3SIDA

Crystal structure of oxidized symerythrin from cyanophora paradoxa, azide adduct at 50% occupancy
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
177
structure length
177
Chain Sequence
NYNQEDFMGLDRFFQDAVSHNNTDANAASSIEVEMYECDCMYPTFAEIARRSGQPEIGAMFDAIAKEEGMHAQLLTKLYSELEVKDSAETLEAKRLVSTIESQIDAVASDSRGLRRALETALEVETIESQKTYPAFAKLAAEQGNMEVATAFEAIVKSETKHANWVKRALENLLEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Symerythrin
publication title Symerythrin structures at atomic resolution and the origins of rubrerythrins and the ferritin-like superfamily.
pubmed doi rcsb
source organism Cyanophora paradoxa
total genus 82
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02915 Rubrerythrin Rubrerythrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3sidA00
2JD60 4OYNA 1LKOA 5J8WA 3BKNA 2FHAA 2IU2A 5LBHA 4ZKXA 4ZL5A 3ISEA 2FG8A 3UNOA 3IS8A 4EVEA 1BG7A 4U3GA 5GU2X 5C6FA 2Z6MA 5D8RA 3E1OA 2Z5QA 3PVYB 4DI0A 1RCCA 3QZ3A 3BVLA 1AEWA 5CZUA 1ZS3A 3R2HA 4PG0A 2VXIA 1NF4A 5HJHA 5FFDA 1XZ3A 4ZL6A 3FVBA 3SHXA 4XKUA 4CY9A 1S2ZA 4CVSA 1F33A 3F39A 1JKVA 2CF7A 3QD8A 2Z5PA 1JYBA 2ZA7A 2ZG8X 3GE4A 5ERJA 5K52A 5GN8A 5JKMG 3Q4QA 3SH6A 4LPNA 4LQHA 2CEIA 4MN9A 2V2RA 5HQOA 5IX6A 4RC7A 3FI6A 3NOZX 2YW6A 3T9JA 3Q4RA 3AJPA 3E1PA 4ZTTA 5ERKA 2CHIA 3Q4OA 5J93A 5CMQA 3PVRA 3PZAA 1JKUA 3AK9A 4XGSA 5D8OA 3AF8X 2QQYA 1NNQA 2ZURX 1Z6OA 3SE1A 3RD0A 5K53A 5JKMA 4AM4A 1Z6OM 4ZMCA 2C2UA 1O9IA 3F37A 2G4HA 3PWFA 1SQ3A 4MJYA 1QYBA 4TOGA 2WTLA 4MUDA 4KVRA 1IESA 3GVYA 4PGKA 4RC8A 2YW7A 4QUWA 2C6RA 1RCDA 4DYXA 3E1QA 4II4A 2CLUA 3HL1A 3RBCA 4ETRA 1VEQA 1MOJA 1UMNA 1IERA 5E2DA 3PVTA 4Z3BA 2V15A 2XJNA 3ERZA 2Z5RA 3F32A 3R2OA 4M34A 2VZBA 4ISMA 4ISPA 3GHQA 2FL0A 2WLUA 4LPMA 3KX9A 4DYUA 3E1NA 3KA8A 5GN8B 2ZA8A 2IY4A 3MPSA 3RAVA 3SIDA 4ZKWA 2BW1A 5FFBA 4RC7B 2ITBA 1XZ1A 3PW8C 3F38A 4TOAA 4E6KA 2CIHA 4AM2A 4CVTA 3WVVA 3E6RA 2XJMA 5E1UA 5J9VA 1MFRA 3E6SA 2F7NA 5LG2A 2C2FA 3VNXA 5JKLG 2ZG7X 2C41A 3BVEA 2FFXJ 1YUXA 1H96A 4CMYV 3A68A 4LPJA 3IS7A 2HR5A 1JI5A 1TKOA 2FG4A 5LS9A 3E1JA 2V2LA 1TJOA 2XGWA 2FKZA 5CMRA 2V2IA 4CVRA 1DVBA 3TA8A 3KA9A 4RC6B 3PW1B 4MKUA 1VELA 1DPSA 3RGDA 3AF9X 3QVDA 3F34A 2PYBA 3F36A 5FFAA 3R2MA 1LKMA 1R03A 2IB0A 4REUA 5FEJA 1LKPA 1Z4AA 3KWOA 4TO9A 3PVYA 3F33A 5JACA 3Q4NA 3AK8A 3O7SA 3KA4A 4TOCA 4ML5A 3HIUA 1JGCA 2OH3A 3WVWA 3AF7X 1GWGA 4A25A 1VJXA 1BFRA 3E1LA 3O7RA 4KVSA 4KVQA 4DZ0A 4PGIA 4CVPA 3R2KA 3PWQC 4TOFA 1L8HA 2V2PA 5GOUA 4AM5A 2QF9A 3KXUA 4R42A 4XKTA 1UVHA 2BK6A 2YJKA 1RCIA 3EZUA 1JI4A 3E2CA 2GYDA 3BT5A 3RE7A 4TODA 4TOEA 3OJ5A 5D8QA 4CMYA 5GU0X 3A9QA 3OGHA 4ZLWA 1YUZA 3PWQA 4ITWA 4LQVA 4IWKA 2JD80 4MY7A 4RC5A 4ERUA 2V2MA 3R2RA 2BJYA 1VLGA 4DE6A 4Y08A 1N1QA 2CN6A 2Y3QA 4IXKA 4XKSA 2FJCA 3IQ1A 1RCGA 2WLAA 4TOHA 3EZ0A 2JD70 2BKCA 4ZKHA 2GYQA 4ITTA 4Z5SA 5FFEA 1RCEA 1EUMA 3PVRB 3KA3A 3QHBA 2CLBA 2VXXA 2W0OA 2YJJA 1JTSA 5LG8A 2X170 4M32A 5I4JA 1VEIA 