A;  4CY9 A;  1JYB A;  3E6R A;  3EZU A;  4II4 A;  2F7N A;  2CLB A;  2YW6 A;  1Z6O A;  2ZG7 X;  4DI0 A;  4CMY V;  2ZUR X;  1RCC A;  3EZ0 A;  5K52 A;  2BJY A;  3OJ5 A;  1UMN A;  2FZF A;  1KRQ A;  1VJX A;  2CN7 A;  3Q4R A;  1R03 A;  5FEJ A;  5FFC A;  4LPJ A;  1UVH A;  2JD8 0;  4TO9 A;  2FHA A;  4CYA A;  2CF7 A;  2CHP A;  3F32 A;  4PGI A;  1LKM A;  2JD6 0;  1JGC A;  1J30 A;  4TOD A;  4RC6 B;  2WLU A;  4MKU A;  4ERU A;  2YJJ A;  5D8Q A;  5D8S A;  5GU3 X;  2D5K A;  1L8H A;  3R2M A;  4PG1 A;  3Q4O A;  1F30 A;  1VEL A;  3A68 A;  2XJO A;  2C6R A;  4TW3 A;  2ZA7 A;  3BVI A;  3NOZ X;  1JI5 A;  4P18 A;  3KA3 A;  2BW1 A;  1NF6 A;  3MPS A;  3QZ3 A;  4DZ0 A;  1QYB A;  3BVK A;  3F33 A;  4RC5 A;  1RYT A;  5GU1 X;  4U3G A;  1S30 A;  3PWF A;  1SQ3 A;  3BVE A;  3FSE A;  3PWQ A;  3KXU A;  3KA6 A;  4DYZ A;  5D8Y A;  1RCG A;  4RC7 B;  4LQN A;  2WLA A;  4ZTT A;  1O9R A;  2CLU A;  4Z5S A;  3U90 A;  5IX6 A;  2C2U A;  2QF9 A;  5J8W A;  3F35 A; 
#chains in the Genus database with same CATH topology
 3AF9 X;  4QUW A;  2VXX A;  1JTS A;  2QQY A;  5JKM G;  3E1J A;  1FHA A;  2XGW A;  5JDO A;  3R2H A;  3AF8 X;  5E1U A;  4RC8 A;  4CYB A;  3E1M A;  3PWQ C;  3UOI A;  1SOF A;  2IY4 A;  3N6O A;  3F37 A;  3GHQ A;  2C2J A;  5FFE A;  1LB3 A;  2Y3Q A;  1NFV A;  2BK6 A;  4CVT A;  4RC6 A;  2FKZ A;  3F34 A;  4DYX A;  3C23 A;  4REU A;  3WNW A;  2OH3 A;  3AK8 A;  2CN6 A;  3GE4 A;  5D8P A;  5HJH A;  2V2S A;  1TKP A;  3F39 A;  4EVC A;  2JD7 0;  5GU0 X;  5FFA A;  4YXM A;  3R2S A;  1JRE A;  1S3Q A;  3Q4Q A;  3ERZ A;  3EGM A;  2IU2 A;  1ZUJ A;  3VVA A;  2W0O A;  2Z5R A;  4TOC A;  4XGS A;  1L8I A;  5FFB A;  4RC7 A;  4E6K A;  3LKD A;  2FFX J;  4MN9 A;  2GS4 A;  3IQ1 A;  5LG2 A;  1MFR A;  3AK9 A;  1JKU A;  1BCF A;  1NNQ A;  2ZA6 A;  3PVY B;  2HTN A;  2HR5 A;  4W4L B;  4ISP A;  2WTL A;  1JI4 A;  1GWG A;  3RGD A;  4ISM A;  4A25 A;  1ZS3 A;  2V2N A;  4CVR A;  2Z5Q A;  3IS8 A;  3PVR B;  4TOG A;  3KX9 A;  1BG7 A;  1YV1 A;  3QB9 A;  2Y44 A;  1RCD A;  3QHB A;  3W54 A;  2VXI A;  2YW7 A;  5LBH A;  