3SIDA

Crystal structure of oxidized symerythrin from cyanophora paradoxa, azide adduct at 50% occupancy
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
177
structure length
177
Chain Sequence
NYNQEDFMGLDRFFQDAVSHNNTDANAASSIEVEMYECDCMYPTFAEIARRSGQPEIGAMFDAIAKEEGMHAQLLTKLYSELEVKDSAETLEAKRLVSTIESQIDAVASDSRGLRRALETALEVETIESQKTYPAFAKLAAEQGNMEVATAFEAIVKSETKHANWVKRALENLLEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Symerythrin
publication title Symerythrin structures at atomic resolution and the origins of rubrerythrins and the ferritin-like superfamily.
pubmed doi rcsb
source organism Cyanophora paradoxa
molecule tags Oxidoreductase
total genus 82
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02915 Rubrerythrin Rubrerythrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3sidA00
1TK6A 4MUDA 2Y3QA 2CF7A 1S2ZA 1JI5A 1SQ3A 3RD0A 2IU2A 3EZUA 3BVIA 1RCEA 3PWQA 3H7GA 3EZ0A 2V2MA 3AF9X 5GU2X 2HTNA 2JD60 5K52A 1UVHA 3E1PA 1AEWA 3PVTB 2BK6A 2CLBA 1RCGA 5E2DA 1JYBA 2V2NA 4LQNA 4CMYV 4DYYA 2C2UA 5GU1X 2QQYA 2XJNA 3TA8A 3KA8A 5D8XA 2C6RA 4PGKA 3F36A 3IS7A 3ISFA 3E1QA 1XZ3A 3KA4A 4CY9A 2FG4A 4LQJA 3SE1A 1IERA 3Q4RA 1MFRA 4KVSA 3T9JA 2RBDA 3E2CA 1Z4AA 3RBCA 3OJ5A 2Z5PA 2BW1A 2QF9A 3PW8A 4CYAA 5GN8A 4DZ0A 2FFXJ 4RC7A 4TOAA 5GU0X 3BVEA 4EVBA 4KVQA 4ISPA 3F34A 2C2JA 5FFBA 2V2SA 3R2KA 2GYQA 3PWFA 4DYZA 2OH3A 1SOFA 4II4A 4TOCA 3KA9A 4U3GA 1TKOA 4XKTA 1ZS3A 4QUWA 3F39A 4ZTTA 3EGMA 5JKMA 1LKPA 3WVWA 2CIHA 2CHPA 4RC6A 3SHXA 3PVYB 2XKQA 4TO9A 1L8HA 3E6RA 4Z5SA 4P18A 4ML5A 5J8SA 2JD80 3AJPA 3SIDA 1BFRA 3E1LA 2BJYA 4RC5B 3O7SA 1EUMA 1KRQA 4XKUA 2OC5A 1NF4A 1VEIA 3R2RA 5HQOA 1BCFA 1OTKA 5FEJA 3R2HA 2BKCA 3KX9A 3AF8X 4IWJA 2IY4A 2PYBA 4DASA 3PVRB 4ZKWA 1YV1A 4MKUA 1QYBA 3A9QA 4ZKHA 4M35A 4REUA 1RCDA 5J93A 1S30A 3PW1B 4OYNA 1XZ1A 4DYXA 4Y08A 5AXSA 4PG1A 4ZL6A 5CZUA 1NNQA 4TOGA 1Z6OA 4MY7A 4TODA 3UNOA 3AF7X 4ITTA 3E1OA 3UOFA 3Q4QA 2V2RA 2F7NA 2Z5RA 2FKZA 2W0OA 4M32A 3WVUA 3OGHA 2XJOA 1IESA 3F37A 2VXXA 4Z3BA 5D8YA 3R2OA 1JGCA 5ERKA 1BG7A 5FFDA 4IXKA 3RGDA 4LPJA 3A68A 4LYXA 2C2FA 5CMQA 2ZA8A 4ERUA 2VXIA 3GHQA 2HR5A 4MJYA 1J30A 2FJCA 1NF6A 3IQ1A 5IX6A 3WNWA 5JACA 3AK8A 3QHCA 2CN7A 3NOZX 1S3QA 2ZG9X 1H96A 3UOIA 5J8WA 4CVRA 1DATA 3FSEA 3QZ3A 1GWGA 2IB0A 3E6SA 1R03A 3F32A 3R2MA 2Z6MA 5HJFA 3F35A 4RC7B 4TOHA 3BVLA 5JKMG 3KA6A 5FFAA 3R2SA 1TKPA 3GVYA 2ZA6A 5JKLA 1VELA 3AK9A 4ZJKA 4II4B 3KXUA 2WLUA 3Q4OA 2V15A 4RC5A 4TOEA 5D8QA 2ZG7X 3KA3A 3QVDA 3FVBA 4ZMCA 2D5KA 3QHBA 1FHAA 4RC6B 2ZURX 4LQHA 4YKHA 2GYDA 2YW6A 4M33A 4EVDA 1L8IA 1UMNA 2YJKA 3E1MA 5D8OA 4RC8A 4DI0A 1YUZA 2WLAA 2JD70 1O9RA 3Q4NA 3IS8A 2UX1A 3BKNA 3BT5A 3PVTA 3HL1A 2G4HA 3NP0X 4R42A 3AJOA 3ISEA 2ZG8X 1JTSA 4CVTA 1TJOA 1VEQA 4TOFA 4ETRA 1YUXA 4ZLWA 2XGWA 4ITWA 4ZL5A 4XKSA 4AM2A 3AJQA 1HRSA 5LG8A 2VZBA 5K53A 3BVKA 1JKVA 4TW3A 2Z5QA 1MOJA 1QGHA 4ZKXA 4EVCA 4LPNA 1VJXA 1JI4A 1N1QA 3WVVA 5ERJA 2FZFA 