4XKTA

E coli bfr variant y149f
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
157
structure length
157
Chain Sequence
MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDWLETELDLIQKMGLQNFLQAQIREE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterioferritin
publication title Three Aromatic Residues are Required for Electron Transfer during Iron Mineralization in Bacterioferritin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 75
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2015-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4xktA00
3RGDA 4DZ0A 4ETRA 5ERKA 4XKSA 2Z5QA 5JKLG 5CZUA 3KWOA 4XGSA 1NF4A 2QF9A 1DPSA 1F33A 2BW1A 2C2JA 5GN8B 4EVCA 1O9RA 1RCDA 2D5KA 3E6RA 1Z6OA 2V2PA 3VNXA 1IESA 4R42A 3EGMA 2FZFA 2CLBA 1JKUA 4TOBA 1R03A 1YV1A 4PG0A 2JD70 1QGHA 2ZG7X 4II4B 3R2LA 3EZ0A 4CY9A 4M33A 5D8XA 3A9QA 5HJHA 5D8SA 2VXIA 2IB0A 4LPNA 3Q4QA 2GYQA 4TW3A 5FFEA 1TK6A 2IU2A 1IERA 2V2IA 3ISEA 1KRQA 5J93A 4ITTA 1UMNA 1DATA 1B71A 3GHQA 3RE7A 3PW1B 3PVTB 4ITWA 3AF8X 3E1QA 4RC5B 1RCIA 3R2MA 4TOEA 5FEJA 3SHXA 2Z5RA 3F38A 2W0OA 3WNWA 1LB3A 4CVTA 3Q4NA 3F36A 1TKOA 4M35A 4EVDA 1SOFA 4AM2A 3F39A 3F34A 1NNQA 1BFRA 2V2SA 4TODA 4AM4A 1QYBA 2CN7A 3ISFA 2V2JA 3A68A 4QUWA 3NP0X 1YUXA 5CMQA 3IQ1A 1S30A 4CMYA 4DYZA 5ERJA 1VEIA 3ES3A 1OTKA 2ZA8A 2Z90A 3F37A 4RC7A 3Q4RA 3PW1A 3PVTA 3GVYA 2XJMA 3QHCA 4LYUA 5J8SA 4ZLWA 5AXSA 5JKLA 1JIGA 1JI5A 4ML5A 4CYBA 4DYUA 5D8QA 3FVBA 2V2OA 2FKZA 3F35A 2CLUA 2V2LA 4ZKWA 5CMRA 2Z6MA 1S2ZA 2GS4A 2V2NA 4DI0A 1Z6OM 2QQYA 5FFDA 3OJ5A 3HIUA 2FG4A 3UOFA 5FFBA 1FHAA 4M34A 4KVRA 2ZG9X 4TOCA 3FI6A 5GU0X 4PGKA 4P18A 2BJYA 3RBCA 5I4JA 4LQVA 3NP2X 3BVIA 3PW8A 4LQHA 2Z5PA 1O9IA 3F33A 4CVPA 4DASA 3OGHA 4TOFA 1JKVA 2FJCA 3ERZA 3PWQA 3SIDA 1JTSA 1AEWA 2CHPA 5D8YA 3KXUA 3BT5A 4PG1A 4OYNA 3NOZX 5C6FA 1YUZA 2OH3A 3E1LA 5IX6A 1XZ3A 1BG7A 1ZUJA 2G4HA 3MPSA 2V2RA 3O7RA 3R2SA 4RC7B 4CYAA 5E1UA 5E2DA 1JGCA 3QB9A 1MOJA 2WLAA 1VLGA 5JKMG 1S3QA 1TJOA 3T9JA 1VJXA 2HR5A 3AJPA 2WTLA 3F32A 3UOIA 2YJKA 3BKNA 3R2RA 2CIHA 3AK8A 1N1QA 2BKCA 5D8OA 1JI4A 4ERUA 4AM5A 3AJOA 2PYBA 3E1PA 3PVYA 4CVRA 3H7GA 3Q4OA 2YW7A 5K52A 4M32A 3E1JA 2BK6A 2ZA7A 4A25A 5FFCA 1L8HA 5LBHA 2C2UA 4U3GA 2ZA6A 5GU1X 4IXKA 3IS8A 1JYBA 5GOUA 5LS9A 3WVUA 2ZG8X 3IS7A 3EZUA 1NFVA 5FFAA 1J30A 2XGWA 3AJQA 4KVQA 3R2KA 2GYDA 4ZJKA 4MN9A 3E6SA 1XZ1A 1UVHA 4DYYA 2JD80 3KA8A 4TO9A 2CF7A 5D8PA 1H96A 3BVKA 3BVEA 4MKUA 5GU3X 3E1MA 4LQJA 3BVFA 4ZKHA 2XKQA 4CVSA 1JREA 3QHBA 1ZS3A 1TKPA 2RBDA 1DVBA 4Y08A 2YW6A 4MUDA 2FHAA 5D8RA 1LKMA 4Z5SA 4DYXA 4REUA 4ZKXA 1RCGA 4MY7A 2XJOA 3RD0A 3KX9A 2X170 2Y3QA 5HQOA 1RYTA 5JKMA 4RC6A 3PVRA 2FFXJ 2FG8A 2HTNA 4DE6A 1NF6A 3PVYB 4TOHA 3R2HA 4IWKA 4LPMA 3O7SA 2C2FA 5LG2A 5GU2X 1SQ3A 3RAVA 1HRSA 4ISPA 4IWJA 3R2OA 1MFRA 3UNOA 1Z4AA 3PWFA 4Z3BA 3KA4A 2YJJA 3PZAA 4ZL6A 4LPJA 2XJNA 3GE4A 3BVLA 3E1NA 4ISMA 5GN8A 4KVSA 1L8IA 