1FHAA 4TOBA 3WVUA 3FSEA 2FZFA 1F30A 2C2JA 3U90A 1YV1A 4CYAA 4EVBA 3UOFA 2CN7A 3E1MA 2XJOA 4EVDA 3PW8A 3WNWA 4LQJA 1S3QA 3BVFA 1HRSA 1OTKA 1NF6A 1RYTA 1TK6A 2V2OA 4II4B 5GU3X 1SOFA 3NP0X 4CYBA 3BVKA 1S30A 5JKLA 2ZA6A 4LYUA 1KRQA 2D5KA 1LB3A 2UX1A 4LYXA 3PVTB 4YKHA 5D8XA 3AJOA 3QB9A 2ZG9X 3ES3A 3ISFA 1DATA 3QHCA 1JIGA 2RBDA 5GU1X 3BVIA 4IWJA 4P18A 4RC5B 2Z90A 5HJFA 1TKPA 2OC5A 2CHPA 4DYYA 3EGMA 1J30A 4DYZA 2V2JA 5D8SA 2V2SA 4ZJKA 4LQNA 3NP2X 5AXSA 3KA6A 1L8IA 3H7GA 1JREA 3UOIA 4TW3A 1ZUJA 1B71A 3R2SA 2XKQA 5J8SA 4M35A 2HTNA 1QGHA 5FFCA 5D8PA 2GS4A 1NFVA 1O9RA 4DASA 4RC6A 1BCFA 3PW1A 5D8YA 3R2LA 4M33A 4PG1A 3AJQA 2V2NA 3F35A 4EVCA
chains in the Genus database with same CATH superfamily
2JD60 4OYNA 1LKOA 5J8WA 3BKNA 2FHAA 2IU2A 5LBHA 4ZKXA 4ZL5A 3ISEA 2FG8A 3UNOA 3IS8A 4EVEA 1BG7A 4U3GA 5GU2X 5C6FA 2Z6MA 5D8RA 3E1OA 2Z5QA 3C1YA 3PVYB 4DI0A 1RCCA 3QZ3A 3BVLA 1AEWA 5CZUA 1ZS3A 3R2HA 4PG0A 2VXIA 1NF4A 5HJHA 5FFDA 1XZ3A 4ZL6A 4YXJA 3FVBA 3SHXA 4XKUA 4CY9A 1S2ZA 4CVSA 1F33A 3F39A 1JKVA 3N6OA 2CF7A 3QD8A 2Z5PA 1JYBA 2ZA7A 2ZG8X 3D19A 3GE4A 5ERJA 5K52A 5GN8A 5JKMG 3Q4QA 3SH6A 2V8UA 4LPNA 3W54A 4LQHA 2CEIA 4MN9A 2V2RA 5HQOA 5IX6A 4RC7A 3FI6A 3NOZX 3V3KB 2YW6A 3T9JA 3Q4RA 3AJPA 3E1PA 4ZTTA 5ERKA 2CHIA 3Q4OA 5J93A 5CMQA 3PVRA 3PZAA 1JKUA 3AK9A 4XGSA 5D8OA 3AF8X 2QQYA 1NNQA 4YXMA 2ZURX 1Z6OA 3SE1A 3RD0A 5K53A 5JKMA 4AM4A 4W4LB 1Z6OM 4KXRB 4ZMCA 3VVAA 2C2UA 1O9IA 3F37A 2G4HA 3PWFA 1SQ3A 4MJYA 1QYBA 4TOGA 2MGYA 2WTLA 4MUDA 4KVRA 1IESA 3GVYA 4PGKA 3UFBA 2WWXB 4RC8A 4E40A 2YW7A 4QUWA 2C6RA 1RCDA 4DYXA 3LKDA 3E1QA 4II4A 2CLUA 3HL1A 3RBCA 4ETRA 1VEQA 1MOJA 1UMNA 1IERA 5E2DA 3PVTA 4Z3BA 2V15A 2XJNA 3ERZA 3L0MA 2Z5RA 3F32A 3R2OA 4M34A 2VZBA 4ISMA 4ISPA 3GHQA 2FL0A 2WLUA 4LPMA 3KX9A 4DYUA 3E1NA 3KA8A 5GN8B 2ZA8A 2IY4A 5JDOA 3MPSA 3RAVA 3KDQA 3SIDA 4ZKWA 2BW1A 5FFBA 4RC7B 2ITBA 1XZ1A 3PW8C 3F38A 4TOAA 4E6KA 2CIHA 4AM2A 4CVTA 3WVVA 3E6RA 2XJMA 5E1UA 5J9VA 1MFRA 3E6SA 2F7NA 5LG2A 2C2FA 2OKCA 3VNXA 5JKLG 2ZG7X 2C41A 3BVEA 2FFXJ 1YUXA 1H96A 4CMYV 3A68A 4LPJA 3IS7A 2HR5A 1JI5A 1TKOA 2FG4A 5LS9A 3E1JA 2V2LA 2CWLA 1TJOA 2XGWA 2FKZA 5CMRA 2V2IA 4CVRA 1DVBA 3TA8A 3KA9A 4RC6B 3PW1B 4MKUA 1VELA 1DPSA 3GGYA 3RGDA 3AF9X 3QVDA 3F34A 2PYBA 3F36A 5FFAA 3R2MA 1LKMA 1R03A 2IB0A 4REUA 5FEJA 1LKPA 3C21A 1Z4AA 3KWOA 4TO9A 3PVYA 3F33A 5JACA 3Q4NA 3AK8A 3O7SA 3KA4A 4TOCA 4ML5A 3HIUA 1JGCA 2OH3A 3WVWA 3AF7X 1GWGA 3C1ZA 4A25A 1VJXA 1BFRA 3E1LA 3O7RA 4KVSA 4KVQA 4DZ0A 4PGIA 4CVPA 3R2KA 3PWQC 4TOFA 1L8HA 2V2PA 3C23A 5GOUA 4AM5A 2QF9A 3KXUA 4R42A 4XKTA 1UVHA 2BK6A 3M6JA 2YJKA 1RCIA 3EZUA 1JI4A 3KHKA 3E2CA 2GYDA 3BT5A 3VV9A 4W4KB 3FRRA 3RE7A 4TODA 2V8TA 4TOEA 3OJ5A 5D8QA 4CMYA 5GU0X 3A9QA 3OGHA 4ZLWA 1YUZA 3PWQA 4ITWA 4LQVA 4IWKA 2JD80 4MY7A 4RC5A 4ERUA 2V2MA 3R2RA 2BJYA 1VLGA 4DE6A 4Y08A 1N1QA 2CN6A 2Y3QA 4IXKA 4XKSA 2FJCA 3IQ1A 1RCGA 2WLAA 4TOHA 3EZ0A 2JD70 2BKCA 4ZKHA 2GYQA 4ITTA 4Z5SA 