5LBHA 1JKUA 3E1JA 4LYUA 2V2JA 3SH6A 4E6KA 3NP2X 3U90A 1VLGA 5HJHA 2XJMA 1F30A 4DYUA 2ZA7A 3RAVA 3HIUA 4XGSA 5D8PA 4PGIA 4MN9A 4M34A 5J9VA 1Z6OM 2FHAA 3GE4A 2CN6A 2FL0A 2WTLA 1JREA 4PG0A 2V2PA 5GN8B 2V2OA 3VNXA 1LKMA 3ES3A 5D8SA 3PVYA 3PWQC 5LS9A 2FG8A 3E1NA 2CEIA 5I4JA 3QD8A 3MPSA 3RE7A 1O9IA 1RYTA 4A25A 1DVBA 2YW7A 4LPMA 3PZAA 5JKLG 2Z90A 3F38A 4EVEA 5FFCA 5D8RA 2CLUA 2YJJA 5FFEA 1JIGA 4KVRA 5CMRA 2CHIA 2V2IA 1RCIA 3F33A 5GU3X 4LQVA 3QB9A 5C6FA 4AM4A 2GS4A 1LKOA 4AM5A 4CMYA 2X170 1B71A 3FI6A 5GOUA 2ITBA 3O7RA 3PVRA 1RCCA 3KWOA 4IWKA 4CVPA 5LG2A 4TOBA 2C41A 5E1UA 3PW1A 4DE6A 3ERZA 1F33A 4CYBA 1LB3A 1ZUJA 2V2LA 1NFVA 3R2LA 3PW8C 4CVSA 4ISMA 3BVFA 1DPSA
chains in the Genus database with same CATH superfamily
1TK6A 4MUDA 2Y3QA 2CF7A 1S2ZA 1JI5A 1SQ3A 3RD0A 2IU2A 3EZUA 3BVIA 4W4KB 1RCEA 3M6JA 3PWQA 3H7GA 3EZ0A 2V2MA 3AF9X 5GU2X 2HTNA 2JD60 5K52A 1UVHA 3E1PA 1AEWA 3LKDA 3PVTB 2BK6A 2CLBA 1RCGA 5E2DA 3C1ZA 1JYBA 2V2NA 3C1YA 4LQNA 4CMYV 4DYYA 2C2UA 5GU1X 2QQYA 2XJNA 3TA8A 3KA8A 5D8XA 2C6RA 4PGKA 4YXMA 3F36A 3IS7A 3ISFA 3E1QA 1XZ3A 3KA4A 4CY9A 2FG4A 3V3KB 4LQJA 3SE1A 1IERA 4E40A 3Q4RA 1MFRA 4KVSA 3FRRA 3T9JA 3FRSA 2RBDA 3E2CA 1Z4AA 3RBCA 2CWLA 3OJ5A 3JZAB 2Z5PA 2BW1A 2QF9A 3PW8A 4CYAA 5GN8A 4DZ0A 2FFXJ 4RC7A 2V8TA 4TOAA 5GU0X 3BVEA 4EVBA 4KVQA 4ISPA 3F34A 2C2JA 5FFBA 2V2SA 3R2KA 3C23A 2GYQA 3PWFA 4DYZA 2OH3A 1SOFA 4II4A 4TOCA 3KA9A 3KDQA 4U3GA 1TKOA 4XKTA 1ZS3A 4QUWA 3F39A 2N02A 4ZTTA 3EGMA 5JKMA 1LKPA 3WVWA 2CIHA 2CHPA 4RC6A 3SHXA 3D19A 3PVYB 2XKQA 3C21A 4MXPA 4TO9A 1L8HA 3E6RA 4Z5SA 4P18A 4ML5A 5J8SA 2JD80 3AJPA 3SIDA 1BFRA 3E1LA 2BJYA 4RC5B 3O7SA 1EUMA 1KRQA 4XKUA 2OC5A 1NF4A 1VEIA 3R2RA 5HQOA 1BCFA 1OTKA 5FEJA 3R2HA 2BKCA 3KX9A 3AF8X 4IWJA 2IY4A 2PYBA 4W4LB 4DASA 3PVRB 4ZKWA 1YV1A 4MKUA 1QYBA 3A9QA 4ZKHA 4M35A 4REUA 1RCDA 5J93A 1S30A 3PW1B 4OYNA 1XZ1A 4DYXA 4Y08A 5AXSA 4PG1A 4ZL6A 5CZUA 1NNQA 4TOGA 1Z6OA 4MY7A 4TODA 3UNOA 3AF7X 4ITTA 3E1OA 3UOFA 3Q4QA 2V2RA 2F7NA 2Z5RA 2FKZA 2W0OA 4M32A 3WVUA 3OGHA 2XJOA 1IESA 3F37A 2VXXA 4KXRB 4Z3BA 4YVZA 5D8YA 3R2OA 1JGCA 5ERKA 1BG7A 5FFDA 3DBYA 4IXKA 2V8UA 3RGDA 4LPJA 3A68A 4LYXA 2C2FA 5JDOA 5CMQA 2ZA8A 4ERUA 2VXIA 3GHQA 2HR5A 4MJYA 1J30A 2FJCA 1NF6A 3IQ1A 5IX6A 3WNWA 5JACA 3AK8A 3QHCA 2CN7A 3NOZX 1S3QA 2ZG9X 1H96A 3UOIA 5J8WA 4CVRA 1DATA 3FSEA 3QZ3A 1GWGA 3VVAA 2IB0A 2MGYA 3E6SA 1R03A 3F32A 3R2MA 2Z6MA 5HJFA 3F35A 4RC7B 4TOHA 3BVLA 2OKCA 3KA6A 3N6OA 5FFAA 5JKMG 3R2SA 1TKPA 3GVYA 3GGYA 2ZA6A 5JKLA 1VELA 3AK9A 4ZJKA 4II4B 3KXUA 2WLUA 3Q4OA 2V15A 4RC5A 4TOEA 5D8QA 2ZG7X 3KA3A 3QVDA 3FVBA 4ZMCA 2D5KA 3QHBA 1FHAA 4RC6B 2ZURX 4LQHA 4YKHA 3JZ9A 2GYDA 2YW6A 4M33A 4EVDA 1L8IA 1UMNA 2YJKA 3GGZA 3E1MA 5D8OA 4RC8A 4DI0A 1YUZA 2WLAA 2JD70 1O9RA 3Q4NA 3IS8A 2UX1A 2AR0A 3BKNA 3BT5A 3PVTA 3HL1A 2G4HA 3NP0X 4R42A 3KHKA 3AJOA 3ISEA 2ZG8X 1JTSA 4CVTA 1TJOA 1VEQA 4TOFA 4ETRA 1YUXA 4ZLWA 2XGWA 4ITWA 4ZL5A 4XKSA 4AM2A 3AJQA 