3QD8A 5LG8A 2F7NA 1F30A 3SH6A 1BCFA 2IY4A 3KA3A 1RCEA 1GWGA 3PW8C 4LYXA 4TOAA 5J8WA 4E6KA 4XKTA 2C6RA 3FSEA 1VELA 3E1OA 4II4A 4RC8A 3PWQC 3AK9A 4MJYA 2FL0A 4YKHA 4EVEA 3AF9X 2OC5A 3E2CA 2C41A 5JACA 4EVBA 2VZBA 5J9VA 2CEIA 2V2MA 3HL1A 2CN6A 2ITBA 2WLUA 2ZURX 3SE1A 2JD60 5K53A 1EUMA 4CMYV 4ZTTA 1RCCA 3KA6A 5HJFA 1LKOA 4RC5A 4RC6B 3PVRB 4ZL5A 3WVWA 1LKPA 4TOGA 4LQNA 2CHIA 3KA9A 4ZMCA 2V15A 3WVVA 3QZ3A 3U90A 4XKUA 2VXXA 3AF7X 3QVDA 2UX1A 1VEQA 3TA8A 4PGIA
chains in the Genus database with same CATH superfamily
3RGDA 4DZ0A 4ETRA 5ERKA 4XKSA 2Z5QA 5JKLG 5CZUA 3KWOA 4XGSA 1NF4A 2QF9A 1DPSA 1F33A 2BW1A 2C2JA 5GN8B 4EVCA 5JDOB 1O9RA 1RCDA 2D5KA 3E6RA 1Z6OA 2V2PA 3VNXA 1IESA 4R42A 3KDQA 3EGMA 2FZFA 2CLBA 1JKUA 4TOBA 1R03A 1YV1A 4PG0A 2JD70 1QGHA 2ZG7X 4II4B 3R2LA 3EZ0A 4CY9A 4M33A 5D8XA 3A9QA 5HJHA 5D8SA 2VXIA 2IB0A 4LPNA 3Q4QA 2GYQA 4TW3A 5FFEA 1TK6A 2IU2A 1IERA 2V2IA 3ISEA 1KRQA 5J93A 4ITTA 3C21A 1UMNA 1DATA 1B71A 3GHQA 3RE7A 3PW1B 3PVTB 4ITWA 3AF8X 3E1QA 4RC5B 4YXMA 1RCIA 3DBYA 3R2MA 4TOEA 5FEJA 3SHXA 2Z5RA 3F38A 3VV9A 2W0OA 3WNWA 1LB3A 4CVTA 3Q4NA 3F36A 1TKOA 4M35A 4EVDA 1SOFA 4AM2A 3F39A 3F34A 1NNQA 1BFRA 2V2SA 4TODA 4AM4A 1QYBA 2CN7A 3ISFA 2V2JA 3A68A 4QUWA 3NP0X 1YUXA 5CMQA 3IQ1A 1S30A 4CMYA 4DYZA 5ERJA 1VEIA 3ES3A 1OTKA 3JZAB 2ZA8A 2Y44A 2Z90A 3F37A 4RC7A 3Q4RA 3PW1A 3PVTA 3GVYA 2XJMA 3QHCA 4LYUA 5J8SA 4ZLWA 5AXSA 5JKLA 1JIGA 1JI5A 4ML5A 4CYBA 4DYUA 5D8QA 3FVBA 2V2OA 2FKZA 3F35A 3L0MA 3VVAA 2CLUA 2V2LA 4ZKWA 5CMRA 2Z6MA 1S2ZA 2GS4A 3C1ZA 2V2NA 4DI0A 1Z6OM 2QQYA 5FFDA 3OJ5A 3HIUA 2FG4A 3UOFA 4WJG4 5FFBA 1FHAA 4M34A 4KVRA 2ZG9X 4TOCA 3FI6A 5GU0X 4PGKA 4P18A 2BJYA 3RBCA 5I4JA 3V3KB 4LQVA 3NP2X 3BVIA 3PW8A 4LQHA 2Z5PA 1O9IA 3F33A 4CVPA 4DASA 3OGHA 4TOFA 1JKVA 2FJCA 3ERZA 3PWQA 3SIDA 1JTSA 1AEWA 2CHPA 5D8YA 3KXUA 3BT5A 4PG1A 4OYNA 3NOZX 4X0JA 5C6FA 1YUZA 2OH3A 3E1LA 5IX6A 1XZ3A 1BG7A 1ZUJA 2G4HA 3MPSA 2V2RA 3O7RA 2G38B 3R2SA 4RC7B 4CYAA 3JZ9A 5E1UA 3GGZA 5E2DA 1JGCA 3FRRA 5HU6D 3QB9A 1MOJA 4W4KB 2WLAA 1VLGA 5JKMG 1S3QA 1TJOA 3T9JA 1VJXA 2HR5A 3AJPA 3D19A 2WTLA 3F32A 3UOIA 2WWXB 2YJKA 3BKNA 3R2RA 2CIHA 3AK8A 2V8UA 1N1QA 2AR0A 2BKCA 5D8OA 1JI4A 4ERUA 4AM5A 3AJOA 2PYBA 3E1PA 3PVYA 4CVRA 3H7GA 3Q4OA 2YW7A 5K52A 4M32A 3E1JA 3UFBA 2BK6A 2ZA7A 4A25A 5FFCA 1L8HA 5LBHA 2C2UA 4U3GA 2ZA6A 5GU1X 3GGYA 4IXKA 3IS8A 4MXPA 1JYBA 5GOUA 5LS9A 3WVUA 2ZG8X 3IS7A 3EZUA 1NFVA 5FFAA 1J30A 2XGWA 3AJQA 4KVQA 3R2KA 2GYDA 4ZJKA 4MN9A 3E6SA 1XZ1A 4KXRB 1UVHA 4DYYA 2JD80 3KA8A 4TO9A 2CF7A 5D8PA 1H96A 3BVKA 3BVEA 4MKUA 5GU3X 3E1MA 4LQJA 3BVFA 4ZKHA 2XKQA 2N02A 4CVSA 1JREA 3QHBA 1ZS3A 1TKPA 2RBDA 1DVBA 4Y08A 2YW6A 4MUDA 2FHAA 5D8RA 1LKMA 4Z5SA 4DYXA 4REUA 4ZKXA 1RCGA 4MY7A 2XJOA 3RD0A 3KX9A 3KHKA 2X170 2Y3QA 5HQOA 1RYTA 5JKMA 4RC6A 3PVRA 2FFXJ 2FG8A 2HTNA 4DE6A 1NF6A 3PVYB 4TOHA 3R2HA 4IWKA 4LPMA 3O7SA 2CWLA 2C2FA 5LG2A 5GU2X 1SQ3A 3RAVA 1HRSA 4ISPA 