5FFEA 1RCEA 3DBYA 1EUMA 3PVRB 3KA3A 3QHBA 2CLBA 2VXXA 2W0OA 2YJJA 1JTSA 5LG8A 2X170 4M32A 2AR0A 2Y44A 4WJG4 5I4JA 1VEIA 1FHAA 4TOBA 3WVUA 3FSEA 2FZFA 1F30A 2C2JA 3U90A 1YV1A 4CYAA 4EVBA 3UOFA 2CN7A 3E1MA 2XJOA 4EVDA 3PW8A 3WNWA 4LQJA 1S3QA 3BVFA 1HRSA 1OTKA 1NF6A 1RYTA 1TK6A 2V2OA 4II4B 5GU3X 1SOFA 3NP0X 4CYBA 2G38B 3BVKA 1S30A 5JKLA 2ZA6A 4LYUA 1KRQA 2D5KA 1LB3A 2UX1A 4LYXA 3PVTB 4YKHA 5D8XA 3GGZA 2N02A 3AJOA 3QB9A 2ZG9X 3ES3A 3ISFA 1DATA 3QHCA 1JIGA 2RBDA 5GU1X 3BVIA 4IWJA 4P18A 4RC5B 2Z90A 5HJFA 1TKPA 2OC5A 2CHPA 4DYYA 3JZAB 3JZ9A 4YVZA 5JDOB 3EGMA 1J30A 4DYZA 2V2JA 5D8SA 5HU6D 2V2SA 4ZJKA 4LQNA 3NP2X 5AXSA 3KA6A 1L8IA 3H7GA 3FRSA 1JREA 3UOIA 4TW3A 1ZUJA 1B71A 3R2SA 4X0JA 2XKQA 5J8SA 4M35A 2HTNA 1QGHA 5FFCA 5D8PA 2GS4A 1NFVA 1O9RA 4DASA 4RC6A 1BCFA 3PW1A 5D8YA 3R2LA 4MXPA 4M33A 4PG1A 3AJQA 2V2NA 3F35A 4EVCA
chains in the Genus database with same CATH topology
2JD60 4OYNA 1LKOA 5J8WA 3BKNA 2FHAA 2IU2A 5LBHA 4ZKXA 4ZL5A 3ISEA 2FG8A 3UNOA 3IS8A 4EVEA 1BG7A 4U3GA 5GU2X 5C6FA 2Z6MA 5D8RA 3E1OA 2Z5QA 3C1YA 3PVYB 4DI0A 1RCCA 3QZ3A 3BVLA 1AEWA 5CZUA 1ZS3A 3R2HA 4PG0A 2VXIA 1NF4A 5HJHA 5FFDA 1XZ3A 4ZL6A 4YXJA 3FVBA 3SHXA 4XKUA 4CY9A 1S2ZA 4CVSA 1F33A 3F39A 1JKVA 3N6OA 2CF7A 3QD8A 2Z5PA 1JYBA 2ZA7A 2ZG8X 3D19A 3GE4A 5ERJA 5K52A 5GN8A 5JKMG 3Q4QA 3SH6A 2V8UA 4LPNA 3W54A 4LQHA 2CEIA 4MN9A 2V2RA 5HQOA 5IX6A 4RC7A 3FI6A 3NOZX 3V3KB 2YW6A 3T9JA 3Q4RA 3AJPA 3E1PA 4ZTTA 5ERKA 2CHIA 3Q4OA 5J93A 5CMQA 3PVRA 3PZAA 1JKUA 3AK9A 4XGSA 5D8OA 3AF8X 2QQYA 1NNQA 4YXMA 2ZURX 1Z6OA 3SE1A 3RD0A 5K53A 5JKMA 4AM4A 4W4LB 1Z6OM 4KXRB 4ZMCA 3VVAA 2C2UA 1O9IA 3F37A 2G4HA 3PWFA 1SQ3A 4MJYA 1QYBA 4TOGA 2MGYA 2WTLA 4MUDA 4KVRA 1IESA 3GVYA 4PGKA 3UFBA 2WWXB 4RC8A 4E40A 2YW7A 4QUWA 2C6RA 1RCDA 4DYXA 3LKDA 3E1QA 4II4A 2CLUA 3HL1A 3RBCA 4ETRA 1VEQA 1MOJA 1UMNA 1IERA 5E2DA 3PVTA 4Z3BA 2V15A 2XJNA 3ERZA 3L0MA 2Z5RA 3F32A 3R2OA 4M34A 2VZBA 4ISMA 4ISPA 3GHQA 2FL0A 2WLUA 4LPMA 3KX9A 4DYUA 3E1NA 3KA8A 5GN8B 2ZA8A 2IY4A 5JDOA 3MPSA 3RAVA 3KDQA 3SIDA 4ZKWA 2BW1A 5FFBA 4RC7B 2ITBA 1XZ1A 3PW8C 3F38A 4TOAA 4E6KA 2CIHA 4AM2A 4CVTA 3WVVA 3E6RA 2XJMA 5E1UA 5J9VA 1MFRA 3E6SA 2F7NA 5LG2A 2C2FA 2OKCA 3VNXA 5JKLG 2ZG7X 2C41A 3BVEA 2FFXJ 1YUXA 1H96A 4CMYV 3A68A 4LPJA 3IS7A 2HR5A 1JI5A 1TKOA 2FG4A 5LS9A 3E1JA 2V2LA 2CWLA 1TJOA 2XGWA 2FKZA 5CMRA 2V2IA 4CVRA 1DVBA 3TA8A 3KA9A 4RC6B 3PW1B 4MKUA 1VELA 1DPSA 3GGYA 3RGDA 3AF9X 3QVDA 3F34A 2PYBA 3F36A 5FFAA 3R2MA 1LKMA 1R03A 2IB0A 4REUA 5FEJA 1LKPA 3C21A 1Z4AA 3KWOA 4TO9A 3PVYA 3F33A 5JACA 3Q4NA 3AK8A 3O7SA 3KA4A 4TOCA 4ML5A 3HIUA 1JGCA 2OH3A 3WVWA 3AF7X 1GWGA 3C1ZA 4A25A 1VJXA 1BFRA 3E1LA 3O7RA 4KVSA 4KVQA 4DZ0A 4PGIA 4CVPA 3R2KA 3PWQC 4TOFA 1L8HA 2V2PA 3C23A 5GOUA 4AM5A 2QF9A 3KXUA 4R42A 4XKTA 1UVHA 2BK6A 3M6JA 2YJKA 1RCIA 3EZUA 1JI4A 3KHKA 3E2CA 2GYDA 3BT5A 3VV9A 4W4KB 3FRRA 3RE7A 4TODA 2V8TA 4TOEA 3OJ5A 5D8QA 4CMYA 5GU0X 3A9QA 3OGHA 4ZLWA 1YUZA 