4XKTA

E coli bfr variant y149f
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
157
structure length
157
Chain Sequence
MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDWLETELDLIQKMGLQNFLQAQIREE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Bacterioferritin
publication title Three Aromatic Residues are Required for Electron Transfer during Iron Mineralization in Bacterioferritin.
pubmed doi rcsb
source organism Escherichia coli
total genus 75
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2015-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4xktA00
2ZA6A 3QVDA 5E1UA 4DYUA 1B71A 2X170 5CMRA 5JKMG 2V2NA 1Z6OA 3NOZX 4PGKA 1O9RA 4MN9A 2V2SA 2JD70 3PWQA 2V2IA 3RAVA 5HQOA 4ZL6A 2FFXJ 2V2LA 3ISEA 1HRSA 1N1QA 3AK9A 3T9JA 3PVRB 3KXUA 4ZTTA 1QYBA 3BVIA 3E2CA 1JIGA 3F35A 3BVKA 2GS4A 2V2PA 1VLGA 2W0OA 2OC5A 2FL0A 2XJNA 4IXKA 1S3QA 1LKPA 3F38A 3PW8A 4QUWA 3NP2X 5J8SA 1TKPA 4ISMA 4P18A 3EZ0A 5GN8A 4ZJKA 5LG2A 3PVTA 3A9QA 3U90A 4RC7A 4DASA 4CVPA 1VEQA 4PG0A 2VZBA 1DPSA 1JKVA 3GHQA 2Y3QA 3E1LA 4EVBA 1RYTA 3VNXA 4Z5SA 3AF8X 3F32A 1L8HA 2CLBA 3MPSA 3E1NA 3AK8A 1RCCA 4ML5A 1SOFA 2FKZA 3AJQA 2CN6A 4IWJA 3OJ5A 5FFDA 3F36A 4TOAA 2D5KA 1IESA 2HR5A 4RC6B 5FFAA 4RC5B 4LPMA 1XZ1A 5D8YA 4ITTA 3A68A 4IWKA 3PW8C 1S30A 2CHIA 3QZ3A 3KA6A 2CIHA 2Z6MA 2BK6A 2WLUA 4ITWA 3IQ1A 3KA3A 3PW1A 3F39A 1LKOA 2CN7A 5JKMA 3BVFA 1YUXA 3NP0X 5CZUA 3E1MA 5J9VA 1UMNA 2GYQA 3OGHA 4CYBA 4TOHA 3QB9A 3SIDA 3F33A 2BKCA 3AJOA 4TW3A 3PVRA 3ISFA 1ZUJA 3ERZA 3O7SA 4MUDA 4XKTA 4II4B 3R2OA 3E1JA 4ETRA 3HIUA 1KRQA 2ZG9X 4CVTA 1GWGA 5GU2X 1TJOA 4LQHA 4TOBA 4MY7A 5LBHA 4LYUA 4KVQA 2YJKA 3WVWA 1RCIA 1RCDA 4DYXA 1NFVA 2CF7A 1H96A 3R2RA 1DVBA 4M33A 1EUMA 3SH6A 4DE6A 3E1OA 3IS7A 4M34A 1F33A 1RCGA 1BG7A 4R42A 1VEIA 2YW7A 3SE1A 4M32A 1FHAA 3WVUA 2YJJA 1J30A 1JGCA 4U3GA 2XGWA 2JD80 4DYYA 5LG8A 3GE4A 4AM4A 1ZS3A 2FHAA 5JKLG 1LB3A 1SQ3A 3QD8A 4XKUA 5GN8B 2F7NA 4EVCA 1BFRA 4LQVA 3FI6A 3O7RA 3PVTB 4AM5A 1MOJA 2IB0A 4CVRA 1MFRA 2BW1A 4Y08A 4TOEA 4OYNA 4RC7B 3Q4NA 1O9IA 5GOUA 4Z3BA 5ERKA 4TODA 1JI5A 1F30A 4CMYV 3F34A 2WLAA 3KX9A 5D8OA 2V2RA 3PVYA 5FEJA 3AF9X 4ZMCA 1AEWA 2CLUA 2V2JA 3RBCA 2ZG8X 1JI4A 4ZKXA 4CY9A 2Z5RA 1NNQA 3R2HA 4TOGA 3GVYA 5E2DA 1BCFA 5IX6A 2CHPA 3QHBA 3TA8A 3UOIA 2C2JA 3RGDA 3FVBA 2G4HA 5JACA 4EVEA 1Z4AA 1UVHA 4LPNA 1RCEA 4RC8A 5HJHA 1VELA 3AF7X 2C41A 3WNWA 3WVVA 1IERA 4PGIA 5D8XA 2PYBA 2BJYA 1TK6A 4ISPA 3BVLA 1YUZA 5D8SA 2V2MA 4LQNA 2UX1A 4E6KA 3R2LA 2CEIA 4KVSA 3KA4A 5FFCA 3PW1B 4LQJA 3E1QA 3BT5A 2Z5QA 1QGHA 1TKOA 4TOCA 3KWOA 1S2ZA 2Z90A 2YW6A 3EZUA 3BVEA 2V15A 2FJCA 2JD60 4XKSA 4AM2A 4ZKWA 4EVDA 3E6RA 1JREA 1JTSA 4ERUA 2ITBA 1XZ3A 3SHXA 