4IWJA 3R2OA 1MFRA 3UNOA 1Z4AA 3PWFA 4Z3BA 3KA4A 2YJJA 4YXJA 3PZAA 4ZL6A 4LPJA 2XJNA 3GE4A 3BVLA 4E40A 3E1NA 4ISMA 5GN8A 4KVSA 1L8IA 3QD8A 5LG8A 2F7NA 1F30A 3SH6A 5JDOA 2OKCA 1BCFA 2IY4A 3KA3A 1RCEA 3FRSA 1GWGA 3PW8C 4LYXA 3C1YA 4TOAA 5J8WA 4E6KA 4XKTA 2C6RA 3FSEA 1VELA 3E1OA 4II4A 4RC8A 3LKDA 3PWQC 3AK9A 4MJYA 2FL0A 4YKHA 4EVEA 3AF9X 4W4LB 2OC5A 3E2CA 2C41A 5JACA 4EVBA 3M6JA 2VZBA 5J9VA 2CEIA 2MGYA 2V2MA 3W54A 4YVZA 3HL1A 2CN6A 2ITBA 2WLUA 2ZURX 3SE1A 2JD60 5K53A 1EUMA 4CMYV 4ZTTA 1RCCA 2V8TA 3C23A 3KA6A 5HJFA 1LKOA 4RC5A 4RC6B 3PVRB 4ZL5A 3WVWA 1LKPA 4TOGA 4LQNA 2CHIA 3KA9A 4ZMCA 2V15A 3WVVA 3QZ3A 3U90A 4XKUA 2VXXA 3AF7X 3N6OA 3QVDA 2UX1A 1VEQA 3TA8A 4PGIA
chains in the Genus database with same CATH topology
3RGDA 4DZ0A 4ETRA 5ERKA 4XKSA 2Z5QA 5JKLG 5CZUA 3KWOA 4XGSA 1NF4A 2QF9A 1DPSA 1F33A 2BW1A 2C2JA 5GN8B 4EVCA 5JDOB 1O9RA 1RCDA 2D5KA 3E6RA 1Z6OA 2V2PA 3VNXA 1IESA 4R42A 3KDQA 3EGMA 2FZFA 2CLBA 1JKUA 4TOBA 1R03A 1YV1A 4PG0A 2JD70 1QGHA 2ZG7X 4II4B 3R2LA 3EZ0A 4CY9A 4M33A 5D8XA 3A9QA 5HJHA 5D8SA 2VXIA 2IB0A 4LPNA 3Q4QA 2GYQA 4TW3A 5FFEA 1TK6A 2IU2A 1IERA 2V2IA 3ISEA 1KRQA 5J93A 4ITTA 3C21A 1UMNA 1DATA 1B71A 3GHQA 3RE7A 3PW1B 3PVTB 4ITWA 3AF8X 3E1QA 4RC5B 4YXMA 1RCIA 3DBYA 3R2MA 4TOEA 5FEJA 3SHXA 2Z5RA 3F38A 3VV9A 2W0OA 3WNWA 1LB3A 4CVTA 3Q4NA 3F36A 1TKOA 4M35A 4EVDA 1SOFA 4AM2A 3F39A 3F34A 1NNQA 1BFRA 2V2SA 4TODA 4AM4A 1QYBA 2CN7A 3ISFA 2V2JA 3A68A 4QUWA 3NP0X 1YUXA 5CMQA 3IQ1A 1S30A 4CMYA 4DYZA 5ERJA 1VEIA 3ES3A 1OTKA 3JZAB 2ZA8A 2Y44A 2Z90A 3F37A 4RC7A 3Q4RA 3PW1A 3PVTA 3GVYA 2XJMA 3QHCA 4LYUA 5J8SA 4ZLWA 5AXSA 5JKLA 1JIGA 1JI5A 4ML5A 4CYBA 4DYUA 5D8QA 3FVBA 2V2OA 2FKZA 3F35A 3L0MA 3VVAA 2CLUA 2V2LA 4ZKWA 5CMRA 2Z6MA 1S2ZA 2GS4A 3C1ZA 2V2NA 4DI0A 1Z6OM 2QQYA 5FFDA 3OJ5A 3HIUA 2FG4A 3UOFA 4WJG4 5FFBA 1FHAA 4M34A 4KVRA 2ZG9X 4TOCA 3FI6A 5GU0X 4PGKA 4P18A 2BJYA 3RBCA 5I4JA 3V3KB 4LQVA 3NP2X 3BVIA 3PW8A 4LQHA 2Z5PA 1O9IA 3F33A 4CVPA 4DASA 3OGHA 4TOFA 1JKVA 2FJCA 3ERZA 3PWQA 3SIDA 1JTSA 1AEWA 2CHPA 5D8YA 3KXUA 3BT5A 4PG1A 4OYNA 3NOZX 4X0JA 5C6FA 1YUZA 2OH3A 3E1LA 5IX6A 1XZ3A 1BG7A 1ZUJA 2G4HA 3MPSA 2V2RA 3O7RA 2G38B 3R2SA 4RC7B 4CYAA 3JZ9A 5E1UA 3GGZA 5E2DA 1JGCA 3FRRA 5HU6D 3QB9A 1MOJA 4W4KB 2WLAA 1VLGA 5JKMG 1S3QA 1TJOA 3T9JA 1VJXA 2HR5A 3AJPA 3D19A 2WTLA 3F32A 3UOIA 2WWXB 2YJKA 3BKNA 3R2RA 2CIHA 3AK8A 2V8UA 1N1QA 2AR0A 2BKCA 5D8OA 1JI4A 4ERUA 4AM5A 3AJOA 2PYBA 3E1PA 3PVYA 4CVRA 3H7GA 3Q4OA 2YW7A 5K52A 4M32A 3E1JA 3UFBA 2BK6A 2ZA7A 4A25A 5FFCA 1L8HA 5LBHA 2C2UA 4U3GA 2ZA6A 5GU1X 3GGYA 4IXKA 3IS8A 4MXPA 1JYBA 5GOUA 5LS9A 3WVUA 2ZG8X 3IS7A 3EZUA 1NFVA 5FFAA 1J30A 2XGWA 3AJQA 4KVQA 3R2KA 2GYDA 4ZJKA 4MN9A 3E6SA 1XZ1A 4KXRB 1UVHA 4DYYA 2JD80 3KA8A 4TO9A 2CF7A 5D8PA 1H96A 3BVKA 3BVEA 4MKUA 5GU3X 3E1MA 4LQJA 3BVFA 4ZKHA 2XKQA 2N02A 4CVSA 1JREA 3QHBA 1ZS3A 1TKPA 2RBDA 1DVBA 4Y08A 2YW6A 4MUDA 2FHAA 5D8RA 1LKMA 4Z5SA 