3PWQA 4ITWA 4LQVA 4IWKA 2JD80 4MY7A 4RC5A 4ERUA 2V2MA 3R2RA 2BJYA 1VLGA 4DE6A 4Y08A 1N1QA 2CN6A 2Y3QA 4IXKA 4XKSA 2FJCA 3IQ1A 1RCGA 2WLAA 4TOHA 3EZ0A 2JD70 2BKCA 4ZKHA 2GYQA 4ITTA 4Z5SA 5FFEA 1RCEA 3DBYA 1EUMA 3PVRB 3KA3A 3QHBA 2CLBA 2VXXA 2W0OA 2YJJA 1JTSA 5LG8A 2X170 4M32A 2AR0A 2Y44A 4WJG4 5I4JA 1VEIA 1FHAA 4TOBA 3WVUA 3FSEA 2FZFA 1F30A 2C2JA 3U90A 1YV1A 4CYAA 4EVBA 3UOFA 2CN7A 3E1MA 2XJOA 4EVDA 3PW8A 3WNWA 4LQJA 1S3QA 3BVFA 1HRSA 1OTKA 1NF6A 1RYTA 1TK6A 2V2OA 4II4B 5GU3X 1SOFA 3NP0X 4CYBA 2G38B 3BVKA 1S30A 5JKLA 2ZA6A 4LYUA 1KRQA 2D5KA 1LB3A 2UX1A 4LYXA 3PVTB 4YKHA 5D8XA 3GGZA 2N02A 3AJOA 3QB9A 2ZG9X 3ES3A 3ISFA 1DATA 3QHCA 1JIGA 2RBDA 5GU1X 3BVIA 4IWJA 4P18A 4RC5B 2Z90A 5HJFA 1TKPA 2OC5A 2CHPA 4DYYA 3JZAB 3JZ9A 4YVZA 5JDOB 3EGMA 1J30A 4DYZA 2V2JA 5D8SA 5HU6D 2V2SA 4ZJKA 4LQNA 3NP2X 5AXSA 3KA6A 1L8IA 3H7GA 3FRSA 1JREA 3UOIA 4TW3A 1ZUJA 1B71A 3R2SA 4X0JA 2XKQA 5J8SA 4M35A 2HTNA 1QGHA 5FFCA 5D8PA 2GS4A 1NFVA 1O9RA 4DASA 4RC6A 1BCFA 3PW1A 5D8YA 3R2LA 4MXPA 4M33A 4PG1A 3AJQA 2V2NA 3F35A 4EVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JD6 0;  4OYN A;  1LKO A;  5J8W A;  3BKN A;  2FHA A;  2IU2 A;  5LBH A;  4ZKX A;  4ZL5 A;  3ISE A;  2FG8 A;  3UNO A;  3IS8 A;  4EVE A;  1BG7 A;  4U3G A;  5GU2 X;  5C6F A;  2Z6M A;  5D8R A;  3E1O A;  2Z5Q A;  3PVY B;  4DI0 A;  1RCC A;  3QZ3 A;  3BVL A;  1AEW A;  5CZU A;  1ZS3 A;  3R2H A;  4PG0 A;  2VXI A;  1NF4 A;  5HJH A;  5FFD A;  1XZ3 A;  4ZL6 A;  3FVB A;  3SHX A;  4XKU A;  4CY9 A;  1S2Z A;  4CVS A;  1F33 A;  3F39 A;  1JKV A;  2CF7 A;  3QD8 A;  2Z5P A;  1JYB A;  2ZA7 A;  2ZG8 X;  3GE4 A;  5ERJ A;  5K52 A;  5GN8 A;  5JKM G;  3Q4Q A;  3SH6 A;  4LPN A;  4LQH A;  2CEI A;  4MN9 A;  2V2R A;  5HQO A;  5IX6 A;  4RC7 A;  3FI6 A;  3NOZ X;  2YW6 A;  3T9J A;  3Q4R A;  3AJP A;  3E1P A;  4ZTT A;  5ERK A;  2CHI A;  3Q4O A;  5J93 A;  5CMQ A;  3PVR A;  3PZA A;  1JKU A;  3AK9 A;  4XGS A;  5D8O A;  3AF8 X;  2QQY A;  1NNQ A;  2ZUR X;  1Z6O A;  3SE1 A;  3RD0 A;  5K53 A;  5JKM A;  4AM4 A;  1Z6O M;  4ZMC A;  2C2U A;  1O9I A;  3F37 A;  2G4H A;  3PWF A;  1SQ3 A;  4MJY A;  1QYB A;  4TOG A;  2WTL A;  4MUD A;  4KVR A;  1IES A;  3GVY A;  4PGK A;  4RC8 A;  2YW7 A;  4QUW A;  2C6R A;  1RCD A;  4DYX A;  3E1Q A;  4II4 A;  2CLU A;  3HL1 A;  3RBC A;  4ETR A;  1VEQ A;  1MOJ A;  1UMN A;  1IER A;  5E2D A;  3PVT A;  4Z3B A;  2V15 A;  2XJN A;  3ERZ A;  2Z5R A;  3F32 A;  3R2O A;  4M34 A;  2VZB A;  4ISM A;  4ISP A;  3GHQ A;  2FL0 A;  2WLU A;  4LPM A;  3KX9 A;  4DYU A;  3E1N A;  3KA8 A;  5GN8 B;  2ZA8 A;  2IY4 A;  3MPS A;  3RAV A;  3SID A;  4ZKW A;  2BW1 A;  5FFB A;  4RC7 B;  2ITB A;  1XZ1 A;  3PW8 C;  3F38 A;  4TOA A;  4E6K A;  2CIH A;  4AM2 A;  4CVT A;  3WVV A;  3E6R A;  2XJM A;  5E1U A;  5J9V A;  1MFR A;  3E6S A;  2F7N A;  5LG2 A;  2C2F A;  3VNX A;  5JKL G;  2ZG7 X;  2C41 A;  3BVE A;  2FFX J;  1YUX A;  1H96 A;  4CMY V;  3A68 A;  4LPJ A;  