4CVSA 2XJMA 4ZKHA 2C2UA 4MJYA 4KVRA 4M35A 3Q4QA 3H7GA 2C2FA 3RD0A 1NF6A 4MKUA 2XJOA 2V2OA 5JKLA 2IU2A 4PG1A 1JKUA 5C6FA 1Z6OM 5K53A 4LPJA 1JYBA 4DYZA 3QHCA 2OH3A 3UOFA 2RBDA 5HJFA 3R2SA 3UNOA 2ZA7A 4ZL5A 5I4JA 5J93A 4TOFA 4ZLWA 5D8RA 1LKMA 3PZAA 1R03A 1L8IA 4DI0A 2ZA8A 4CYAA 4REUA 5GU3X 5LS9A 4YKHA 3IS8A 4RC6A 4RC5A 4TO9A 3R2KA 2VXXA 4XGSA 2WTLA 3KA8A 3PWFA 2GYDA 2IY4A 3PWQC 2XKQA 2FZFA 3FSEA 1VJXA 4LYXA 2QQYA 2VXIA 5J8WA 2FG8A 3RE7A 4A25A 1OTKA 2ZG7X 4DZ0A 5GU0X 2Z5PA 5FFBA 1NF4A 3KA9A 3E1PA 5CMQA 3BKNA 3E6SA 3F37A 2ZURX 3PVYB 3ES3A 3Q4RA 3R2MA 2QF9A 3AJPA 1DATA 2C6RA 5D8QA 3HL1A 5AXSA 1YV1A 5ERJA 5K52A 4CMYA 2FG4A 3Q4OA 5D8PA 2HTNA 4II4A 5FFEA 3EGMA 5GU1X
chains in the Genus database with same CATH superfamily
2ZA6A 3QVDA 5E1UA 4DYUA 3V3KB 1B71A 2X170 5CMRA 5JKMG 2V2NA 1Z6OA 3NOZX 4PGKA 1O9RA 4MN9A 2V2SA 4E40A 2JD70 3PWQA 2V2IA 4W4KB 3RAVA 5HQOA 4ZL6A 2FFXJ 2V2LA 3ISEA 3KDQA 1HRSA 1N1QA 3AK9A 3T9JA 3PVRB 3KXUA 4ZTTA 1QYBA 3BVIA 5HU6D 3E2CA 1JIGA 3F35A 3DBYA 3BVKA 3N6OA 2GS4A 2V2PA 1VLGA 2W0OA 2OC5A 2FL0A 2XJNA 4IXKA 1S3QA 1LKPA 3F38A 3PW8A 4QUWA 3NP2X 5J8SA 1TKPA 4ISMA 4YVZA 4P18A 3EZ0A 5GN8A 4ZJKA 5LG2A 3PVTA 2V8UA 3A9QA 3U90A 4RC7A 4DASA 4CVPA 1VEQA 4PG0A 2VZBA 1DPSA 1JKVA 3GHQA 2Y3QA 3E1LA 4EVBA 1RYTA 3VNXA 4Z5SA 3AF8X 3F32A 1L8HA 2CLBA 3MPSA 3E1NA 3AK8A 1RCCA 4ML5A 1SOFA 2FKZA 3AJQA 4W4LB 2CN6A 4IWJA 3OJ5A 5FFDA 3F36A 4TOAA 2D5KA 1IESA 2HR5A 5JDOB 4RC6B 5FFAA 4X0JA 4RC5B 4LPMA 1XZ1A 5D8YA 4ITTA 3A68A 4IWKA 4YXJA 3PW8C 3FRRA 3C21A 1S30A 2CHIA 3QZ3A 3KA6A 2WWXB 2CIHA 2Z6MA 2BK6A 2WLUA 4ITWA 3IQ1A 3KA3A 3PW1A 2CWLA 2AR0A 3F39A 1LKOA 2CN7A 5JKMA 3BVFA 1YUXA 3NP0X 5CZUA 3E1MA 5J9VA 1UMNA 2GYQA 3OGHA 4CYBA 4TOHA 3C1YA 3QB9A 3SIDA 3F33A 2BKCA 3AJOA 4TW3A 3PVRA 3ISFA 1ZUJA 3ERZA 3O7SA 4MUDA 4XKTA 4II4B 3R2OA 3E1JA 4ETRA 3HIUA 1KRQA 2ZG9X 4CVTA 1GWGA 5GU2X 1TJOA 4LQHA 3JZAB 4TOBA 4WJG4 4MY7A 5LBHA 4LYUA 4KVQA 2YJKA 3WVWA 1RCIA 1RCDA 4DYXA 1NFVA 2CF7A 1H96A 3R2RA 1DVBA 3GGZA 2G38B 4M33A 1EUMA 3SH6A 4DE6A 3E1OA 3IS7A 4M34A 1F33A 2Y44A 1RCGA 1BG7A 4R42A 1VEIA 2YW7A 4YXMA 3SE1A 4M32A 1FHAA 3WVUA 2YJJA 1J30A 1JGCA 4U3GA 2XGWA 2JD80 4DYYA 5LG8A 3GE4A 4AM4A 1ZS3A 2FHAA 5JKLG 1LB3A 1SQ3A 3QD8A 4XKUA 5GN8B 2F7NA 4EVCA 1BFRA 4LQVA 3FI6A 3O7RA 3PVTB 4AM5A 3D19A 3FRSA 1MOJA 3VV9A 2IB0A 4CVRA 1MFRA 2BW1A 4Y08A 4TOEA 4OYNA 4RC7B 3Q4NA 1O9IA 5GOUA 4Z3BA 5ERKA 4TODA 5JDOA 1JI5A 1F30A 4CMYV 3F34A 2WLAA 3KX9A 5D8OA 2V2RA 3PVYA 5FEJA 3AF9X 3C23A 4ZMCA 1AEWA 2CLUA 2V2JA 3RBCA 3JZ9A 2ZG8X 1JI4A 4ZKXA 4CY9A 2Z5RA 1NNQA 3R2HA 4TOGA 3GVYA 5E2DA 1BCFA 5IX6A 2CHPA 3QHBA 3TA8A 2V8TA 3UOIA 2C2JA 3RGDA 3FVBA 2G4HA 5JACA 4EVEA 1Z4AA 1UVHA 4LPNA 