1HRSA 5LG8A 2VZBA 4YXJA 5K53A 3BVKA 1JKVA 4TW3A 2Z5QA 1MOJA 1QGHA 4ZKXA 4EVCA 4LPNA 1VJXA 3W54A 1JI4A 1N1QA 3WVVA 5ERJA 2FZFA 5LBHA 1JKUA 3E1JA 4LYUA 2V2JA 3SH6A 4E6KA 3NP2X 3U90A 1VLGA 5HJHA 2XJMA 1F30A 4DYUA 2ZA7A 3RAVA 3HIUA 3VV9A 4XGSA 5D8PA 4PGIA 4MN9A 4M34A 5J9VA 1Z6OM 5JDOB 2FHAA 3GE4A 2CN6A 2FL0A 2WTLA 1JREA 4PG0A 2V2PA 5GN8B 2V2OA 3VNXA 1LKMA 3ES3A 5D8SA 3PVYA 3PWQC 5LS9A 2FG8A 3E1NA 2CEIA 2G38B 5I4JA 3QD8A 3MPSA 3RE7A 1O9IA 1RYTA 4A25A 1DVBA 2YW7A 4LPMA 3PZAA 5JKLG 2Z90A 3F38A 4EVEA 5FFCA 5D8RA 4WJG4 2CLUA 2YJJA 5FFEA 1JIGA 4KVRA 5CMRA 3L0MA 2CHIA 4X0JA 2V2IA 1RCIA 3F33A 5GU3X 4LQVA 3QB9A 5C6FA 4AM4A 2GS4A 1LKOA 4AM5A 4CMYA 5HU6D 2X170 1B71A 3FI6A 5GOUA 2ITBA 3O7RA 3PVRA 1RCCA 2Y44A 3KWOA 4IWKA 4CVPA 5LG2A 4TOBA 2C41A 2WWXB 5E1UA 3PW1A 4DE6A 3ERZA 1F33A 4CYBA 1LB3A 1ZUJA 2V2LA 1NFVA 3R2LA 3PW8C 4CVSA 4ISMA 3UFBA 3BVFA 1DPSA
chains in the Genus database with same CATH topology
1TK6A 4MUDA 2Y3QA 2CF7A 1S2ZA 1JI5A 1SQ3A 3RD0A 2IU2A 3EZUA 3BVIA 4W4KB 1RCEA 3M6JA 3PWQA 3H7GA 3EZ0A 2V2MA 3AF9X 5GU2X 2HTNA 2JD60 5K52A 1UVHA 3E1PA 1AEWA 3LKDA 3PVTB 2BK6A 2CLBA 1RCGA 5E2DA 3C1ZA 1JYBA 2V2NA 3C1YA 4LQNA 4CMYV 4DYYA 2C2UA 5GU1X 2QQYA 2XJNA 3TA8A 3KA8A 5D8XA 2C6RA 4PGKA 4YXMA 3F36A 3IS7A 3ISFA 3E1QA 1XZ3A 3KA4A 4CY9A 2FG4A 3V3KB 4LQJA 3SE1A 1IERA 4E40A 3Q4RA 1MFRA 4KVSA 3FRRA 3T9JA 3FRSA 2RBDA 3E2CA 1Z4AA 3RBCA 2CWLA 3OJ5A 3JZAB 2Z5PA 2BW1A 2QF9A 3PW8A 4CYAA 5GN8A 4DZ0A 2FFXJ 4RC7A 2V8TA 4TOAA 5GU0X 3BVEA 4EVBA 4KVQA 4ISPA 3F34A 2C2JA 5FFBA 2V2SA 3R2KA 3C23A 2GYQA 3PWFA 4DYZA 2OH3A 1SOFA 4II4A 4TOCA 3KA9A 3KDQA 4U3GA 1TKOA 4XKTA 1ZS3A 4QUWA 3F39A 2N02A 4ZTTA 3EGMA 5JKMA 1LKPA 3WVWA 2CIHA 2CHPA 4RC6A 3SHXA 3D19A 3PVYB 2XKQA 3C21A 4MXPA 4TO9A 1L8HA 3E6RA 4Z5SA 4P18A 4ML5A 5J8SA 2JD80 3AJPA 3SIDA 1BFRA 3E1LA 2BJYA 4RC5B 3O7SA 1EUMA 1KRQA 4XKUA 2OC5A 1NF4A 1VEIA 3R2RA 5HQOA 1BCFA 1OTKA 5FEJA 3R2HA 2BKCA 3KX9A 3AF8X 4IWJA 2IY4A 2PYBA 4W4LB 4DASA 3PVRB 4ZKWA 1YV1A 4MKUA 1QYBA 3A9QA 4ZKHA 4M35A 4REUA 1RCDA 5J93A 1S30A 3PW1B 4OYNA 1XZ1A 4DYXA 4Y08A 5AXSA 4PG1A 4ZL6A 5CZUA 1NNQA 4TOGA 1Z6OA 4MY7A 4TODA 3UNOA 3AF7X 4ITTA 3E1OA 3UOFA 3Q4QA 2V2RA 2F7NA 2Z5RA 2FKZA 2W0OA 4M32A 3WVUA 3OGHA 2XJOA 1IESA 3F37A 2VXXA 4KXRB 4Z3BA 4YVZA 5D8YA 3R2OA 1JGCA 5ERKA 1BG7A 5FFDA 3DBYA 4IXKA 2V8UA 3RGDA 4LPJA 3A68A 4LYXA 2C2FA 5JDOA 5CMQA 2ZA8A 4ERUA 2VXIA 3GHQA 2HR5A 4MJYA 1J30A 2FJCA 1NF6A 3IQ1A 5IX6A 3WNWA 5JACA 3AK8A 3QHCA 2CN7A 3NOZX 1S3QA 2ZG9X 1H96A 3UOIA 5J8WA 4CVRA 1DATA 3FSEA 3QZ3A 1GWGA 3VVAA 2IB0A 2MGYA 3E6SA 1R03A 3F32A 3R2MA 2Z6MA 5HJFA 3F35A 4RC7B 4TOHA 3BVLA 2OKCA 3KA6A 3N6OA 5FFAA 5JKMG 3R2SA 1TKPA 3GVYA 3GGYA 2ZA6A 5JKLA 1VELA 3AK9A 4ZJKA 4II4B 3KXUA 2WLUA 3Q4OA 2V15A 4RC5A 4TOEA 5D8QA 2ZG7X 3KA3A 3QVDA 3FVBA 4ZMCA 2D5KA 3QHBA 1FHAA 4RC6B 2ZURX 4LQHA 4YKHA 3JZ9A 2GYDA 2YW6A 4M33A 4EVDA 1L8IA 1UMNA 2YJKA 3GGZA 3E1MA 5D8OA 4RC8A 4DI0A 1YUZA 2WLAA 2JD70 