3IS7 A;  2HR5 A;  1JI5 A;  1TKO A;  2FG4 A;  5LS9 A;  3E1J A;  2V2L A;  1TJO A;  2XGW A;  2FKZ A;  5CMR A;  2V2I A;  4CVR A;  1DVB A;  3TA8 A;  3KA9 A;  4RC6 B;  3PW1 B;  4MKU A;  1VEL A;  1DPS A;  3RGD A;  3AF9 X;  3QVD A;  3F34 A;  2PYB A;  3F36 A;  5FFA A;  3R2M A;  1LKM A;  1R03 A;  2IB0 A;  4REU A;  5FEJ A;  1LKP A;  1Z4A A;  3KWO A;  4TO9 A;  3PVY A;  3F33 A;  5JAC A;  3Q4N A;  3AK8 A;  3O7S A;  3KA4 A;  4TOC A;  4ML5 A;  3HIU A;  1JGC A;  2OH3 A;  3WVW A;  3AF7 X;  1GWG A;  4A25 A;  1VJX A;  1BFR A;  3E1L A;  3O7R A;  4KVS A;  4KVQ A;  4DZ0 A;  4PGI A;  4CVP A;  3R2K A;  3PWQ C;  4TOF A;  1L8H A;  2V2P A;  5GOU A;  4AM5 A;  2QF9 A;  3KXU A;  4R42 A;  4XKT A;  1UVH A;  2BK6 A;  2YJK A;  1RCI A;  3EZU A;  1JI4 A;  3E2C A;  2GYD A;  3BT5 A;  3RE7 A;  4TOD A;  4TOE A;  3OJ5 A;  5D8Q A;  4CMY A;  5GU0 X;  3A9Q A;  3OGH A;  4ZLW A;  1YUZ A;  3PWQ A;  4ITW A;  4LQV A;  4IWK A;  2JD8 0;  4MY7 A;  4RC5 A;  4ERU A;  2V2M A;  3R2R A;  2BJY A;  1VLG A;  4DE6 A;  4Y08 A;  1N1Q A;  2CN6 A;  2Y3Q A;  4IXK A;  4XKS A;  2FJC A;  3IQ1 A;  1RCG A;  2WLA A;  4TOH A;  3EZ0 A;  2JD7 0;  2BKC A;  4ZKH A;  2GYQ A;  4ITT A;  4Z5S A;  5FFE A;  1RCE A;  1EUM A;  3PVR B;  3KA3 A;  3QHB A;  2CLB A;  2VXX A;  2W0O A;  2YJJ A;  1JTS A;  5LG8 A;  2X17 0;  4M32 A;  5I4J A;  1VEI A;  1FHA A;  4TOB A;  3WVU A;  3FSE A;  2FZF A;  1F30 A;  2C2J A;  3U90 A;  1YV1 A;  4CYA A;  4EVB A;  3UOF A;  2CN7 A;  3E1M A;  2XJO A;  4EVD A;  3PW8 A;  3WNW A;  4LQJ A;  1S3Q A;  3BVF A;  1HRS A;  1OTK A;  1NF6 A;  1RYT A;  1TK6 A;  2V2O A;  4II4 B;  5GU3 X;  1SOF A;  3NP0 X;  4CYB A;  3BVK A;  1S30 A;  5JKL A;  2ZA6 A;  4LYU A;  1KRQ A;  2D5K A;  1LB3 A;  2UX1 A;  4LYX A;  3PVT B;  4YKH A;  5D8X A;  3AJO A;  3QB9 A;  2ZG9 X;  3ES3 A;  3ISF A;  1DAT A;  3QHC A;  1JIG A;  2RBD A;  5GU1 X;  3BVI A;  4IWJ A;  4P18 A;  4RC5 B;  2Z90 A;  5HJF A;  1TKP A;  2OC5 A;  2CHP A;  4DYY A;  3EGM A;  1J30 A;  4DYZ A;  2V2J A;  5D8S A;  2V2S A;  4ZJK A;  4LQN A;  3NP2 X;  5AXS A;  3KA6 A;  1L8I A;  3H7G A;  1JRE A;  3UOI A;  4TW3 A;  1ZUJ A;  1B71 A;  3R2S A;  2XKQ A;  5J8S A;  4M35 A;  2HTN A;  1QGH A;  5FFC A;  5D8P A;  2GS4 A;  1NFV A;  1O9R A;  4DAS A;  4RC6 A;  1BCF A;  3PW1 A;  5D8Y A;  3R2L A;  4M33 A;  4PG1 A;  3AJQ A;  2V2N A;  3F35 A;  4EVC A; 
#chains in the Genus database with same CATH topology
 2JD6 0;  4OYN A;  1LKO A;  5J8W A;  3BKN A;  2FHA A;  2IU2 A;  5LBH A;  4ZKX A;  4ZL5 A;  3ISE A;  2FG8 A;  3UNO A;  3IS8 A;  4EVE A;  1BG7 A;  4U3G A;  5GU2 X;  5C6F A;  2Z6M A;  5D8R A;  3E1O A;  2Z5Q A;  3C1Y A;  3PVY B;  4DI0 A;  1RCC A;  3QZ3 A;  3BVL A;  1AEW A;  5CZU A;  1ZS3 A;  3R2H A;  4PG0 A;  2VXI A;  1NF4 A;  5HJH A;  5FFD A;  1XZ3 A;  4ZL6 A;  4YXJ A;  3FVB A;  3SHX A;  4XKU A;  4CY9 A;  1S2Z A;  4CVS A;  1F33 A;  3F39 A;  1JKV A;  3N6O A;  2CF7 A;  3QD8 A;  2Z5P A;  1JYB A;  2ZA7 