4DYXA 4REUA 4ZKXA 1RCGA 4MY7A 2XJOA 3RD0A 3KX9A 3KHKA 2X170 2Y3QA 5HQOA 1RYTA 5JKMA 4RC6A 3PVRA 2FFXJ 2FG8A 2HTNA 4DE6A 1NF6A 3PVYB 4TOHA 3R2HA 4IWKA 4LPMA 3O7SA 2CWLA 2C2FA 5LG2A 5GU2X 1SQ3A 3RAVA 1HRSA 4ISPA 4IWJA 3R2OA 1MFRA 3UNOA 1Z4AA 3PWFA 4Z3BA 3KA4A 2YJJA 4YXJA 3PZAA 4ZL6A 4LPJA 2XJNA 3GE4A 3BVLA 4E40A 3E1NA 4ISMA 5GN8A 4KVSA 1L8IA 3QD8A 5LG8A 2F7NA 1F30A 3SH6A 5JDOA 2OKCA 1BCFA 2IY4A 3KA3A 1RCEA 3FRSA 1GWGA 3PW8C 4LYXA 3C1YA 4TOAA 5J8WA 4E6KA 4XKTA 2C6RA 3FSEA 1VELA 3E1OA 4II4A 4RC8A 3LKDA 3PWQC 3AK9A 4MJYA 2FL0A 4YKHA 4EVEA 3AF9X 4W4LB 2OC5A 3E2CA 2C41A 5JACA 4EVBA 3M6JA 2VZBA 5J9VA 2CEIA 2MGYA 2V2MA 3W54A 4YVZA 3HL1A 2CN6A 2ITBA 2WLUA 2ZURX 3SE1A 2JD60 5K53A 1EUMA 4CMYV 4ZTTA 1RCCA 2V8TA 3C23A 3KA6A 5HJFA 1LKOA 4RC5A 4RC6B 3PVRB 4ZL5A 3WVWA 1LKPA 4TOGA 4LQNA 2CHIA 3KA9A 4ZMCA 2V15A 3WVVA 3QZ3A 3U90A 4XKUA 2VXXA 3AF7X 3N6OA 3QVDA 2UX1A 1VEQA 3TA8A 4PGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RGD A;  4DZ0 A;  4ETR A;  5ERK A;  4XKS A;  2Z5Q A;  5JKL G;  5CZU A;  3KWO A;  4XGS A;  1NF4 A;  2QF9 A;  1DPS A;  1F33 A;  2BW1 A;  2C2J A;  5GN8 B;  4EVC A;  1O9R A;  1RCD A;  2D5K A;  3E6R A;  1Z6O A;  2V2P A;  3VNX A;  1IES A;  4R42 A;  3EGM A;  2FZF A;  2CLB A;  1JKU A;  4TOB A;  1R03 A;  1YV1 A;  4PG0 A;  2JD7 0;  1QGH A;  2ZG7 X;  4II4 B;  3R2L A;  3EZ0 A;  4CY9 A;  4M33 A;  5D8X A;  3A9Q A;  5HJH A;  5D8S A;  2VXI A;  2IB0 A;  4LPN A;  3Q4Q A;  2GYQ A;  4TW3 A;  5FFE A;  1TK6 A;  2IU2 A;  1IER A;  2V2I A;  3ISE A;  1KRQ A;  5J93 A;  4ITT A;  1UMN A;  1DAT A;  1B71 A;  3GHQ A;  3RE7 A;  3PW1 B;  3PVT B;  4ITW A;  3AF8 X;  3E1Q A;  4RC5 B;  1RCI A;  3R2M A;  4TOE A;  5FEJ A;  3SHX A;  2Z5R A;  3F38 A;  2W0O A;  3WNW A;  1LB3 A;  4CVT A;  3Q4N A;  3F36 A;  1TKO A;  4M35 A;  4EVD A;  1SOF A;  4AM2 A;  3F39 A;  3F34 A;  1NNQ A;  1BFR A;  2V2S A;  4TOD A;  4AM4 A;  1QYB A;  2CN7 A;  3ISF A;  2V2J A;  3A68 A;  4QUW A;  3NP0 X;  1YUX A;  5CMQ A;  3IQ1 A;  1S30 A;  4CMY A;  4DYZ A;  5ERJ A;  1VEI A;  3ES3 A;  1OTK A;  2ZA8 A;  2Z90 A;  3F37 A;  4RC7 A;  3Q4R A;  3PW1 A;  3PVT A;  3GVY A;  2XJM A;  3QHC A;  4LYU A;  5J8S A;  4ZLW A;  5AXS A;  5JKL A;  1JIG A;  1JI5 A;  4ML5 A;  4CYB A;  4DYU A;  5D8Q A;  3FVB A;  2V2O A;  2FKZ A;  3F35 A;  2CLU A;  2V2L A;  4ZKW A;  5CMR A;  2Z6M A;  1S2Z A;  2GS4 A;  2V2N A;  4DI0 A;  1Z6O M;  2QQY A;  5FFD A;  3OJ5 A;  3HIU A;  2FG4 A;  3UOF A;  5FFB A;  1FHA A;  4M34 A;  4KVR A;  2ZG9 X;  4TOC A;  3FI6 A;  5GU0 X;  4PGK A;  4P18 A;  2BJY A;  3RBC A;  5I4J A;  4LQV A;  3NP2 X;  3BVI A;  3PW8 A;  4LQH A;  2Z5P A;  1O9I A;  3F33 A;  4CVP A;  4DAS A;  3OGH A;  4TOF A;  1JKV A;  2FJC A;  3ERZ A;  3PWQ A;  3SID A;  1JTS A;  1AEW A;  2CHP A;  5D8Y A;  3KXU A;  3BT5 A;  4PG1 A;  4OYN A;  3NOZ X;  5C6F A;  1YUZ A;  2OH3 A;  3E1L A;  5IX6 A;  1XZ3 A;  1BG7 A;  1ZUJ A;  2G4H