1O9RA 3Q4NA 3IS8A 2UX1A 2AR0A 3BKNA 3BT5A 3PVTA 3HL1A 2G4HA 3NP0X 4R42A 3KHKA 3AJOA 3ISEA 2ZG8X 1JTSA 4CVTA 1TJOA 1VEQA 4TOFA 4ETRA 1YUXA 4ZLWA 2XGWA 4ITWA 4ZL5A 4XKSA 4AM2A 3AJQA 1HRSA 5LG8A 2VZBA 4YXJA 5K53A 3BVKA 1JKVA 4TW3A 2Z5QA 1MOJA 1QGHA 4ZKXA 4EVCA 4LPNA 1VJXA 3W54A 1JI4A 1N1QA 3WVVA 5ERJA 2FZFA 5LBHA 1JKUA 3E1JA 4LYUA 2V2JA 3SH6A 4E6KA 3NP2X 3U90A 1VLGA 5HJHA 2XJMA 1F30A 4DYUA 2ZA7A 3RAVA 3HIUA 3VV9A 4XGSA 5D8PA 4PGIA 4MN9A 4M34A 5J9VA 1Z6OM 5JDOB 2FHAA 3GE4A 2CN6A 2FL0A 2WTLA 1JREA 4PG0A 2V2PA 5GN8B 2V2OA 3VNXA 1LKMA 3ES3A 5D8SA 3PVYA 3PWQC 5LS9A 2FG8A 3E1NA 2CEIA 2G38B 5I4JA 3QD8A 3MPSA 3RE7A 1O9IA 1RYTA 4A25A 1DVBA 2YW7A 4LPMA 3PZAA 5JKLG 2Z90A 3F38A 4EVEA 5FFCA 5D8RA 4WJG4 2CLUA 2YJJA 5FFEA 1JIGA 4KVRA 5CMRA 3L0MA 2CHIA 4X0JA 2V2IA 1RCIA 3F33A 5GU3X 4LQVA 3QB9A 5C6FA 4AM4A 2GS4A 1LKOA 4AM5A 4CMYA 5HU6D 2X170 1B71A 3FI6A 5GOUA 2ITBA 3O7RA 3PVRA 1RCCA 2Y44A 3KWOA 4IWKA 4CVPA 5LG2A 4TOBA 2C41A 2WWXB 5E1UA 3PW1A 4DE6A 3ERZA 1F33A 4CYBA 1LB3A 1ZUJA 2V2LA 1NFVA 3R2LA 3PW8C 4CVSA 4ISMA 3UFBA 3BVFA 1DPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TK6 A;  4MUD A;  2Y3Q A;  2CF7 A;  1S2Z A;  1JI5 A;  1SQ3 A;  3RD0 A;  2IU2 A;  3EZU A;  3BVI A;  1RCE A;  3PWQ A;  3H7G A;  3EZ0 A;  2V2M A;  3AF9 X;  5GU2 X;  2HTN A;  2JD6 0;  5K52 A;  1UVH A;  3E1P A;  1AEW A;  3PVT B;  2BK6 A;  2CLB A;  1RCG A;  5E2D A;  1JYB A;  2V2N A;  4LQN A;  4CMY V;  4DYY A;  2C2U A;  5GU1 X;  2QQY A;  2XJN A;  3TA8 A;  3KA8 A;  5D8X A;  2C6R A;  4PGK A;  3F36 A;  3IS7 A;  3ISF A;  3E1Q A;  1XZ3 A;  3KA4 A;  4CY9 A;  2FG4 A;  4LQJ A;  3SE1 A;  1IER A;  3Q4R A;  1MFR A;  4KVS A;  3T9J A;  2RBD A;  3E2C A;  1Z4A A;  3RBC A;  3OJ5 A;  2Z5P A;  2BW1 A;  2QF9 A;  3PW8 A;  4CYA A;  5GN8 A;  4DZ0 A;  2FFX J;  4RC7 A;  4TOA A;  5GU0 X;  3BVE A;  4EVB A;  4KVQ A;  4ISP A;  3F34 A;  2C2J A;  5FFB A;  2V2S A;  3R2K A;  2GYQ A;  3PWF A;  4DYZ A;  2OH3 A;  1SOF A;  4II4 A;  4TOC A;  3KA9 A;  4U3G A;  1TKO A;  4XKT A;  1ZS3 A;  4QUW A;  3F39 A;  4ZTT A;  3EGM A;  5JKM A;  1LKP A;  3WVW A;  2CIH A;  2CHP A;  4RC6 A;  3SHX A;  3PVY B;  2XKQ A;  4TO9 A;  1L8H A;  3E6R A;  4Z5S A;  4P18 A;  4ML5 A;  5J8S A;  2JD8 0;  3AJP A;  3SID A;  1BFR A;  3E1L A;  2BJY A;  4RC5 B;  3O7S A;  1EUM A;  1KRQ A;  4XKU A;  2OC5 A;  1NF4 A;  1VEI A;  3R2R A;  5HQO A;  1BCF A;  1OTK A;  5FEJ A;  3R2H A;  2BKC A;  3KX9 A;  3AF8 X;  4IWJ A;  2IY4 A;  2PYB A;  4DAS A;  3PVR B;  4ZKW A;  1YV1 A;  4MKU A;  1QYB A;  3A9Q A;  4ZKH A;  4M35 A;  4REU A;  1RCD A;  5J93 A;  1S30 A;  3PW1 B;  4OYN A;  1XZ1 A;  4DYX A;  4Y08 A;  5AXS A;  4PG1 A;  4ZL6 A;  5CZU A;  1NNQ A;  4TOG A;  1Z6O A;  4MY7 A;  4TOD A;  3UNO A;  3AF7 X;  4ITT A;  3E1O A;  3UOF A;  3Q4Q A;  2V2R A;  2F7N A;  2Z5R A;  2FKZ A;  2W0O A;  4M32 A;  3WVU A;  3OGH A;  2XJO A;  1IES A;  3F37 A;  2VXX A;  4Z3B A;  5D8Y A;  3R2O A;  1JGC A;  5ERK