A;  2ZG8 X;  3D19 A;  3GE4 A;  5ERJ A;  5K52 A;  5GN8 A;  5JKM G;  3Q4Q A;  3SH6 A;  2V8U A;  4LPN A;  3W54 A;  4LQH A;  2CEI A;  4MN9 A;  2V2R A;  5HQO A;  5IX6 A;  4RC7 A;  3FI6 A;  3NOZ X;  3V3K B;  2YW6 A;  3T9J A;  3Q4R A;  3AJP A;  3E1P A;  4ZTT A;  5ERK A;  2CHI A;  3Q4O A;  5J93 A;  5CMQ A;  3PVR A;  3PZA A;  1JKU A;  3AK9 A;  4XGS A;  5D8O A;  3AF8 X;  2QQY A;  1NNQ A;  4YXM A;  2ZUR X;  1Z6O A;  3SE1 A;  3RD0 A;  5K53 A;  5JKM A;  4AM4 A;  4W4L B;  1Z6O M;  4KXR B;  4ZMC A;  3VVA A;  2C2U A;  1O9I A;  3F37 A;  2G4H A;  3PWF A;  1SQ3 A;  4MJY A;  1QYB A;  4TOG A;  2MGY A;  2WTL A;  4MUD A;  4KVR A;  1IES A;  3GVY A;  4PGK A;  3UFB A;  2WWX B;  4RC8 A;  4E40 A;  2YW7 A;  4QUW A;  2C6R A;  1RCD A;  4DYX A;  3LKD A;  3E1Q A;  4II4 A;  2CLU A;  3HL1 A;  3RBC A;  4ETR A;  1VEQ A;  1MOJ A;  1UMN A;  1IER A;  5E2D A;  3PVT A;  4Z3B A;  2V15 A;  2XJN A;  3ERZ A;  3L0M A;  2Z5R A;  3F32 A;  3R2O A;  4M34 A;  2VZB A;  4ISM A;  4ISP A;  3GHQ A;  2FL0 A;  2WLU A;  4LPM A;  3KX9 A;  4DYU A;  3E1N A;  3KA8 A;  5GN8 B;  2ZA8 A;  2IY4 A;  5JDO A;  3MPS A;  3RAV A;  3KDQ A;  3SID A;  4ZKW A;  2BW1 A;  5FFB A;  4RC7 B;  2ITB A;  1XZ1 A;  3PW8 C;  3F38 A;  4TOA A;  4E6K A;  2CIH A;  4AM2 A;  4CVT A;  3WVV A;  3E6R A;  2XJM A;  5E1U A;  5J9V A;  1MFR A;  3E6S A;  2F7N A;  5LG2 A;  2C2F A;  2OKC A;  3VNX A;  5JKL G;  2ZG7 X;  2C41 A;  3BVE A;  2FFX J;  1YUX A;  1H96 A;  4CMY V;  3A68 A;  4LPJ A;  3IS7 A;  2HR5 A;  1JI5 A;  1TKO A;  2FG4 A;  5LS9 A;  3E1J A;  2V2L A;  2CWL A;  1TJO A;  2XGW A;  2FKZ A;  5CMR A;  2V2I A;  4CVR A;  1DVB A;  3TA8 A;  3KA9 A;  4RC6 B;  3PW1 B;  4MKU A;  1VEL A;  1DPS A;  3GGY A;  3RGD A;  3AF9 X;  3QVD A;  3F34 A;  2PYB A;  3F36 A;  5FFA A;  3R2M A;  1LKM A;  1R03 A;  2IB0 A;  4REU A;  5FEJ A;  1LKP A;  3C21 A;  1Z4A A;  3KWO A;  4TO9 A;  3PVY A;  3F33 A;  5JAC A;  3Q4N A;  3AK8 A;  3O7S A;  3KA4 A;  4TOC A;  4ML5 A;  3HIU A;  1JGC A;  2OH3 A;  3WVW A;  3AF7 X;  1GWG A;  3C1Z A;  4A25 A;  1VJX A;  1BFR A;  3E1L A;  3O7R A;  4KVS A;  4KVQ A;  4DZ0 A;  4PGI A;  4CVP A;  3R2K A;  3PWQ C;  4TOF A;  1L8H A;  2V2P A;  3C23 A;  5GOU A;  4AM5 A;  2QF9 A;  3KXU A;  4R42 A;  4XKT A;  1UVH A;  2BK6 A;  3M6J A;  2YJK A;  1RCI A;  3EZU A;  1JI4 A;  3KHK A;  3E2C A;  2GYD A;  3BT5 A;  3VV9 A;  4W4K B;  3FRR A;  3RE7 A;  4TOD A;  2V8T A;  4TOE A;  3OJ5 A;  5D8Q A;  4CMY A;  5GU0 X;  3A9Q A;  3OGH A;  4ZLW A;  1YUZ A;  3PWQ A;  4ITW A;  4LQV A;  4IWK A;  2JD8 0;  4MY7 A;  4RC5 A;  4ERU A;  2V2M A;  3R2R A;  2BJY A;  1VLG A;  4DE6 A;  4Y08 A;  1N1Q A;  2CN6 A;  2Y3Q A;  4IXK A;  4XKS A;  2FJC A;  3IQ1 A;  1RCG A;  2WLA A;  4TOH A;  3EZ0 A;  2JD7 0;  2BKC A;  4ZKH A;  2GYQ A;  4ITT A;  4Z5S A;  5FFE A;  1RCE A;  3DBY A;  1EUM A;  3PVR B;  3KA3 A;  3QHB A;  2CLB A;  2VXX A;  2W0O A;  2YJJ A;  1JTS A;  5LG8 A;  2X17 0;  4M32 A;  2AR0 A;  