4CVS A;  3TA8 A;  4EVE A;  3QHC A;  2CIH A;  3R2R A;  3NP2 X;  4PG0 A;  4XKT A;  3IS7 A;  1BFR A;  4DYY A;  2XJN A;  1Z6O M;  5J8S A;  3QD8 A;  3PW1 B;  1XZ3 A;  2FG8 A;  4LQJ A;  1IER A;  2RBD A;  4ZKH A;  5GOU A;  2V2M A;  4LQV A;  3KA8 A;  4Z3B A;  3HIU A;  3AJP A;  3E1P A;  3QVD A;  4X0J A;  4XKU A;  4M34 A;  5CMR A;  5HJF A;  5HQO A;  3E1O A;  4EVD A;  3O7S A;  3D19 A;  4ZKW A;  1QGH A;  4TOB A;  5LS9 A;  1OTK A;  4MJY A;  1EUM A;  5E2D A;  2V2J A;  4R42 A;  4LQH A;  1VEQ A;  2V2P A;  4ETR A;  3A9Q A;  5I4J A;  1LKO A;  3WVV A;  5D8O A;  2XKQ A;  4LYX A;  4M32 A;  3H7G A;  3PVR A;  3UNO A;  3E2C A;  4TOF A;  5ERJ A;  1NF4 A;  2Z90 A;  3E1N A;  3O7R A;  1F33 A;  3BVL A;  5D8R A;  3UOF A;  4DYU A;  1O9I A;  4EVB A;  4KVR A;  1H96 A;  4PGK A;  3R2L A;  4ZMC A;  3BVF A;  3JZ9 A;  3KDQ A;  3FVB A;  2IB0 A;  1AEW A;  2G4H A;  3OGH A;  5GN8 B;  4ML5 A;  2VZB A;  3Q4N A;  5JKL A;  4ZL6 A;  3GGY A;  1RCE A;  3F38 A;  4YKH A;  3ISF A;  3PW1 A;  5AXS A;  4CVP A;  1IES A;  1N1Q A;  4ZL5 A;  4TOA A;  4LYU A;  3PZA A;  4KVQ A;  4AM4 A;  3E6S A;  3AJQ A;  3FI6 A;  5JKM A;  3KA4 A;  1S2Z A;  5CZU A;  2UX1 A;  3PVT B;  4TOE A;  2Z5P A;  5GU2 X;  3WVW A;  4DE6 A;  3ES3 A;  2BKC A;  1MOJ A;  4LPN A;  4ITW A;  3RD0 A;  2V2O A;  1YUZ A;  5K53 A;  5LG8 A;  1LKP A;  2ZA8 A;  4OYN A;  3SE1 A;  2FG4 A;  2YJK A;  3RAV A;  1TKO A;  3BKN A;  2OC5 A;  4M33 A;  5J93 A;  1DVB A;  4TOH A;  2C2F A;  3JZA B;  3T9J A;  3E1L A;  3M6J A;  3PW8 A;  3R2K A;  3C1Y A;  3NP0 X;  4WJG 4;  2ITB A;  3C1Z A;  1JKV A;  1Z4A A;  3KWO A;  4ITT A;  3BT5 A;  3RE7 A;  5GN8 A;  2OKC A;  4MUD A;  4II4 B;  4AM5 A;  1TJO A;  3E1Q A;  5HU6 D;  4Y08 A;  4KVS A;  5JAC A;  2V2I A;  2CHI A;  2MGY A;  4ZLW A;  4IWK A;  5JKL G;  2FL0 A;  3WVU A;  4MY7 A;  5CMQ A;  3PVY A;  2V15 A;  4IXK A;  4IWJ A;  1JIG A;  3SHX A;  4ZJK A;  3R2O A;  3VNX A;  1RCI A;  1TK6 A;  3PW8 C;  4AM2 A;  3KHK A;  5D8X A;  3RBC A;  2WWX B;  4CMY A;  5ERK A;  4YXJ A;  3DBY A;  2FJC A;  4XKS A;  2V2R A;  3PVT A;  1B71 