1RCEA 4RC8A 5HJHA 1VELA 3AF7X 3KHKA 2C41A 3WNWA 3WVVA 1IERA 4PGIA 5D8XA 2PYBA 2BJYA 1TK6A 4ISPA 3BVLA 1YUZA 5D8SA 2V2MA 4LQNA 2UX1A 4E6KA 3R2LA 2CEIA 4KVSA 3KA4A 5FFCA 3PW1B 4LQJA 3E1QA 3BT5A 2Z5QA 1QGHA 1TKOA 4MXPA 4TOCA 3KWOA 1S2ZA 2Z90A 2YW6A 3EZUA 3BVEA 3L0MA 2V15A 2FJCA 2JD60 4XKSA 4AM2A 4ZKWA 4EVDA 3E6RA 1JREA 1JTSA 4ERUA 2ITBA 1XZ3A 3SHXA 4CVSA 2XJMA 4ZKHA 2C2UA 4MJYA 4KVRA 4M35A 3Q4QA 4KXRB 3H7GA 2C2FA 3RD0A 1NF6A 4MKUA 2XJOA 3LKDA 2V2OA 5JKLA 2IU2A 4PG1A 1JKUA 5C6FA 1Z6OM 3W54A 5K53A 4LPJA 1JYBA 3VVAA 4DYZA 3QHCA 2OH3A 3UOFA 3C1ZA 2RBDA 5HJFA 3R2SA 3UNOA 2ZA7A 4ZL5A 5I4JA 5J93A 4TOFA 4ZLWA 5D8RA 1LKMA 3PZAA 1R03A 1L8IA 4DI0A 2ZA8A 4CYAA 4REUA 5GU3X 5LS9A 4YKHA 3IS8A 4RC6A 4RC5A 4TO9A 3R2KA 2VXXA 4XGSA 2WTLA 3KA8A 3PWFA 2GYDA 2IY4A 3PWQC 2XKQA 2FZFA 3FSEA 1VJXA 4LYXA 2QQYA 2VXIA 5J8WA 2FG8A 3RE7A 4A25A 1OTKA 2ZG7X 4DZ0A 5GU0X 2Z5PA 5FFBA 1NF4A 3KA9A 3E1PA 5CMQA 3BKNA 3E6SA 3F37A 3GGYA 2ZURX 3PVYB 3UFBA 3ES3A 3Q4RA 3R2MA 2QF9A 3AJPA 1DATA 2C6RA 2N02A 5D8QA 2MGYA 3HL1A 5AXSA 1YV1A 5ERJA 5K52A 4CMYA 3M6JA 2OKCA 2FG4A 3Q4OA 5D8PA 2HTNA 4II4A 5FFEA 3EGMA 5GU1X
chains in the Genus database with same CATH topology
2ZA6A 3QVDA 5E1UA 4DYUA 3V3KB 1B71A 2X170 5CMRA 5JKMG 2V2NA 1Z6OA 3NOZX 4PGKA 1O9RA 4MN9A 2V2SA 4E40A 2JD70 3PWQA 2V2IA 4W4KB 3RAVA 5HQOA 4ZL6A 2FFXJ 2V2LA 3ISEA 3KDQA 1HRSA 1N1QA 3AK9A 3T9JA 3PVRB 3KXUA 4ZTTA 1QYBA 3BVIA 5HU6D 3E2CA 1JIGA 3F35A 3DBYA 3BVKA 3N6OA 2GS4A 2V2PA 1VLGA 2W0OA 2OC5A 2FL0A 2XJNA 4IXKA 1S3QA 1LKPA 3F38A 3PW8A 4QUWA 3NP2X 5J8SA 1TKPA 4ISMA 4YVZA 4P18A 3EZ0A 5GN8A 4ZJKA 5LG2A 3PVTA 2V8UA 3A9QA 3U90A 4RC7A 4DASA 4CVPA 1VEQA 4PG0A 2VZBA 1DPSA 1JKVA 3GHQA 2Y3QA 3E1LA 4EVBA 1RYTA 3VNXA 4Z5SA 3AF8X 3F32A 1L8HA 2CLBA 3MPSA 3E1NA 3AK8A 1RCCA 4ML5A 1SOFA 2FKZA 3AJQA 4W4LB 2CN6A 4IWJA 3OJ5A 5FFDA 3F36A 4TOAA 2D5KA 1IESA 2HR5A 5JDOB 4RC6B 5FFAA 4X0JA 4RC5B 4LPMA 1XZ1A 5D8YA 4ITTA 3A68A 4IWKA 4YXJA 3PW8C 3FRRA 3C21A 1S30A 2CHIA 3QZ3A 3KA6A 2WWXB 2CIHA 2Z6MA 2BK6A 2WLUA 4ITWA 3IQ1A 3KA3A 3PW1A 2CWLA 2AR0A 3F39A 1LKOA 2CN7A 5JKMA 3BVFA 1YUXA 3NP0X 5CZUA 3E1MA 5J9VA 1UMNA 2GYQA 3OGHA 4CYBA 4TOHA 3C1YA 3QB9A 3SIDA 3F33A 2BKCA 3AJOA 4TW3A 3PVRA 3ISFA 1ZUJA 3ERZA 3O7SA 4MUDA 4XKTA 4II4B 3R2OA 3E1JA 4ETRA 3HIUA 1KRQA 2ZG9X 4CVTA 1GWGA 5GU2X 1TJOA 4LQHA 3JZAB 4TOBA 4WJG4 4MY7A 5LBHA 4LYUA 4KVQA 2YJKA 3WVWA 1RCIA 1RCDA 4DYXA 1NFVA 2CF7A 1H96A 3R2RA 1DVBA 3GGZA 2G38B 4M33A 1EUMA 3SH6A 4DE6A 3E1OA 3IS7A 4M34A 1F33A 2Y44A 1RCGA 1BG7A 4R42A 1VEIA 2YW7A 4YXMA 3SE1A 4M32A 1FHAA 3WVUA 2YJJA 1J30A 1JGCA 4U3GA 2XGWA 2JD80 4DYYA 5LG8A 3GE4A 4AM4A 1ZS3A 2FHAA 5JKLG 1LB3A 1SQ3A 3QD8A 4XKUA 5GN8B 2F7NA 4EVCA 1BFRA 