2Y44 A;  4WJG 4;  5I4J A;  1VEI A;  1FHA A;  4TOB A;  3WVU A;  3FSE A;  2FZF A;  1F30 A;  2C2J A;  3U90 A;  1YV1 A;  4CYA A;  4EVB A;  3UOF A;  2CN7 A;  3E1M A;  2XJO A;  4EVD A;  3PW8 A;  3WNW A;  4LQJ A;  1S3Q A;  3BVF A;  1HRS A;  1OTK A;  1NF6 A;  1RYT A;  1TK6 A;  2V2O A;  4II4 B;  5GU3 X;  1SOF A;  3NP0 X;  4CYB A;  2G38 B;  3BVK A;  1S30 A;  5JKL A;  2ZA6 A;  4LYU A;  1KRQ A;  2D5K A;  1LB3 A;  2UX1 A;  4LYX A;  3PVT B;  4YKH A;  5D8X A;  3GGZ A;  2N02 A;  3AJO A;  3QB9 A;  2ZG9 X;  3ES3 A;  3ISF A;  1DAT A;  3QHC A;  1JIG A;  2RBD A;  5GU1 X;  3BVI A;  4IWJ A;  4P18 A;  4RC5 B;  2Z90 A;  5HJF A;  1TKP A;  2OC5 A;  2CHP A;  4DYY A;  3JZA B;  3JZ9 A;  4YVZ A;  5JDO B;  3EGM A;  1J30 A;  4DYZ A;  2V2J A;  5D8S A;  5HU6 D;  2V2S A;  4ZJK A;  4LQN A;  3NP2 X;  5AXS A;  3KA6 A;  1L8I A;  3H7G A;  3FRS A;  1JRE A;  3UOI A;  4TW3 A;  1ZUJ A;  1B71 A;  3R2S A;  4X0J A;  2XKQ A;  5J8S A;  4M35 A;  2HTN A;  1QGH A;  5FFC A;  5D8P A;  2GS4 A;  1NFV A;  1O9R A;  4DAS A;  4RC6 A;  1BCF A;  3PW1 A;  5D8Y A;  3R2L A;  4MXP A;  4M33 A;  4PG1 A;  3AJQ A;  2V2N A;  3F35 A;  4EVC A; 
#chains in the Genus database with same CATH homology
 2JD6 0;  4OYN A;  1LKO A;  5J8W A;  3BKN A;  2FHA A;  2IU2 A;  5LBH A;  4ZKX A;  4ZL5 A;  3ISE A;  2FG8 A;  3UNO A;  3IS8 A;  4EVE A;  1BG7 A;  4U3G A;  5GU2 X;  5C6F A;  2Z6M A;  5D8R A;  3E1O A;  2Z5Q A;  3C1Y A;  3PVY B;  4DI0 A;  1RCC A;  3QZ3 A;  3BVL A;  1AEW A;  5CZU A;  1ZS3 A;  3R2H A;  4PG0 A;  2VXI A;  1NF4 A;  5HJH A;  5FFD A;  1XZ3 A;  4ZL6 A;  4YXJ A;  3FVB A;  3SHX A;  4XKU A;  4CY9 A;  1S2Z A;  4CVS A;  1F33 A;  3F39 A;  1JKV A;  3N6O A;  2CF7 A;  3QD8 A;  2Z5P A;  1JYB A;  2ZA7 A;  2ZG8 X;  3D19 A;  3GE4 A;  5ERJ A;  5K52 A;  5GN8 A;  5JKM G;  3Q4Q A;  3SH6 A;  2V8U A;  4LPN A;  3W54 A;  4LQH A;  2CEI A;  4MN9 A;  2V2R A;  5HQO A;  5IX6 A;  4RC7 A;  3FI6 A;  3NOZ X;  3V3K B;  2YW6 A;  3T9J A;  3Q4R A;  3AJP A;  3E1P A;  4ZTT A;  5ERK A;  2CHI A;  3Q4O A;  5J93 A;  5CMQ A;  3PVR A;  3PZA A;  1JKU A;  3AK9 A;  4XGS A;  5D8O A;  3AF8 X;  2QQY A;  1NNQ A;  4YXM A;  2ZUR X;  1Z6O A;  3SE1 A;  3RD0 A;  5K53 A;  5JKM A;  4AM4 A;  4W4L B;  1Z6O M;  4KXR B;  4ZMC A;  3VVA A;  2C2U A;  1O9I A;  3F37 A;  2G4H A;  3PWF A;  1SQ3 A;  4MJY A;  1QYB A;  4TOG A;  2MGY A;  2WTL A;  4MUD A;  4KVR A;  1IES A;  3GVY A;  4PGK A;  3UFB A;  2WWX B;  4RC8 A;  4E40 A;  2YW7 A;  4QUW A;  2C6R A;  1RCD A;  4DYX A;  3LKD A;  3E1Q A;  4II4 A;  2CLU A;  3HL1 A;  3RBC A;  4ETR A;  1VEQ A;  1MOJ A;  1UMN A;  1IER A;  5E2D A;  3PVT A;  4Z3B A;  2V15 A;  2XJN A;  3ERZ A;  3L0M A;  2Z5R A;  3F32 A;  3R2O A;  4M34 A;  2VZB A;  4ISM A;  4ISP A;  3GHQ A;  2FL0 A;  2WLU A;  4LPM A;  3KX9 A;  4DYU A;  3E1N A;  3KA8 A;  5GN8 B;  2ZA8 A;  2IY4 A;  5JDO A;  3MPS A;  3RAV A;  3KDQ A;  3SID A;  4ZKW A;  2BW1 A;  5FFB A;  4RC7 B;  2ITB A;  