A;  2ZG8 X;  1XZ1 A;  3ISE A;  3F36 A;  1HRS A;  1YUX A;  1DAT A;  2Z6M A;  2AR0 A;  2CEI A;  4LPM A;  4M35 A;  1VLG A;  2X17 0;  5C6F A;  5FFD A;  3SH6 A;  2GYQ A;  2XJM A;  3AJO A;  4ZKX A;  4RC5 B;  3HL1 A;  2ZG9 X;  1VEI A;  3AF7 X;  2GYD A;  2V2L A;  3KA9 A;  3SID A;  4DAS A;  5J9V A;  1DPS A;  2C41 A;  2PYB A;  3GVY A;  4CY9 A;  1JYB A;  3C21 A;  2V8U A;  3E6R A;  3EZU A;  3V3K B;  4II4 A;  2F7N A;  2CLB A;  2CWL A;  2YW6 A;  1Z6O A;  2ZG7 X;  4DI0 A;  4CMY V;  2ZUR X;  2V8T A;  1RCC A;  3EZ0 A;  5K52 A;  2BJY A;  3OJ5 A;  1UMN A;  2FZF A;  5JDO B;  1KRQ A;  1VJX A;  2CN7 A;  3Q4R A;  1R03 A;  5FEJ A;  3VV9 A;  5FFC A;  3GGZ A;  1UVH A;  2JD8 0;  4LPJ A;  4TO9 A;  2FHA A;  4CYA A;  2CF7 A;  2CHP A;  3F32 A;  4PGI A;  1LKM A;  2JD6 0;  4W4K B;  1JGC A;  1J30 A;  4TOD A;  4RC6 B;  2WLU A;  4MKU A;  4ERU A;  2YJJ A;  5D8Q A;  5D8S A;  4KXR B;  5GU3 X;  2D5K A;  1L8H A;  3R2M A;  4PG1 A;  3Q4O A;  1F30 A;  1VEL A;  2G38 B;  3A68 A;  2XJO A;  2C6R A;  4TW3 A;  2ZA7 A;  3BVI A;  3NOZ X;  1JI5 A;  4P18 A;  3KA3 A;  2BW1 A;  1NF6 A;  3MPS A;  3QZ3 A;  4DZ0 A;  1QYB A;  3BVK A;  3F33 A;  4RC5 A;  1RYT A;  5GU1 X;  4U3G A;  1S30 A;  3UFB A;  3PWF A;  1SQ3 A;  3FRR A;  3BVE A;  2N02 A;  3FSE A;  3PWQ A;  3KXU A;  3KA6 A;  4DYZ A;  5D8Y A;  1RCG A;  4MXP A;  4RC7 B;  4LQN A;  2WLA A;  4ZTT A;  3L0M A;  1O9R A;  2CLU A;  4E40 A;  4YVZ A;  4Z5S A;  3FRS A;  3U90 A;  5IX6 A;  2C2U A;  2QF9 A;  5J8W A;  3F35 A; 
#chains in the Genus database with same CATH homology
 3AF9 X;  4QUW A;  2VXX A;  1JTS A;  2QQY A;  5JKM G;  3E1J A;  1FHA A;  2XGW A;  5JDO A;  3R2H A;  3AF8 X;  5E1U A;  4RC8 A;  4CYB A;  3E1M A;  3PWQ C;  3UOI A;  1SOF A;  2IY4 A;  3N6O A;  3F37 A;  3GHQ A;  2C2J A;  5FFE A;  1LB3 A;  2Y3Q A;  1NFV A;  2BK6 A;  4CVT A;  4RC6 A;  2FKZ A;  3F34 A;  4DYX A;  3C23 A;  4REU A;  3WNW A;  2OH3 A;  3AK8 A;  2CN6 A;  3GE4 A;  5D8P A;  5HJH A;  2V2S A;  1TKP A;  3F39 A;  4EVC A;  2JD7 0;  5GU0 X;  5FFA A;  4YXM A;  3R2S A;  1JRE A;  1S3Q A;  3Q4Q