4LQVA 3FI6A 3O7RA 3PVTB 4AM5A 3D19A 3FRSA 1MOJA 3VV9A 2IB0A 4CVRA 1MFRA 2BW1A 4Y08A 4TOEA 4OYNA 4RC7B 3Q4NA 1O9IA 5GOUA 4Z3BA 5ERKA 4TODA 5JDOA 1JI5A 1F30A 4CMYV 3F34A 2WLAA 3KX9A 5D8OA 2V2RA 3PVYA 5FEJA 3AF9X 3C23A 4ZMCA 1AEWA 2CLUA 2V2JA 3RBCA 3JZ9A 2ZG8X 1JI4A 4ZKXA 4CY9A 2Z5RA 1NNQA 3R2HA 4TOGA 3GVYA 5E2DA 1BCFA 5IX6A 2CHPA 3QHBA 3TA8A 2V8TA 3UOIA 2C2JA 3RGDA 3FVBA 2G4HA 5JACA 4EVEA 1Z4AA 1UVHA 4LPNA 1RCEA 4RC8A 5HJHA 1VELA 3AF7X 3KHKA 2C41A 3WNWA 3WVVA 1IERA 4PGIA 5D8XA 2PYBA 2BJYA 1TK6A 4ISPA 3BVLA 1YUZA 5D8SA 2V2MA 4LQNA 2UX1A 4E6KA 3R2LA 2CEIA 4KVSA 3KA4A 5FFCA 3PW1B 4LQJA 3E1QA 3BT5A 2Z5QA 1QGHA 1TKOA 4MXPA 4TOCA 3KWOA 1S2ZA 2Z90A 2YW6A 3EZUA 3BVEA 3L0MA 2V15A 2FJCA 2JD60 4XKSA 4AM2A 4ZKWA 4EVDA 3E6RA 1JREA 1JTSA 4ERUA 2ITBA 1XZ3A 3SHXA 4CVSA 2XJMA 4ZKHA 2C2UA 4MJYA 4KVRA 4M35A 3Q4QA 4KXRB 3H7GA 2C2FA 3RD0A 1NF6A 4MKUA 2XJOA 3LKDA 2V2OA 5JKLA 2IU2A 4PG1A 1JKUA 5C6FA 1Z6OM 3W54A 5K53A 4LPJA 1JYBA 3VVAA 4DYZA 3QHCA 2OH3A 3UOFA 3C1ZA 2RBDA 5HJFA 3R2SA 3UNOA 2ZA7A 4ZL5A 5I4JA 5J93A 4TOFA 4ZLWA 5D8RA 1LKMA 3PZAA 1R03A 1L8IA 4DI0A 2ZA8A 4CYAA 4REUA 5GU3X 5LS9A 4YKHA 3IS8A 4RC6A 4RC5A 4TO9A 3R2KA 2VXXA 4XGSA 2WTLA 3KA8A 3PWFA 2GYDA 2IY4A 3PWQC 2XKQA 2FZFA 3FSEA 1VJXA 4LYXA 2QQYA 2VXIA 5J8WA 2FG8A 3RE7A 4A25A 1OTKA 2ZG7X 4DZ0A 5GU0X 2Z5PA 5FFBA 1NF4A 3KA9A 3E1PA 5CMQA 3BKNA 3E6SA 3F37A 3GGYA 2ZURX 3PVYB 3UFBA 3ES3A 3Q4RA 3R2MA 2QF9A 3AJPA 1DATA 2C6RA 2N02A 5D8QA 2MGYA 3HL1A 5AXSA 1YV1A 5ERJA 5K52A 4CMYA 3M6JA 2OKCA 2FG4A 3Q4OA 5D8PA 2HTNA 4II4A 5FFEA 3EGMA 5GU1X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZA6 A;  3QVD A;  5E1U A;  4DYU A;  1B71 A;  2X17 0;  5CMR A;  5JKM G;  2V2N A;  1Z6O A;  3NOZ X;  4PGK A;  1O9R A;  4MN9 A;  2V2S A;  2JD7 0;  3PWQ A;  2V2I A;  3RAV A;  5HQO A;  4ZL6 A;  2FFX J;  2V2L A;  3ISE A;  1HRS A;  1N1Q A;  3AK9 A;  3T9J A;  3PVR B;  3KXU A;  4ZTT A;  1QYB A;  3BVI A;  3E2C A;  1JIG A;  3F35 A;  3BVK A;  2GS4 A;  2V2P A;  1VLG A;  2W0O A;  2OC5 A;  2FL0 A;  2XJN A;  4IXK A;  1S3Q A;  1LKP A;  3F38 A;  3PW8 A;  4QUW A;  3NP2 X;  5J8S A;  1TKP A;  4ISM A;  4P18 A;  3EZ0 A;  5GN8 A;  4ZJK A;  5LG2 A;  3PVT A;  3A9Q A;  3U90 A;  4RC7 A;  4DAS A;  4CVP A;  1VEQ A;  4PG0 A;  2VZB A;  1DPS A;  1JKV A;  3GHQ A;  2Y3Q A;  3E1L A;  4EVB A;  1RYT A;  3VNX A;  4Z5S A;  3AF8 X;  3F32 A;  1L8H A;  2CLB A;  3MPS A;  3E1N A;  3AK8 A;  1RCC A;  4ML5 A;  1SOF A;  2FKZ A;  3AJQ A;  2CN6 A;  4IWJ A;  3OJ5 A;  5FFD A;  3F36 A;  4TOA A;  2D5K A;  1IES A;  2HR5 A;  4RC6 B;  5FFA A;  4RC5 B;  4LPM A;  1XZ1 A;  5D8Y A;  4ITT A;  3A68 A;  4IWK A;  3PW8 C;  1S30 A;  2CHI A;  3QZ3 A;  3KA6 A;  2CIH A;  