A;  3MPS A;  2V2R A;  3O7R A;  3R2S A;  4RC7 B;  4CYA A;  5E1U A;  5E2D A;  1JGC A;  3QB9 A;  1MOJ A;  2WLA A;  1VLG A;  5JKM G;  1S3Q A;  1TJO A;  3T9J A;  1VJX A;  2HR5 A;  3AJP A;  2WTL A;  3F32 A;  3UOI A;  2YJK A;  3BKN A;  3R2R A;  2CIH A;  3AK8 A;  1N1Q A;  2BKC A;  5D8O A;  1JI4 A;  4ERU A;  4AM5 A;  3AJO A;  2PYB A;  3E1P A;  3PVY A;  4CVR A;  3H7G A;  3Q4O A;  2YW7 A;  5K52 A;  4M32 A;  3E1J A;  2BK6 A;  2ZA7 A;  4A25 A;  5FFC A;  1L8H A;  5LBH A;  2C2U A;  4U3G A;  2ZA6 A;  5GU1 X;  4IXK A;  3IS8 A;  1JYB A;  5GOU A;  5LS9 A;  3WVU A;  2ZG8 X;  3IS7 A;  3EZU A;  1NFV A;  5FFA A;  1J30 A;  2XGW A;  3AJQ A;  4KVQ A;  3R2K A;  2GYD A;  4ZJK A;  4MN9 A;  3E6S A;  1XZ1 A;  1UVH A;  4DYY A;  2JD8 0;  3KA8 A;  4TO9 A;  2CF7 A;  5D8P A;  1H96 A;  3BVK A;  3BVE A;  4MKU A;  5GU3 X;  3E1M A;  4LQJ A;  3BVF A;  4ZKH A;  2XKQ A;  4CVS A;  1JRE A;  3QHB A;  1ZS3 A;  1TKP A;  2RBD A;  1DVB A;  4Y08 A;  2YW6 A;  4MUD A;  2FHA A;  5D8R A;  1LKM A;  4Z5S A;  4DYX A;  4REU A;  4ZKX A;  1RCG A;  4MY7 A;  2XJO A;  3RD0 A;  3KX9 A;  2X17 0;  2Y3Q A;  5HQO A;  1RYT A;  5JKM A;  4RC6 A;  3PVR A;  2FFX J;  2FG8 A;  2HTN A;  4DE6 A;  1NF6 A;  3PVY B;  4TOH A;  3R2H A;  4IWK A;  4LPM A;  3O7S A;  2C2F A;  5LG2 A;  5GU2 X;  1SQ3 A;  3RAV A;  1HRS A;  4ISP A;  4IWJ A;  3R2O A;  1MFR A;  3UNO A;  1Z4A A;  3PWF A;  4Z3B A;  3KA4 A;  2YJJ A;  3PZA A;  4ZL6 A;  4LPJ A;  2XJN A;  3GE4 A;  3BVL A;  3E1N A;  4ISM A;  5GN8 A;  4KVS A;  1L8I A;  3QD8 A;  5LG8 A;  2F7N A;  1F30 A;  3SH6 A;  1BCF A;  2IY4 A;  3KA3 A;  1RCE A;  1GWG A;  3PW8 C;  4LYX A;  4TOA A;  5J8W A;  4E6K A;  4XKT A;  2C6R A;  3FSE A;  1VEL A;  3E1O A;  4II4 A;  4RC8 A;  3PWQ C;  3AK9 A;  4MJY A;  2FL0 A;  4YKH A;  4EVE A;  3AF9 X;  2OC5 A;  3E2C A;  2C41 A;  5JAC A;  4EVB A;  2VZB A;  5J9V A;  2CEI A;  2V2M A;  3HL1 A;  2CN6 A;  2ITB A;  2WLU A;  2ZUR X;  3SE1 A;  2JD6 0;  5K53 A;  1EUM A;  4CMY V;  4ZTT A;  1RCC A;  3KA6 A;  5HJF A;  1LKO A;  4RC5 A;  4RC6 B;  3PVR B;  4ZL5 A;  3WVW A;  1LKP A;  4TOG A;  4LQN A;  2CHI A;  3KA9 A;  4ZMC A;  2V15 A;  3WVV A;  3QZ3 A;  3U90 A;  4XKU A;  2VXX A;  3AF7 X;  3QVD A;  2UX1 A;  1VEQ A;  3TA8 A;  4PGI A; 
#chains in the Genus database with same CATH topology
 3RGD A;  4DZ0 A;  4ETR A;  5ERK A;  4XKS A;  2Z5Q A;  5JKL G;  5CZU A;  3KWO A;  4XGS A;  1NF4 A;  2QF9 A;  1DPS A;  1F33 A;  2BW1 A;  2C2J A;  5GN8 B;  4EVC A;  5JDO B;  1O9R A;  1RCD A;  2D5K A;  3E6R A;  1Z6O A;  2V2P A;  3VNX A;  1IES A;  4R42 A;  3KDQ A;  3EGM A;  2FZF A;  2CLB A;  1JKU A;  4TOB A;  1R03 A;  1YV1 A;  4PG0 A;  2JD7 0;  1QGH A;  2ZG7 X;  4II4 B;  3R2L A;  3EZ0 A;  4CY9 A;  4M33 A;  5D8X A;  3A9Q A;  5HJH A;  5D8S A;  2VXI A;  2IB0 A;  4LPN A;  3Q4Q A;  2GYQ A;  4TW3 A;  5FFE A;  1TK6 A;  2IU2 A;  1IER A;  2V2I A;  3ISE A;  1KRQ A;  5J93 A;  4ITT A;  