A;  1BG7 A;  5FFD A;  4IXK A;  3RGD A;  4LPJ A;  3A68 A;  4LYX A;  2C2F A;  5CMQ A;  2ZA8 A;  4ERU A;  2VXI A;  3GHQ A;  2HR5 A;  4MJY A;  1J30 A;  2FJC A;  1NF6 A;  3IQ1 A;  5IX6 A;  3WNW A;  5JAC A;  3AK8 A;  3QHC A;  2CN7 A;  3NOZ X;  1S3Q A;  2ZG9 X;  1H96 A;  3UOI A;  5J8W A;  4CVR A;  1DAT A;  3FSE A;  3QZ3 A;  1GWG A;  2IB0 A;  3E6S A;  1R03 A;  3F32 A;  3R2M A;  2Z6M A;  5HJF A;  3F35 A;  4RC7 B;  4TOH A;  3BVL A;  5JKM G;  3KA6 A;  5FFA A;  3R2S A;  1TKP A;  3GVY A;  2ZA6 A;  5JKL A;  1VEL A;  3AK9 A;  4ZJK A;  4II4 B;  3KXU A;  2WLU A;  3Q4O A;  2V15 A;  4RC5 A;  4TOE A;  5D8Q A;  2ZG7 X;  3KA3 A;  3QVD A;  3FVB A;  4ZMC A;  2D5K A;  3QHB A;  1FHA A;  4RC6 B;  2ZUR X;  4LQH A;  4YKH A;  2GYD A;  2YW6 A;  4M33 A;  4EVD A;  1L8I A;  1UMN A;  2YJK A;  3E1M A;  5D8O A;  4RC8 A;  4DI0 A;  1YUZ A;  2WLA A;  2JD7 0;  1O9R A;  3Q4N A;  3IS8 A;  2UX1 A;  3BKN A;  3BT5 A;  3PVT A;  3HL1 A;  2G4H A;  3NP0 X;  4R42 A;  3AJO A;  3ISE A;  2ZG8 X;  1JTS A;  4CVT A;  1TJO A;  1VEQ A;  4TOF A;  4ETR A;  1YUX A;  4ZLW A;  2XGW A;  4ITW A;  4ZL5 A;  4XKS A;  4AM2 A;  3AJQ A;  1HRS A;  5LG8 A;  2VZB A;  5K53 A;  3BVK A;  1JKV A;  4TW3 A;  2Z5Q A;  1MOJ A;  1QGH A;  4ZKX A;  4EVC A;  4LPN A;  1VJX A;  1JI4 A;  1N1Q A;  3WVV A;  5ERJ A;  2FZF A;  5LBH A;  1JKU A;  3E1J A;  4LYU A;  2V2J A;  3SH6 A;  4E6K A;  3NP2 X;  3U90 A;  1VLG A;  5HJH A;  2XJM A;  1F30 A;  4DYU A;  2ZA7 A;  3RAV A;  3HIU A;  4XGS A;  5D8P A;  4PGI A;  4MN9 A;  4M34 A;  5J9V A;  1Z6O M;  2FHA A;  3GE4 A;  2CN6 A;  2FL0 A;  2WTL A;  1JRE A;  4PG0 A;  2V2P A;  5GN8 B;  2V2O A;  3VNX A;  1LKM A;  3ES3 A;  5D8S A;  3PVY A;  3PWQ C;  5LS9 A;  2FG8 A;  3E1N A;  2CEI A;  5I4J A;  3QD8 A;  3MPS A;  3RE7 A;  1O9I A;  1RYT A;  4A25 A;  1DVB A;  2YW7 A;  4LPM A;  3PZA A;  5JKL G;  2Z90 A;  3F38 A;  4EVE A;  5FFC A;  5D8R A;  2CLU A;  2YJJ A;  5FFE A;  1JIG A;  4KVR A;  5CMR A;  2CHI A;  2V2I A;  1RCI A;  3F33 A;  5GU3 X;  4LQV A;  3QB9 A;  5C6F A;  4AM4 A;  2GS4 A;  1LKO A;  4AM5 A;  4CMY A;  2X17 0;  1B71 A;  3FI6 A;  5GOU A;  2ITB A;  3O7R A;  3PVR A;  1RCC A;  3KWO A;  4IWK A;  4CVP A;  5LG2 A;  4TOB A;  2C41 A;  5E1U A;  3PW1 A;  4DE6 A;  3ERZ A;  1F33 A;  4CYB A;  1LB3 A;  1ZUJ A;  2V2L A;  1NFV A;  3R2L A;  3PW8 C;  4CVS A;  4ISM A;  3BVF A;  1DPS A; 
#chains in the Genus database with same CATH topology
 1TK6 A;  4MUD A;  2Y3Q A;  2CF7 A;  1S2Z A;  1JI5 A;  1SQ3 A;  3RD0 A;  2IU2 A;  3EZU A;  3BVI A;  4W4K B;  1RCE A;  3M6J A;  3PWQ A;  3H7G A;  3EZ0 A;  2V2M A;  3AF9 X;  5GU2 X;  2HTN A;  2JD6 0;  5K52 A;  1UVH A;  3E1P A;  1AEW A;  3LKD A;  3PVT B;  2BK6 A;  2CLB A;  1RCG A;  5E2D A;  3C1Z A;  1JYB A;  2V2N A;  3C1Y A;  4LQN A;  4CMY V;  4DYY A;  2C2U A;  5GU1 X;  2QQY A;  2XJN A;  3TA8 A;  3KA8 A;  5D8X A;  2C6R A;  4PGK A;  4YXM A;  3F36 A;  3IS7 A;  3ISF A;  3E1Q A;  1XZ3 A;  