2Z6M A;  2BK6 A;  2WLU A;  4ITW A;  3IQ1 A;  3KA3 A;  3PW1 A;  3F39 A;  1LKO A;  2CN7 A;  5JKM A;  3BVF A;  1YUX A;  3NP0 X;  5CZU A;  3E1M A;  5J9V A;  1UMN A;  2GYQ A;  3OGH A;  4CYB A;  4TOH A;  3QB9 A;  3SID A;  3F33 A;  2BKC A;  3AJO A;  4TW3 A;  3PVR A;  3ISF A;  1ZUJ A;  3ERZ A;  3O7S A;  4MUD A;  4XKT A;  4II4 B;  3R2O A;  3E1J A;  4ETR A;  3HIU A;  1KRQ A;  2ZG9 X;  4CVT A;  1GWG A;  5GU2 X;  1TJO A;  4LQH A;  4TOB A;  4MY7 A;  5LBH A;  4LYU A;  4KVQ A;  2YJK A;  3WVW A;  1RCI A;  1RCD A;  4DYX A;  1NFV A;  2CF7 A;  1H96 A;  3R2R A;  1DVB A;  4M33 A;  1EUM A;  3SH6 A;  4DE6 A;  3E1O A;  3IS7 A;  4M34 A;  1F33 A;  1RCG A;  1BG7 A;  4R42 A;  1VEI A;  2YW7 A;  3SE1 A;  4M32 A;  1FHA A;  3WVU A;  2YJJ A;  1J30 A;  1JGC A;  4U3G A;  2XGW A;  2JD8 0;  4DYY A;  5LG8 A;  3GE4 A;  4AM4 A;  1ZS3 A;  2FHA A;  5JKL G;  1LB3 A;  1SQ3 A;  3QD8 A;  4XKU A;  5GN8 B;  2F7N A;  4EVC A;  1BFR A;  4LQV A;  3FI6 A;  3O7R A;  3PVT B;  4AM5 A;  1MOJ A;  2IB0 A;  4CVR A;  1MFR A;  2BW1 A;  4Y08 A;  4TOE A;  4OYN A;  4RC7 B;  3Q4N A;  1O9I A;  5GOU A;  4Z3B A;  5ERK A;  4TOD A;  1JI5 A;  1F30 A;  4CMY V;  3F34 A;  2WLA A;  3KX9 A;  5D8O A;  2V2R A;  3PVY A;  5FEJ A;  3AF9 X;  4ZMC A;  1AEW A;  2CLU A;  2V2J A;  3RBC A;  2ZG8 X;  1JI4 A;  4ZKX A;  4CY9 A;  2Z5R A;  1NNQ A;  3R2H A;  4TOG A;  3GVY A;  5E2D A;  1BCF A;  5IX6 A;  2CHP A;  3QHB A;  3TA8 A;  3UOI A;  2C2J A;  3RGD A;  3FVB A;  2G4H A;  5JAC A;  4EVE A;  1Z4A A;  1UVH A;  4LPN A;  1RCE A;  4RC8 A;  5HJH A;  1VEL A;  3AF7 X;  2C41 A;  3WNW A;  3WVV A;  1IER A;  4PGI A;  5D8X A;  2PYB A;  2BJY A;  1TK6 A;  4ISP A;  3BVL A;  1YUZ A;  5D8S A;  2V2M A;  4LQN A;  2UX1 A;  4E6K A;  3R2L A;  2CEI A;  4KVS A;  3KA4 A;  5FFC A;  3PW1 B;  4LQJ A;  3E1Q A;  3BT5 A;  2Z5Q A;  1QGH A;  1TKO A;  4TOC A;  3KWO A;  1S2Z A;  2Z90 A;  2YW6 A;  3EZU A;  3BVE A;  2V15 A;  2FJC A;  2JD6 0;  4XKS A;  4AM2 A;  4ZKW A;  4EVD A;  3E6R A;  1JRE A;  1JTS A;  4ERU A;  2ITB A;  1XZ3 A;  3SHX A;  4CVS A;  2XJM A;  4ZKH A;  2C2U A;  4MJY A;  4KVR A;  4M35 A;  3Q4Q A;  3H7G A;  2C2F A;  3RD0 A;  1NF6 A;  4MKU A;  2XJO A;  2V2O A;  5JKL A;  2IU2 A;  4PG1 A;  1JKU A;  5C6F A;  1Z6O M;  5K53 A;  4LPJ A;  1JYB A;  4DYZ A;  3QHC A;  2OH3 A;  3UOF A;  2RBD A;  5HJF A;  3R2S A;  3UNO A;  2ZA7 A;  4ZL5 A;  5I4J A;  5J93 A;  4TOF A;  4ZLW A;  5D8R A;  1LKM A;  3PZA A;  1R03 A;  1L8I A;  4DI0 A;  2ZA8 A;  4CYA A;  4REU A;  5GU3 X;  5LS9 A;  4YKH A;  3IS8 A;  4RC6 A;  4RC5 A;  4TO9 A;  3R2K A;  2VXX A;  4XGS A;  2WTL A;  3KA8 A;  3PWF A;  2GYD A;  2IY4 A;  3PWQ C;  2XKQ A;  2FZF A;  3FSE A;  1VJX A;  4LYX A;  2QQY A;  2VXI A;  5J8W A;  2FG8 A;  3RE7 A;  4A25 A;  1OTK A;  2ZG7 X;  4DZ0 A;  5GU0 X;  2Z5P A;  5FFB A;  1NF4 A;  3KA9 A;  3E1P A;  5CMQ A;  3BKN A;  3E6S A;  3F37 A;  2ZUR X;  3PVY B;  3ES3 A;  3Q4R A;  3R2M A;  2QF9 A;  3AJP A;  1DAT A;  2C6R A;  5D8Q A;  3HL1 A;  5AXS A;  1YV1 A;  5ERJ A;  5K52 A;  4CMY A;  2FG4 A;  3Q4O A;  5D8P A;  2HTN A;  4II4 A;  5FFE A;  3EGM A;  5GU1 X; 