1XZ1 A;  3PW8 C;  3F38 A;  4TOA A;  4E6K A;  2CIH A;  4AM2 A;  4CVT A;  3WVV A;  3E6R A;  2XJM A;  5E1U A;  5J9V A;  1MFR A;  3E6S A;  2F7N A;  5LG2 A;  2C2F A;  2OKC A;  3VNX A;  5JKL G;  2ZG7 X;  2C41 A;  3BVE A;  2FFX J;  1YUX A;  1H96 A;  4CMY V;  3A68 A;  4LPJ A;  3IS7 A;  2HR5 A;  1JI5 A;  1TKO A;  2FG4 A;  5LS9 A;  3E1J A;  2V2L A;  2CWL A;  1TJO A;  2XGW A;  2FKZ A;  5CMR A;  2V2I A;  4CVR A;  1DVB A;  3TA8 A;  3KA9 A;  4RC6 B;  3PW1 B;  4MKU A;  1VEL A;  1DPS A;  3GGY A;  3RGD A;  3AF9 X;  3QVD A;  3F34 A;  2PYB A;  3F36 A;  5FFA A;  3R2M A;  1LKM A;  1R03 A;  2IB0 A;  4REU A;  5FEJ A;  1LKP A;  3C21 A;  1Z4A A;  3KWO A;  4TO9 A;  3PVY A;  3F33 A;  5JAC A;  3Q4N A;  3AK8 A;  3O7S A;  3KA4 A;  4TOC A;  4ML5 A;  3HIU A;  1JGC A;  2OH3 A;  3WVW A;  3AF7 X;  1GWG A;  3C1Z A;  4A25 A;  1VJX A;  1BFR A;  3E1L A;  3O7R A;  4KVS A;  4KVQ A;  4DZ0 A;  4PGI A;  4CVP A;  3R2K A;  3PWQ C;  4TOF A;  1L8H A;  2V2P A;  3C23 A;  5GOU A;  4AM5 A;  2QF9 A;  3KXU A;  4R42 A;  4XKT A;  1UVH A;  2BK6 A;  3M6J A;  2YJK A;  1RCI A;  3EZU A;  1JI4 A;  3KHK A;  3E2C A;  2GYD A;  3BT5 A;  3VV9 A;  4W4K B;  3FRR A;  3RE7 A;  4TOD A;  2V8T A;  4TOE A;  3OJ5 A;  5D8Q A;  4CMY A;  5GU0 X;  3A9Q A;  3OGH A;  4ZLW A;  1YUZ A;  3PWQ A;  4ITW A;  4LQV A;  4IWK A;  2JD8 0;  4MY7 A;  4RC5 A;  4ERU A;  2V2M A;  3R2R A;  2BJY A;  1VLG A;  4DE6 A;  4Y08 A;  1N1Q A;  2CN6 A;  2Y3Q A;  4IXK A;  4XKS A;  2FJC A;  3IQ1 A;  1RCG A;  2WLA A;  4TOH A;  3EZ0 A;  2JD7 0;  2BKC A;  4ZKH A;  2GYQ A;  4ITT A;  4Z5S A;  5FFE A;  1RCE A;  3DBY A;  1EUM A;  3PVR B;  3KA3 A;  3QHB A;  2CLB A;  2VXX A;  2W0O A;  2YJJ A;  1JTS A;  5LG8 A;  2X17 0;  4M32 A;  2AR0 A;  2Y44 A;  4WJG 4;  5I4J A;  1VEI A;  1FHA A;  4TOB A;  3WVU A;  3FSE A;  2FZF A;  1F30 A;  2C2J A;  3U90 A;  1YV1 A;  4CYA A;  4EVB A;  3UOF A;  2CN7 A;  3E1M A;  2XJO A;  4EVD A;  3PW8 A;  3WNW A;  4LQJ A;  1S3Q A;  3BVF A;  1HRS A;  1OTK A;  1NF6 A;  1RYT A;  1TK6 A;  2V2O A;  4II4 B;  5GU3 X;  1SOF A;  3NP0 X;  4CYB A;  2G38 B;  3BVK A;  1S30 A;  5JKL A;  2ZA6 A;  4LYU A;  1KRQ A;  2D5K A;  1LB3 A;  2UX1 A;  4LYX A;  3PVT B;  4YKH A;  5D8X A;  3GGZ A;  2N02 A;  3AJO A;  3QB9 A;  2ZG9 X;  3ES3 A;  3ISF A;  1DAT A;  3QHC A;  1JIG A;  2RBD A;  5GU1 X;  3BVI A;  4IWJ A;  4P18 A;  4RC5 B;  2Z90 A;  5HJF A;  1TKP A;  2OC5 A;  2CHP A;  4DYY A;  3JZA B;  3JZ9 A;  4YVZ A;  5JDO B;  3EGM A;  1J30 A;  4DYZ A;  2V2J A;  5D8S A;  5HU6 D;  2V2S A;  4ZJK A;  4LQN A;  3NP2 X;  5AXS A;  3KA6 A;  1L8I A;  3H7G A;  3FRS A;  1JRE A;  3UOI A;  4TW3 A;  1ZUJ A;  1B71 A;  3R2S A;  4X0J A;  2XKQ A;  5J8S A;  4M35 A;  2HTN A;  1QGH A;  5FFC A;  5D8P A;  2GS4 A;  1NFV A;  1O9R A;  4DAS A;  4RC6 A;  1BCF A;  3PW1 A;  5D8Y A;  3R2L A;  4MXP A;  4M33 A;  4PG1 A;  3AJQ A;  2V2N A;  3F35 A;  4EVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...