3KA4 A;  4CY9 A;  2FG4 A;  3V3K B;  4LQJ A;  3SE1 A;  1IER A;  4E40 A;  3Q4R A;  1MFR A;  4KVS A;  3FRR A;  3T9J A;  3FRS A;  2RBD A;  3E2C A;  1Z4A A;  3RBC A;  2CWL A;  3OJ5 A;  3JZA B;  2Z5P A;  2BW1 A;  2QF9 A;  3PW8 A;  4CYA A;  5GN8 A;  4DZ0 A;  2FFX J;  4RC7 A;  2V8T A;  4TOA A;  5GU0 X;  3BVE A;  4EVB A;  4KVQ A;  4ISP A;  3F34 A;  2C2J A;  5FFB A;  2V2S A;  3R2K A;  3C23 A;  2GYQ A;  3PWF A;  4DYZ A;  2OH3 A;  1SOF A;  4II4 A;  4TOC A;  3KA9 A;  3KDQ A;  4U3G A;  1TKO A;  4XKT A;  1ZS3 A;  4QUW A;  3F39 A;  2N02 A;  4ZTT A;  3EGM A;  5JKM A;  1LKP A;  3WVW A;  2CIH A;  2CHP A;  4RC6 A;  3SHX A;  3D19 A;  3PVY B;  2XKQ A;  3C21 A;  4MXP A;  4TO9 A;  1L8H A;  3E6R A;  4Z5S A;  4P18 A;  4ML5 A;  5J8S A;  2JD8 0;  3AJP A;  3SID A;  1BFR A;  3E1L A;  2BJY A;  4RC5 B;  3O7S A;  1EUM A;  1KRQ A;  4XKU A;  2OC5 A;  1NF4 A;  1VEI A;  3R2R A;  5HQO A;  1BCF A;  1OTK A;  5FEJ A;  3R2H A;  2BKC A;  3KX9 A;  3AF8 X;  4IWJ A;  2IY4 A;  2PYB A;  4W4L B;  4DAS A;  3PVR B;  4ZKW A;  1YV1 A;  4MKU A;  1QYB A;  3A9Q A;  4ZKH A;  4M35 A;  4REU A;  1RCD A;  5J93 A;  1S30 A;  3PW1 B;  4OYN A;  1XZ1 A;  4DYX A;  4Y08 A;  5AXS A;  4PG1 A;  4ZL6 A;  5CZU A;  1NNQ A;  4TOG A;  1Z6O A;  4MY7 A;  4TOD A;  3UNO A;  3AF7 X;  4ITT A;  3E1O A;  3UOF A;  3Q4Q A;  2V2R A;  2F7N A;  2Z5R A;  2FKZ A;  2W0O A;  4M32 A;  3WVU A;  3OGH A;  2XJO A;  1IES A;  3F37 A;  2VXX A;  4KXR B;  4Z3B A;  4YVZ A;  5D8Y A;  3R2O A;  1JGC A;  5ERK A;  1BG7 A;  5FFD A;  3DBY A;  4IXK A;  2V8U A;  3RGD A;  4LPJ A;  3A68 A;  4LYX A;  2C2F A;  5JDO A;  5CMQ A;  2ZA8 A;  4ERU A;  2VXI A;  3GHQ A;  2HR5 A;  4MJY A;  1J30 A;  2FJC A;  1NF6 A;  3IQ1 A;  5IX6 A;  3WNW A;  5JAC A;  3AK8 A;  3QHC A;  2CN7 A;  3NOZ X;  1S3Q A;  2ZG9 X;  1H96 A;  3UOI A;  5J8W A;  4CVR A;  1DAT A;  3FSE A;  3QZ3 A;  1GWG A;  3VVA A;  2IB0 A;  2MGY A;  3E6S A;  1R03 A;  3F32 A;  3R2M A;  2Z6M A;  5HJF A;  3F35 A;  4RC7 B;  4TOH A;  3BVL A;  2OKC A;  3KA6 A;  3N6O A;  5FFA A;  5JKM G;  3R2S A;  1TKP A;  3GVY A;  3GGY A;  2ZA6 A;  5JKL A;  1VEL A;  3AK9 A;  4ZJK A;  4II4 B;  3KXU A;  2WLU A;  3Q4O A;  2V15 A;  4RC5 A;  4TOE A;  5D8Q A;  2ZG7 X;  3KA3 A;  3QVD A;  3FVB A;  4ZMC A;  2D5K A;  3QHB A;  1FHA A;  4RC6 B;  2ZUR X;  4LQH A;  4YKH A;  3JZ9 A;  2GYD A;  2YW6 A;  4M33 A;  4EVD A;  1L8I A;  1UMN A;  2YJK A;  3GGZ A;  3E1M A;  5D8O A;  4RC8 A;  4DI0 A;  1YUZ A;  2WLA A;  2JD7 0;  1O9R A;  3Q4N A;  3IS8 A;  2UX1 A;  2AR0 A;  3BKN A;  3BT5 A;  3PVT A;  3HL1 A;  2G4H A;  3NP0 X;  4R42 A;  3KHK A;  3AJO A;  3ISE A;  2ZG8 X;  1JTS A;  4CVT A;  1TJO A;  1VEQ A;  4TOF A;  4ETR A;  1YUX A;  4ZLW A;  2XGW A;  4ITW A;  4ZL5 A;  4XKS A;  4AM2 A;  3AJQ A;  1HRS A;  5LG8 A;  2VZB A;  4YXJ A;  5K53 A;  3BVK A;  1JKV A;  4TW3 A;  2Z5Q A;  1MOJ A;  1QGH A;  4ZKX A;  4EVC A;  4LPN A;  1VJX A;  3W54 A;  1JI4 A;  1N1Q A;  3WVV A;  