3C21 A;  1UMN A;  1DAT A;  1B71 A;  3GHQ A;  3RE7 A;  3PW1 B;  3PVT B;  4ITW A;  3AF8 X;  3E1Q A;  4RC5 B;  4YXM A;  1RCI A;  3DBY A;  3R2M A;  4TOE A;  5FEJ A;  3SHX A;  2Z5R A;  3F38 A;  3VV9 A;  2W0O A;  3WNW A;  1LB3 A;  4CVT A;  3Q4N A;  3F36 A;  1TKO A;  4M35 A;  4EVD A;  1SOF A;  4AM2 A;  3F39 A;  3F34 A;  1NNQ A;  1BFR A;  2V2S A;  4TOD A;  4AM4 A;  1QYB A;  2CN7 A;  3ISF A;  2V2J A;  3A68 A;  4QUW A;  3NP0 X;  1YUX A;  5CMQ A;  3IQ1 A;  1S30 A;  4CMY A;  4DYZ A;  5ERJ A;  1VEI A;  3ES3 A;  1OTK A;  3JZA B;  2ZA8 A;  2Y44 A;  2Z90 A;  3F37 A;  4RC7 A;  3Q4R A;  3PW1 A;  3PVT A;  3GVY A;  2XJM A;  3QHC A;  4LYU A;  5J8S A;  4ZLW A;  5AXS A;  5JKL A;  1JIG A;  1JI5 A;  4ML5 A;  4CYB A;  4DYU A;  5D8Q A;  3FVB A;  2V2O A;  2FKZ A;  3F35 A;  3L0M A;  3VVA A;  2CLU A;  2V2L A;  4ZKW A;  5CMR A;  2Z6M A;  1S2Z A;  2GS4 A;  3C1Z A;  2V2N A;  4DI0 A;  1Z6O M;  2QQY A;  5FFD A;  3OJ5 A;  3HIU A;  2FG4 A;  3UOF A;  4WJG 4;  5FFB A;  1FHA A;  4M34 A;  4KVR A;  2ZG9 X;  4TOC A;  3FI6 A;  5GU0 X;  4PGK A;  4P18 A;  2BJY A;  3RBC A;  5I4J A;  3V3K B;  4LQV A;  3NP2 X;  3BVI A;  3PW8 A;  4LQH A;  2Z5P A;  1O9I A;  3F33 A;  4CVP A;  4DAS A;  3OGH A;  4TOF A;  1JKV A;  2FJC A;  3ERZ A;  3PWQ A;  3SID A;  1JTS A;  1AEW A;  2CHP A;  5D8Y A;  3KXU A;  3BT5 A;  4PG1 A;  4OYN A;  3NOZ X;  4X0J A;  5C6F A;  1YUZ A;  2OH3 A;  3E1L A;  5IX6 A;  1XZ3 A;  1BG7 A;  1ZUJ A;  2G4H A;  3MPS A;  2V2R A;  3O7R A;  2G38 B;  3R2S A;  4RC7 B;  4CYA A;  3JZ9 A;  5E1U A;  3GGZ A;  5E2D A;  1JGC A;  3FRR A;  5HU6 D;  3QB9 A;  1MOJ A;  4W4K B;  2WLA A;  1VLG A;  5JKM G;  1S3Q A;  1TJO A;  3T9J A;  1VJX A;  2HR5 A;  3AJP A;  3D19 A;  2WTL A;  3F32 A;  3UOI A;  2WWX B;  2YJK A;  3BKN A;  3R2R A;  2CIH A;  3AK8 A;  2V8U A;  1N1Q A;  2AR0 A;  2BKC A;  5D8O A;  1JI4 A;  4ERU A;  4AM5 A;  3AJO A;  2PYB A;  3E1P A;  3PVY A;  4CVR A;  3H7G A;  3Q4O A;  2YW7 A;  5K52 A;  4M32 A;  3E1J A;  3UFB A;  2BK6 A;  2ZA7 A;  4A25 A;  5FFC A;  1L8H A;  5LBH A;  2C2U A;  4U3G A;  2ZA6 A;  5GU1 X;  3GGY A;  4IXK A;  3IS8 A;  4MXP A;  1JYB A;  5GOU A;  5LS9 A;  3WVU A;  2ZG8 X;  3IS7 A;  3EZU A;  1NFV A;  5FFA A;  1J30 A;  2XGW A;  3AJQ A;  4KVQ A;  3R2K A;  2GYD A;  4ZJK A;  4MN9 A;  3E6S A;  1XZ1 A;  4KXR B;  1UVH A;  4DYY A;  2JD8 0;  3KA8 A;  4TO9 A;  2CF7 A;  5D8P A;  1H96 A;  3BVK A;  3BVE A;  4MKU A;  5GU3 X;  3E1M A;  4LQJ A;  3BVF A;  4ZKH A;  2XKQ A;  2N02 A;  4CVS A;  1JRE A;  3QHB A;  1ZS3 A;  1TKP A;  2RBD A;  1DVB A;  4Y08 A;  2YW6 A;  4MUD A;  2FHA A;  5D8R A;  1LKM A;  4Z5S A;  4DYX A;  4REU A;  4ZKX A;  1RCG A;  4MY7 A;  2XJO A;  3RD0 A;  3KX9 A;  3KHK A;  2X17 0;  2Y3Q A;  5HQO A;  1RYT A;  5JKM A;  4RC6 A;  3PVR A;  2FFX J;  2FG8 A;  2HTN A;  4DE6 A;  1NF6 A;  3PVY B;  4TOH A;  3R2H A;  4IWK A;  4LPM A;  3O7S A;  2CWL A;  2C2F A;  5LG2 A;  5GU2 