A;  3ERZ A;  3EGM A;  2IU2 A;  1ZUJ A;  3VVA A;  2W0O A;  2Z5R A;  4TOC A;  4XGS A;  1L8I A;  5FFB A;  4RC7 A;  4E6K A;  3LKD A;  2FFX J;  4MN9 A;  2GS4 A;  3IQ1 A;  5LG2 A;  1MFR A;  3AK9 A;  1JKU A;  1BCF A;  1NNQ A;  2ZA6 A;  3PVY B;  2HTN A;  2HR5 A;  4W4L B;  4ISP A;  2WTL A;  1JI4 A;  1GWG A;  3RGD A;  4ISM A;  4A25 A;  1ZS3 A;  2V2N A;  4CVR A;  2Z5Q A;  3IS8 A;  3PVR B;  4TOG A;  3KX9 A;  1BG7 A;  1YV1 A;  3QB9 A;  2Y44 A;  1RCD A;  3QHB A;  3W54 A;  2VXI A;  2YW7 A;  5LBH A;  4CVS A;  3TA8 A;  4EVE A;  3QHC A;  2CIH A;  3R2R A;  3NP2 X;  4PG0 A;  4XKT A;  3IS7 A;  1BFR A;  4DYY A;  2XJN A;  1Z6O M;  5J8S A;  3QD8 A;  3PW1 B;  1XZ3 A;  2FG8 A;  4LQJ A;  1IER A;  2RBD A;  4ZKH A;  5GOU A;  2V2M A;  4LQV A;  3KA8 A;  4Z3B A;  3HIU A;  3AJP A;  3E1P A;  3QVD A;  4X0J A;  4XKU A;  4M34 A;  5CMR A;  5HJF A;  5HQO A;  3E1O A;  4EVD A;  3O7S A;  3D19 A;  4ZKW A;  1QGH A;  4TOB A;  5LS9 A;  1OTK A;  4MJY A;  1EUM A;  5E2D A;  2V2J A;  4R42 A;  4LQH A;  1VEQ A;  2V2P A;  4ETR A;  3A9Q A;  5I4J A;  1LKO A;  3WVV A;  5D8O A;  2XKQ A;  4LYX A;  4M32 A;  3H7G A;  3PVR A;  3UNO A;  3E2C A;  4TOF A;  5ERJ A;  1NF4 A;  2Z90 A;  3E1N A;  3O7R A;  1F33 A;  3BVL A;  5D8R A;  3UOF A;  4DYU A;  1O9I A;  4EVB A;  4KVR A;  1H96 A;  4PGK A;  3R2L A;  4ZMC A;  3BVF A;  3JZ9 A;  3KDQ A;  3FVB A;  2IB0 A;  1AEW A;  2G4H A;  3OGH A;  5GN8 B;  4ML5 A;  2VZB A;  3Q4N A;  5JKL A;  4ZL6 A;  3GGY A;  1RCE A;  3F38 A;  4YKH A;  3ISF A;  3PW1 A;  5AXS A;  4CVP A;  1IES A;  1N1Q A;  4ZL5 A;  4TOA A;  4LYU A;  3PZA A;  4KVQ A;  4AM4 A;  3E6S A;  3AJQ A;  3FI6 A;  5JKM A;  3KA4 A;  1S2Z A;  5CZU A;  2UX1 A;  3PVT B;  4TOE A;  2Z5P A;  5GU2 X;  3WVW A;  4DE6 A;  3ES3 A;  2BKC A;  1MOJ A;  4LPN A;  4ITW A;  3RD0 A;  2V2O A;  1YUZ A;  5K53 A;  5LG8 A;  1LKP A;  2ZA8 A;  4OYN A;  3SE1 A;  2FG4 A;  2YJK A;  3RAV A;  1TKO A;  3BKN A;  2OC5 A;  4M33 A;  5J93 A;  1DVB A;  4TOH A;  2C2F A;  3JZA B;  3T9J A;  3E1L A;  3M6J A;  3PW8 A;  3R2K A;  3C1Y A;  3NP0 X;  4WJG 4;  