#chains in the Genus database with same CATH topology
 2ZA6 A;  3QVD A;  5E1U A;  4DYU A;  3V3K B;  1B71 A;  2X17 0;  5CMR A;  5JKM G;  2V2N A;  1Z6O A;  3NOZ X;  4PGK A;  1O9R A;  4MN9 A;  2V2S A;  4E40 A;  2JD7 0;  3PWQ A;  2V2I A;  4W4K B;  3RAV A;  5HQO A;  4ZL6 A;  2FFX J;  2V2L A;  3ISE A;  3KDQ A;  1HRS A;  1N1Q A;  3AK9 A;  3T9J A;  3PVR B;  3KXU A;  4ZTT A;  1QYB A;  3BVI A;  5HU6 D;  3E2C A;  1JIG A;  3F35 A;  3DBY A;  3BVK A;  3N6O A;  2GS4 A;  2V2P A;  1VLG A;  2W0O A;  2OC5 A;  2FL0 A;  2XJN A;  4IXK A;  1S3Q A;  1LKP A;  3F38 A;  3PW8 A;  4QUW A;  3NP2 X;  5J8S A;  1TKP A;  4ISM A;  4YVZ A;  4P18 A;  3EZ0 A;  5GN8 A;  4ZJK A;  5LG2 A;  3PVT A;  2V8U A;  3A9Q A;  3U90 A;  4RC7 A;  4DAS A;  4CVP A;  1VEQ A;  4PG0 A;  2VZB A;  1DPS A;  1JKV A;  3GHQ A;  2Y3Q A;  3E1L A;  4EVB A;  1RYT A;  3VNX A;  4Z5S A;  3AF8 X;  3F32 A;  1L8H A;  2CLB A;  3MPS A;  3E1N A;  3AK8 A;  1RCC A;  4ML5 A;  1SOF A;  2FKZ A;  3AJQ A;  4W4L B;  2CN6 A;  4IWJ A;  3OJ5 A;  5FFD A;  3F36 A;  4TOA A;  2D5K A;  1IES A;  2HR5 A;  5JDO B;  4RC6 B;  5FFA A;  4X0J A;  4RC5 B;  4LPM A;  1XZ1 A;  5D8Y A;  4ITT A;  3A68 A;  4IWK A;  4YXJ A;  3PW8 C;  3FRR A;  3C21 A;  1S30 A;  2CHI A;  3QZ3 A;  3KA6 A;  2WWX B;  2CIH A;  2Z6M A;  2BK6 A;  2WLU A;  4ITW A;  3IQ1 A;  3KA3 A;  3PW1 A;  2CWL A;  2AR0 A;  3F39 A;  1LKO A;  2CN7 A;  5JKM A;  3BVF A;  1YUX A;  3NP0 X;  5CZU A;  3E1M A;  5J9V A;  1UMN A;  2GYQ A;  3OGH A;  4CYB A;  4TOH A;  3C1Y A;  3QB9 A;  3SID A;  3F33 A;  2BKC A;  3AJO A;  4TW3 A;  3PVR A;  3ISF A;  1ZUJ A;  3ERZ A;  3O7S A;  4MUD A;  4XKT A;  4II4 B;  3R2O A;  3E1J A;  4ETR A;  3HIU A;  1KRQ A;  2ZG9 X;  4CVT A;  1GWG A;  5GU2 X;  1TJO A;  4LQH A;  3JZA B;  4TOB A;  4WJG 4;  4MY7 A;  5LBH A;  4LYU A;  4KVQ A;  2YJK A;  3WVW A;  1RCI A;  1RCD A;  4DYX A;  1NFV A;  2CF7 A;  1H96 A;  3R2R A;  1DVB A;  3GGZ A;  2G38 B;  4M33 A;  1EUM A;  3SH6 A;  4DE6 A;  3E1O A;  3IS7 A;  4M34 A;  1F33 A;  2Y44 A;  1RCG A;  1BG7 A;  4R42 A;  1VEI A;  2YW7 A;  4YXM A;  3SE1 A;  4M32 A;  1FHA A;  3WVU A;  2YJJ A;  1J30 A;  1JGC A;  4U3G A;  2XGW A;  2JD8 0;  4DYY A;  5LG8 A;  3GE4 A;  4AM4 A;  1ZS3 A;  2FHA A;  5JKL G;  1LB3 A;  1SQ3 A;  3QD8 A;  4XKU A;  5GN8 B;  2F7N