X;  1SQ3 A;  3RAV A;  1HRS A;  4ISP A;  4IWJ A;  3R2O A;  1MFR A;  3UNO A;  1Z4A A;  3PWF A;  4Z3B A;  3KA4 A;  2YJJ A;  4YXJ A;  3PZA A;  4ZL6 A;  4LPJ A;  2XJN A;  3GE4 A;  3BVL A;  4E40 A;  3E1N A;  4ISM A;  5GN8 A;  4KVS A;  1L8I A;  3QD8 A;  5LG8 A;  2F7N A;  1F30 A;  3SH6 A;  5JDO A;  2OKC A;  1BCF A;  2IY4 A;  3KA3 A;  1RCE A;  3FRS A;  1GWG A;  3PW8 C;  4LYX A;  3C1Y A;  4TOA A;  5J8W A;  4E6K A;  4XKT A;  2C6R A;  3FSE A;  1VEL A;  3E1O A;  4II4 A;  4RC8 A;  3LKD A;  3PWQ C;  3AK9 A;  4MJY A;  2FL0 A;  4YKH A;  4EVE A;  3AF9 X;  4W4L B;  2OC5 A;  3E2C A;  2C41 A;  5JAC A;  4EVB A;  3M6J A;  2VZB A;  5J9V A;  2CEI A;  2MGY A;  2V2M A;  3W54 A;  4YVZ A;  3HL1 A;  2CN6 A;  2ITB A;  2WLU A;  2ZUR X;  3SE1 A;  2JD6 0;  5K53 A;  1EUM A;  4CMY V;  4ZTT A;  1RCC A;  2V8T A;  3C23 A;  3KA6 A;  5HJF A;  1LKO A;  4RC5 A;  4RC6 B;  3PVR B;  4ZL5 A;  3WVW A;  1LKP A;  4TOG A;  4LQN A;  2CHI A;  3KA9 A;  4ZMC A;  2V15 A;  3WVV A;  3QZ3 A;  3U90 A;  4XKU A;  2VXX A;  3AF7 X;  3N6O A;  3QVD A;  2UX1 A;  1VEQ A;  3TA8 A;  4PGI A; 
#chains in the Genus database with same CATH homology
 3RGD A;  4DZ0 A;  4ETR A;  5ERK A;  4XKS A;  2Z5Q A;  5JKL G;  5CZU A;  3KWO A;  4XGS A;  1NF4 A;  2QF9 A;  1DPS A;  1F33 A;  2BW1 A;  2C2J A;  5GN8 B;  4EVC A;  5JDO B;  1O9R A;  1RCD A;  2D5K A;  3E6R A;  1Z6O A;  2V2P A;  3VNX A;  1IES A;  4R42 A;  3KDQ A;  3EGM A;  2FZF A;  2CLB A;  1JKU A;  4TOB A;  1R03 A;  1YV1 A;  4PG0 A;  2JD7 0;  1QGH A;  2ZG7 X;  4II4 B;  3R2L A;  3EZ0 A;  4CY9 A;  4M33 A;  5D8X A;  3A9Q A;  5HJH A;  5D8S A;  2VXI A;  2IB0 A;  4LPN A;  3Q4Q A;  2GYQ A;  4TW3 A;  5FFE A;  1TK6 A;  2IU2 A;  1IER A;  2V2I A;  3ISE A;  1KRQ A;  5J93 A;  4ITT A;  3C21 A;  1UMN A;  1DAT A;  1B71 A;  3GHQ A;  3RE7 A;  3PW1 B;  3PVT B;  4ITW A;  3AF8 X;  3E1Q A;  4RC5 B;  4YXM A;  1RCI A;  3DBY A;  3R2M A;  4TOE A;  5FEJ A;  3SHX A;  2Z5R A;  3F38 A;  3VV9 A;  2W0O A;  3WNW A;  1LB3 A;  4CVT A;  3Q4N A;  3F36 A;  1TKO A;  4M35 A;  4EVD A;  1SOF A;  4AM2 A;  3F39 A;  3F34 A;  1NNQ A;  1BFR A;  2V2S A;  4TOD A;  4AM4 A;  1QYB A;  2CN7 A;  3ISF A;  2V2J A;  3A68 A;  4QUW A;  3NP0 X;  1YUX A;  5CMQ A;  3IQ1 A;  1S30 A;  4CMY A;  4DYZ A;  5ERJ A;  1VEI A;  3ES3 A;  1OTK A;  3JZA B;  2ZA8 A;  2Y44 A;  2Z90 A;  3F37 A;  4RC7 A;  3Q4R A;  3PW1 A;  3PVT A;  3GVY A;  2XJM A;  3QHC A;  4LYU A;  5J8S A;  4ZLW A;  5AXS A;  5JKL A;  1JIG A;  1JI5 A;  4ML5 A;  4CYB A;  4DYU A;  5D8Q A;  3FVB A;  2V2O A;  2FKZ A;  3F35 A;  3L0M A;  3VVA A;  2CLU A;  2V2L A;  4ZKW A;  5CMR A;  2Z6M A;  1S2Z A;  2GS4 A;  3C1Z A;  2V2N A;  4DI0 A;  1Z6O M;  2QQY A;  5FFD A;  3OJ5 A;  3HIU A;  2FG4 A;  3UOF A;  4WJG 4;  5FFB A;  1FHA A;  4M34 A;  4KVR A;  2ZG9 X;  4TOC A;  3FI6 A;  5GU0 X;  4PGK A;  4P18 A;  2BJY A;  3RBC A;  5I4J A;  3V3K B;  4LQV A;  3NP2 X;  3BVI A;  