2ITB A;  3C1Z A;  1JKV A;  1Z4A A;  3KWO A;  4ITT A;  3BT5 A;  3RE7 A;  5GN8 A;  2OKC A;  4MUD A;  4II4 B;  4AM5 A;  1TJO A;  3E1Q A;  5HU6 D;  4Y08 A;  4KVS A;  5JAC A;  2V2I A;  2CHI A;  2MGY A;  4ZLW A;  4IWK A;  5JKL G;  2FL0 A;  3WVU A;  4MY7 A;  5CMQ A;  3PVY A;  2V15 A;  4IXK A;  4IWJ A;  1JIG A;  3SHX A;  4ZJK A;  3R2O A;  3VNX A;  1RCI A;  1TK6 A;  3PW8 C;  4AM2 A;  3KHK A;  5D8X A;  3RBC A;  2WWX B;  4CMY A;  5ERK A;  4YXJ A;  3DBY A;  2FJC A;  4XKS A;  2V2R A;  3PVT A;  1B71 A;  2ZG8 X;  1XZ1 A;  3ISE A;  3F36 A;  1HRS A;  1YUX A;  1DAT A;  2Z6M A;  2AR0 A;  2CEI A;  4LPM A;  4M35 A;  1VLG A;  2X17 0;  5C6F A;  5FFD A;  3SH6 A;  2GYQ A;  2XJM A;  3AJO A;  4ZKX A;  4RC5 B;  3HL1 A;  2ZG9 X;  1VEI A;  3AF7 X;  2GYD A;  2V2L A;  3KA9 A;  3SID A;  4DAS A;  5J9V A;  1DPS A;  2C41 A;  2PYB A;  3GVY A;  4CY9 A;  1JYB A;  3C21 A;  2V8U A;  3E6R A;  3EZU A;  3V3K B;  4II4 A;  2F7N A;  2CLB A;  2CWL A;  2YW6 A;  1Z6O A;  2ZG7 X;  4DI0 A;  4CMY V;  2ZUR X;  2V8T A;  1RCC A;  3EZ0 A;  5K52 A;  2BJY A;  3OJ5 A;  1UMN A;  2FZF A;  5JDO B;  1KRQ A;  1VJX A;  2CN7 A;  3Q4R A;  1R03 A;  5FEJ A;  3VV9 A;  5FFC A;  3GGZ A;  1UVH A;  2JD8 0;  4LPJ A;  4TO9 A;  2FHA A;  4CYA A;  2CF7 A;  2CHP A;  3F32 A;  4PGI A;  1LKM A;  2JD6 0;  4W4K B;  1JGC A;  1J30 A;  4TOD A;  4RC6 B;  2WLU A;  4MKU A;  4ERU A;  2YJJ A;  5D8Q A;  5D8S A;  4KXR B;  5GU3 X;  2D5K A;  1L8H A;  3R2M A;  4PG1 A;  3Q4O A;  1F30 A;  1VEL A;  2G38 B;  3A68 A;  2XJO A;  2C6R A;  4TW3 A;  2ZA7 A;  3BVI A;  3NOZ X;  1JI5 A;  4P18 A;  3KA3 A;  2BW1 A;  1NF6 A;  3MPS A;  3QZ3 A;  4DZ0 A;  1QYB A;  3BVK A;  3F33 A;  4RC5 A;  1RYT A;  5GU1 X;  4U3G A;  1S30 A;  3UFB A;  3PWF A;  1SQ3 A;  3FRR A;  3BVE A;  2N02 A;  3FSE A;  3PWQ A;  3KXU A;  3KA6 A;  4DYZ A;  5D8Y A;  1RCG A;  4MXP A;  4RC7 B;  4LQN A;  2WLA A;  4ZTT A;  3L0M A;  1O9R A;  2CLU A;  4E40 A;  4YVZ A;  4Z5S A;  3FRS A;  3U90 A;  5IX6 A;  2C2U A;  2QF9 A;  5J8W A;  3F35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...