A;  4EVC A;  1BFR A;  4LQV A;  3FI6 A;  3O7R A;  3PVT B;  4AM5 A;  3D19 A;  3FRS A;  1MOJ A;  3VV9 A;  2IB0 A;  4CVR A;  1MFR A;  2BW1 A;  4Y08 A;  4TOE A;  4OYN A;  4RC7 B;  3Q4N A;  1O9I A;  5GOU A;  4Z3B A;  5ERK A;  4TOD A;  5JDO A;  1JI5 A;  1F30 A;  4CMY V;  3F34 A;  2WLA A;  3KX9 A;  5D8O A;  2V2R A;  3PVY A;  5FEJ A;  3AF9 X;  3C23 A;  4ZMC A;  1AEW A;  2CLU A;  2V2J A;  3RBC A;  3JZ9 A;  2ZG8 X;  1JI4 A;  4ZKX A;  4CY9 A;  2Z5R A;  1NNQ A;  3R2H A;  4TOG A;  3GVY A;  5E2D A;  1BCF A;  5IX6 A;  2CHP A;  3QHB A;  3TA8 A;  2V8T A;  3UOI A;  2C2J A;  3RGD A;  3FVB A;  2G4H A;  5JAC A;  4EVE A;  1Z4A A;  1UVH A;  4LPN A;  1RCE A;  4RC8 A;  5HJH A;  1VEL A;  3AF7 X;  3KHK A;  2C41 A;  3WNW A;  3WVV A;  1IER A;  4PGI A;  5D8X A;  2PYB A;  2BJY A;  1TK6 A;  4ISP A;  3BVL A;  1YUZ A;  5D8S A;  2V2M A;  4LQN A;  2UX1 A;  4E6K A;  3R2L A;  2CEI A;  4KVS A;  3KA4 A;  5FFC A;  3PW1 B;  4LQJ A;  3E1Q A;  3BT5 A;  2Z5Q A;  1QGH A;  1TKO A;  4MXP A;  4TOC A;  3KWO A;  1S2Z A;  2Z90 A;  2YW6 A;  3EZU A;  3BVE A;  3L0M A;  2V15 A;  2FJC A;  2JD6 0;  4XKS A;  4AM2 A;  4ZKW A;  4EVD A;  3E6R A;  1JRE A;  1JTS A;  4ERU A;  2ITB A;  1XZ3 A;  3SHX A;  4CVS A;  2XJM A;  4ZKH A;  2C2U A;  4MJY A;  4KVR A;  4M35 A;  3Q4Q A;  4KXR B;  3H7G A;  2C2F A;  3RD0 A;  1NF6 A;  4MKU A;  2XJO A;  3LKD A;  2V2O A;  5JKL A;  2IU2 A;  4PG1 A;  1JKU A;  5C6F A;  1Z6O M;  3W54 A;  5K53 A;  4LPJ A;  1JYB A;  3VVA A;  4DYZ A;  3QHC A;  2OH3 A;  3UOF A;  3C1Z A;  2RBD A;  5HJF A;  3R2S A;  3UNO A;  2ZA7 A;  4ZL5 A;  5I4J A;  5J93 A;  4TOF A;  4ZLW A;  5D8R A;  1LKM A;  3PZA A;  1R03 A;  1L8I A;  4DI0 A;  2ZA8 A;  4CYA A;  4REU A;  5GU3 X;  5LS9 A;  4YKH A;  3IS8 A;  4RC6 A;  4RC5 A;  4TO9 A;  3R2K A;  2VXX A;  4XGS A;  2WTL A;  3KA8 A;  3PWF A;  2GYD A;  2IY4 A;  3PWQ C;  2XKQ A;  2FZF A;  3FSE A;  1VJX A;  4LYX A;  2QQY A;  2VXI A;  5J8W A;  2FG8 A;  3RE7 A;  4A25 A;  1OTK A;  2ZG7 X;  4DZ0 A;  5GU0 X;  2Z5P A;  5FFB A;  1NF4 A;  3KA9 A;  3E1P A;  5CMQ A;  3BKN A;  3E6S A;  3F37 A;  3GGY A;  2ZUR X;  3PVY B;  3UFB A;  3ES3 A;  3Q4R A;  3R2M A;  2QF9 A;  3AJP A;  1DAT A;  2C6R A;  2N02 A;  5D8Q A;  2MGY A;  3HL1 A;  5AXS A;  1YV1 A;  5ERJ A;  5K52 A;  4CMY A;  3M6J A;  2OKC A;  2FG4 A;  3Q4O A;  5D8P A;  2HTN A;  4II4 A;  5FFE A;  3EGM A;  5GU1 X; 
#chains in the Genus database with same CATH homology