3PW8 A;  4LQH A;  2Z5P A;  1O9I A;  3F33 A;  4CVP A;  4DAS A;  3OGH A;  4TOF A;  1JKV A;  2FJC A;  3ERZ A;  3PWQ A;  3SID A;  1JTS A;  1AEW A;  2CHP A;  5D8Y A;  3KXU A;  3BT5 A;  4PG1 A;  4OYN A;  3NOZ X;  4X0J A;  5C6F A;  1YUZ A;  2OH3 A;  3E1L A;  5IX6 A;  1XZ3 A;  1BG7 A;  1ZUJ A;  2G4H A;  3MPS A;  2V2R A;  3O7R A;  2G38 B;  3R2S A;  4RC7 B;  4CYA A;  3JZ9 A;  5E1U A;  3GGZ A;  5E2D A;  1JGC A;  3FRR A;  5HU6 D;  3QB9 A;  1MOJ A;  4W4K B;  2WLA A;  1VLG A;  5JKM G;  1S3Q A;  1TJO A;  3T9J A;  1VJX A;  2HR5 A;  3AJP A;  3D19 A;  2WTL A;  3F32 A;  3UOI A;  2WWX B;  2YJK A;  3BKN A;  3R2R A;  2CIH A;  3AK8 A;  2V8U A;  1N1Q A;  2AR0 A;  2BKC A;  5D8O A;  1JI4 A;  4ERU A;  4AM5 A;  3AJO A;  2PYB A;  3E1P A;  3PVY A;  4CVR A;  3H7G A;  3Q4O A;  2YW7 A;  5K52 A;  4M32 A;  3E1J A;  3UFB A;  2BK6 A;  2ZA7 A;  4A25 A;  5FFC A;  1L8H A;  5LBH A;  2C2U A;  4U3G A;  2ZA6 A;  5GU1 X;  3GGY A;  4IXK A;  3IS8 A;  4MXP A;  1JYB A;  5GOU A;  5LS9 A;  3WVU A;  2ZG8 X;  3IS7 A;  3EZU A;  1NFV A;  5FFA A;  1J30 A;  2XGW A;  3AJQ A;  4KVQ A;  3R2K A;  2GYD A;  4ZJK A;  4MN9 A;  3E6S A;  1XZ1 A;  4KXR B;  1UVH A;  4DYY A;  2JD8 0;  3KA8 A;  4TO9 A;  2CF7 A;  5D8P A;  1H96 A;  3BVK A;  3BVE A;  4MKU A;  5GU3 X;  3E1M A;  4LQJ A;  3BVF A;  4ZKH A;  2XKQ A;  2N02 A;  4CVS A;  1JRE A;  3QHB A;  1ZS3 A;  1TKP A;  2RBD A;  1DVB A;  4Y08 A;  2YW6 A;  4MUD A;  2FHA A;  5D8R A;  1LKM A;  4Z5S A;  4DYX A;  4REU A;  4ZKX A;  1RCG A;  4MY7 A;  2XJO A;  3RD0 A;  3KX9 A;  3KHK A;  2X17 0;  2Y3Q A;  5HQO A;  1RYT A;  5JKM A;  4RC6 A;  3PVR A;  2FFX J;  2FG8 A;  2HTN A;  4DE6 A;  1NF6 A;  3PVY B;  4TOH A;  3R2H A;  4IWK A;  4LPM A;  3O7S A;  2CWL A;  2C2F A;  5LG2 A;  5GU2 X;  1SQ3 A;  3RAV A;  1HRS A;  4ISP A;  4IWJ A;  3R2O A;  1MFR A;  3UNO A;  1Z4A A;  3PWF A;  4Z3B A;  3KA4 A;  2YJJ A;  4YXJ A;  3PZA A;  4ZL6 A;  4LPJ A;  2XJN A;  3GE4 A;  3BVL A;  4E40 A;  3E1N A;  4ISM A;  5GN8 A;  4KVS A;  1L8I A;  3QD8 A;  5LG8 A;  2F7N A;  1F30 A;  3SH6 A;  5JDO A;  2OKC A;  1BCF A;  2IY4 A;  3KA3 A;  1RCE A;  3FRS A;  1GWG A;  3PW8 C;  4LYX A;  3C1Y A;  4TOA A;  5J8W A;  4E6K A;  4XKT A;  2C6R A;  3FSE A;  1VEL A;  3E1O A;  4II4 A;  4RC8 A;  3LKD A;  3PWQ C;  3AK9 A;  4MJY A;  2FL0 A;  4YKH A;  4EVE A;  3AF9 X;  4W4L B;  2OC5 A;  3E2C A;  2C41 A;  5JAC A;  4EVB A;  3M6J A;  2VZB A;  5J9V A;  2CEI A;  2MGY A;  2V2M A;  3W54 A;  4YVZ A;  3HL1 A;  2CN6 A;  2ITB A;  2WLU A;  2ZUR X;  3SE1 A;  2JD6 0;  5K53 A;  1EUM A;  4CMY V;  4ZTT A;  1RCC A;  2V8T A;  3C23 A;  3KA6 A;  5HJF A;  1LKO A;  4RC5 A;  4RC6 B;  3PVR B;  4ZL5 A;  3WVW A;  1LKP A;  4TOG A;  4LQN A;  2CHI A;  3KA9 A;  4ZMC A;  2V15 A;  3WVV A;  3QZ3 A;  3U90 A;  4XKU A;  2VXX A;  3AF7 X;  3N6O A;  3QVD A;  2UX1 A;  1VEQ A;  3TA8 A;  4PGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...