5ERJ A;  2FZF A;  5LBH A;  1JKU A;  3E1J A;  4LYU A;  2V2J A;  3SH6 A;  4E6K A;  3NP2 X;  3U90 A;  1VLG A;  5HJH A;  2XJM A;  1F30 A;  4DYU A;  2ZA7 A;  3RAV A;  3HIU A;  3VV9 A;  4XGS A;  5D8P A;  4PGI A;  4MN9 A;  4M34 A;  5J9V A;  1Z6O M;  5JDO B;  2FHA A;  3GE4 A;  2CN6 A;  2FL0 A;  2WTL A;  1JRE A;  4PG0 A;  2V2P A;  5GN8 B;  2V2O A;  3VNX A;  1LKM A;  3ES3 A;  5D8S A;  3PVY A;  3PWQ C;  5LS9 A;  2FG8 A;  3E1N A;  2CEI A;  2G38 B;  5I4J A;  3QD8 A;  3MPS A;  3RE7 A;  1O9I A;  1RYT A;  4A25 A;  1DVB A;  2YW7 A;  4LPM A;  3PZA A;  5JKL G;  2Z90 A;  3F38 A;  4EVE A;  5FFC A;  5D8R A;  4WJG 4;  2CLU A;  2YJJ A;  5FFE A;  1JIG A;  4KVR A;  5CMR A;  3L0M A;  2CHI A;  4X0J A;  2V2I A;  1RCI A;  3F33 A;  5GU3 X;  4LQV A;  3QB9 A;  5C6F A;  4AM4 A;  2GS4 A;  1LKO A;  4AM5 A;  4CMY A;  5HU6 D;  2X17 0;  1B71 A;  3FI6 A;  5GOU A;  2ITB A;  3O7R A;  3PVR A;  1RCC A;  2Y44 A;  3KWO A;  4IWK A;  4CVP A;  5LG2 A;  4TOB A;  2C41 A;  2WWX B;  5E1U A;  3PW1 A;  4DE6 A;  3ERZ A;  1F33 A;  4CYB A;  1LB3 A;  1ZUJ A;  2V2L A;  1NFV A;  3R2L A;  3PW8 C;  4CVS A;  4ISM A;  3UFB A;  3BVF A;  1DPS A; 
#chains in the Genus database with same CATH homology
 1TK6 A;  4MUD A;  2Y3Q A;  2CF7 A;  1S2Z A;  1JI5 A;  1SQ3 A;  3RD0 A;  2IU2 A;  3EZU A;  3BVI A;  4W4K B;  1RCE A;  3M6J A;  3PWQ A;  3H7G A;  3EZ0 A;  2V2M A;  3AF9 X;  5GU2 X;  2HTN A;  2JD6 0;  5K52 A;  1UVH A;  3E1P A;  1AEW A;  3LKD A;  3PVT B;  2BK6 A;  2CLB A;  1RCG A;  5E2D A;  3C1Z A;  1JYB A;  2V2N A;  3C1Y A;  4LQN A;  4CMY V;  4DYY A;  2C2U A;  5GU1 X;  2QQY A;  2XJN A;  3TA8 A;  3KA8 A;  5D8X A;  2C6R A;  4PGK A;  4YXM A;  3F36 A;  3IS7 A;  3ISF A;  3E1Q A;  1XZ3 A;  3KA4 A;  4CY9 A;  2FG4 A;  3V3K B;  4LQJ A;  3SE1 A;  1IER A;  4E40 A;  3Q4R A;  1MFR A;  4KVS A;  3FRR A;  3T9J A;  3FRS A;  2RBD A;  3E2C A;  1Z4A A;  3RBC A;  2CWL A;  3OJ5 A;  3JZA B;  2Z5P A;  2BW1 A;  2QF9 A;  3PW8 A;  4CYA A;  5GN8 A;  4DZ0 A;  2FFX J;  4RC7 A;  2V8T A;  4TOA A;  5GU0 X;  3BVE A;  4EVB A;  4KVQ A;  4ISP A;  3F34 A;  2C2J A;  5FFB A;  2V2S A;  3R2K A;  3C23 A;  2GYQ A;  3PWF A;  4DYZ A;  2OH3 A;  1SOF A;  4II4 A;  4TOC A;  3KA9 A;  3KDQ A;  4U3G A;  1TKO A;  4XKT A;  1ZS3 A;  4QUW A;  3F39 A;  2N02 A;  4ZTT A;  3EGM A;  5JKM A;  1LKP A;  3WVW A;  2CIH A;  2CHP A;  4RC6 A;  3SHX A;  3D19 A;  3PVY B;  2XKQ A;  3C21 A;  4MXP A;  4TO9 A;  1L8H A;  3E6R A;  4Z5S A;  4P18 A;  4ML5 A;  5J8S A;  2JD8 0;  3AJP A;  3SID A;  1BFR A;  3E1L A;  2BJY A;  4RC5 B;  3O7S A;  1EUM A;  1KRQ A;  4XKU A;  2OC5 A;  1NF4 A;  1VEI A;  3R2R A;  5HQO A;  1BCF A;  1OTK A;  5FEJ A;  3R2H A;  2BKC A;  3KX9 A;  3AF8 X;  4IWJ A;  2IY4 A;  2PYB A;  4W4L B;  4DAS A;  3PVR B;  4ZKW A;  1YV1 A;  4MKU A;  1QYB A;  3A9Q A;  4ZKH A;  4M35 A;  4REU A;  1RCD A;  5J93 A;  1S30 A;  3PW1 B;  4OYN A;  1XZ1 A;  4DYX A;  4Y08 A;  5AXS A;  4PG1 A;  4ZL6 A;  5CZU A;  1NNQ A;  4TOG A;  1Z6O A;  4MY7 A;  4TOD A;  3UNO A;  3AF7 X;  4ITT A;  3E1O A;  3UOF A;  3Q4Q A;  2V2R A;  2F7N A;  2Z5R A;  2FKZ A;  2W0O A;  4M32 A;  3WVU A;  3OGH A;  2XJO A;  1IES A;  3F37 A;  2VXX A;  4KXR B;  4Z3B A;  4YVZ A;  5D8Y A;  3R2O A;  1JGC A;  5ERK A;  1BG7 A;  5FFD A;  3DBY A;  4IXK A;  2V8U A;  3RGD A;  4LPJ A;  3A68 A;  4LYX A;  2C2F A;  5JDO A;  5CMQ A;  2ZA8 A;  4ERU A;  2VXI A;  3GHQ A;  2HR5 A;  4MJY A;  1J30 A;  2FJC A;  1NF6 A;  3IQ1 A;  5IX6 A;  3WNW A;  5JAC A;  3AK8 A;  3QHC A;  2CN7 A;  3NOZ X;  1S3Q A;  2ZG9 X;  1H96 A;  3UOI A;  5J8W A;  4CVR A;  1DAT A;  3FSE A;  3QZ3 A;  1GWG A;  3VVA A;  2IB0 A;  2MGY A;  3E6S A;  1R03 A;  3F32 A;  3R2M A;  2Z6M A;  5HJF A;  3F35 A;  4RC7 B;  4TOH A;  3BVL A;  2OKC A;  3KA6 A;  3N6O A;  5FFA A;  5JKM G;  3R2S A;  1TKP A;  3GVY A;  3GGY A;  2ZA6 A;  5JKL A;  1VEL A;  3AK9 A;  4ZJK A;  4II4 B;  3KXU A;  2WLU A;  3Q4O A;  2V15 A;  4RC5 A;  4TOE A;  5D8Q A;  2ZG7 X;  3KA3 A;  3QVD A;  3FVB A;  4ZMC A;  2D5K A;  3QHB A;  1FHA A;  4RC6 B;  2ZUR X;  4LQH A;  4YKH A;  3JZ9 A;  2GYD A;  2YW6 A;  4M33 A;  4EVD A;  1L8I A;  1UMN A;  2YJK A;  3GGZ A;  3E1M A;  5D8O A;  4RC8 A;  4DI0 A;  1YUZ A;  2WLA A;  2JD7 0;  1O9R A;  3Q4N A;  3IS8 A;  2UX1 A;  2AR0 A;  3BKN A;  3BT5 A;  3PVT A;  3HL1 A;  2G4H A;  3NP0 X;  4R42 A;  3KHK A;  3AJO A;  3ISE A;  2ZG8 X;  1JTS A;  4CVT A;  1TJO A;  1VEQ A;  4TOF A;  4ETR A;  1YUX A;  4ZLW A;  2XGW A;  4ITW A;  4ZL5 A;  4XKS A;  4AM2 A;  3AJQ A;  1HRS A;  5LG8 A;  2VZB A;  4YXJ A;  5K53 A;  3BVK A;  1JKV A;  4TW3 A;  2Z5Q A;  1MOJ A;  1QGH A;  4ZKX A;  4EVC A;  4LPN A;  1VJX A;  3W54 A;  1JI4 A;  1N1Q A;  3WVV A;  5ERJ A;  2FZF A;  5LBH A;  1JKU A;  3E1J A;  4LYU A;  2V2J A;  3SH6 A;  4E6K A;  3NP2 X;  3U90 A;  1VLG A;  5HJH A;  2XJM A;  1F30 A;  4DYU A;  2ZA7 A;  3RAV A;  3HIU A;  3VV9 A;  4XGS A;  5D8P A;  4PGI A;  4MN9 A;  4M34 A;  5J9V A;  1Z6O M;  5JDO B;  2FHA A;  3GE4 A;  2CN6 A;  2FL0 A;  2WTL A;  1JRE A;  4PG0 A;  2V2P A;  5GN8 B;  2V2O A;  3VNX A;  1LKM A;  3ES3 A;  5D8S A;  3PVY A;  3PWQ C;  5LS9 A;  2FG8 A;  3E1N A;  2CEI A;  2G38 B;  5I4J A;  3QD8 A;  3MPS A;  3RE7 A;  1O9I A;  1RYT A;  4A25 A;  1DVB A;  2YW7 A;  4LPM A;  3PZA A;  5JKL G;  2Z90 A;  3F38 A;  4EVE A;  5FFC A;  5D8R A;  4WJG 4;  2CLU A;  2YJJ A;  5FFE A;  1JIG A;  4KVR A;  5CMR A;  3L0M A;  2CHI A;  4X0J A;  2V2I A;  1RCI A;  3F33 A;  5GU3 X;  4LQV A;  3QB9 A;  5C6F A;  4AM4 A;  2GS4 A;  1LKO A;  4AM5 A;  4CMY A;  5HU6 D;  2X17 0;  1B71 A;  3FI6 A;  5GOU A;  2ITB A;  3O7R A;  3PVR A;  1RCC A;  2Y44 A;  3KWO A;  4IWK A;  4CVP A;  5LG2 A;  4TOB A;  2C41 A;  2WWX B;  5E1U A;  3PW1 A;  4DE6 A;  3ERZ A;  1F33 A;  4CYB A;  1LB3 A;  1ZUJ A;  2V2L A;  1NFV A;  3R2L A;  3PW8 C;  4CVS A;  4ISM A;  3UFB A;  3BVF A;  1DPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...