 2ZA6 A;  3QVD A;  5E1U A;  4DYU A;  3V3K B;  1B71 A;  2X17 0;  5CMR A;  5JKM G;  2V2N A;  1Z6O A;  3NOZ X;  4PGK A;  1O9R A;  4MN9 A;  2V2S A;  4E40 A;  2JD7 0;  3PWQ A;  2V2I A;  4W4K B;  3RAV A;  5HQO A;  4ZL6 A;  2FFX J;  2V2L A;  3ISE A;  3KDQ A;  1HRS A;  1N1Q A;  3AK9 A;  3T9J A;  3PVR B;  3KXU A;  4ZTT A;  1QYB A;  3BVI A;  5HU6 D;  3E2C A;  1JIG A;  3F35 A;  3DBY A;  3BVK A;  3N6O A;  2GS4 A;  2V2P A;  1VLG A;  2W0O A;  2OC5 A;  2FL0 A;  2XJN A;  4IXK A;  1S3Q A;  1LKP A;  3F38 A;  3PW8 A;  4QUW A;  3NP2 X;  5J8S A;  1TKP A;  4ISM A;  4YVZ A;  4P18 A;  3EZ0 A;  5GN8 A;  4ZJK A;  5LG2 A;  3PVT A;  2V8U A;  3A9Q A;  3U90 A;  4RC7 A;  4DAS A;  4CVP A;  1VEQ A;  4PG0 A;  2VZB A;  1DPS A;  1JKV A;  3GHQ A;  2Y3Q A;  3E1L A;  4EVB A;  1RYT A;  3VNX A;  4Z5S A;  3AF8 X;  3F32 A;  1L8H A;  2CLB A;  3MPS A;  3E1N A;  3AK8 A;  1RCC A;  4ML5 A;  1SOF A;  2FKZ A;  3AJQ A;  4W4L B;  2CN6 A;  4IWJ A;  3OJ5 A;  5FFD A;  3F36 A;  4TOA A;  2D5K A;  1IES A;  2HR5 A;  5JDO B;  4RC6 B;  5FFA A;  4X0J A;  4RC5 B;  4LPM A;  1XZ1 A;  5D8Y A;  4ITT A;  3A68 A;  4IWK A;  4YXJ A;  3PW8 C;  3FRR A;  3C21 A;  1S30 A;  2CHI A;  3QZ3 A;  3KA6 A;  2WWX B;  2CIH A;  2Z6M A;  2BK6 A;  2WLU A;  4ITW A;  3IQ1 A;  3KA3 A;  3PW1 A;  2CWL A;  2AR0 A;  3F39 A;  1LKO A;  2CN7 A;  5JKM A;  3BVF A;  1YUX A;  3NP0 X;  5CZU A;  3E1M A;  5J9V A;  1UMN A;  2GYQ A;  3OGH A;  4CYB A;  4TOH A;  3C1Y A;  3QB9 A;  3SID A;  3F33 A;  2BKC A;  3AJO A;  4TW3 A;  3PVR A;  3ISF A;  1ZUJ A;  3ERZ A;  3O7S A;  4MUD A;  4XKT A;  4II4 B;  3R2O A;  3E1J A;  4ETR A;  3HIU A;  1KRQ A;  2ZG9 X;  4CVT A;  1GWG A;  5GU2 X;  1TJO A;  4LQH A;  3JZA B;  4TOB A;  4WJG 4;  4MY7 A;  5LBH A;  4LYU A;  4KVQ A;  2YJK A;  3WVW A;  1RCI A;  1RCD A;  4DYX A;  1NFV A;  2CF7 A;  1H96 A;  3R2R A;  1DVB A;  3GGZ A;  2G38 B;  4M33 A;  1EUM A;  3SH6 A;  4DE6 A;  3E1O A;  3IS7 A;  4M34 A;  1F33 A;  2Y44 A;  1RCG A;  1BG7 A;  4R42 A;  1VEI A;  2YW7 A;  4YXM A;  3SE1 A;  4M32 A;  1FHA A;  3WVU A;  2YJJ A;  1J30 A;  1JGC A;  4U3G A;  2XGW A;  2JD8 0;  4DYY A;  5LG8 A;  3GE4 A;  4AM4 A;  1ZS3 A;  2FHA A;  5JKL G;  1LB3 A;  1SQ3 A;  3QD8 A;  4XKU A;  5GN8 B;  2F7N A;  4EVC A;  1BFR A;  4LQV A;  3FI6 A;  3O7R A;  3PVT B;  4AM5 A;  3D19 A;  3FRS A;  1MOJ A;  3VV9 A;  2IB0 A;  4CVR A;  1MFR A;  2BW1 A;  4Y08 A;  4TOE A;  4OYN A;  4RC7 B;  3Q4N A;  1O9I A;  5GOU A;  4Z3B A;  5ERK A;  4TOD A;  5JDO A;  1JI5 A;  1F30 A;  4CMY V;  3F34 A;  2WLA A;  3KX9 A;  5D8O A;  2V2R A;  3PVY A;  5FEJ A;  3AF9 X;  3C23 A;  4ZMC A;  1AEW A;  2CLU A;  2V2J A;  3RBC A;  3JZ9 A;  2ZG8 X;  1JI4 A;  4ZKX A;  4CY9 A;  2Z5R A;  1NNQ A;  3R2H A;  4TOG A;  3GVY A;  5E2D A;  1BCF A;  5IX6 A;  2CHP A;  3QHB A;  3TA8 A;  2V8T A;  3UOI A;  2C2J A;  3RGD A;  3FVB A;  2G4H A;  5JAC A;  4EVE A;  1Z4A A;  1UVH A;  4LPN A;  1RCE A;  4RC8 A;  5HJH A;  1VEL A;  3AF7 X;  3KHK A;  2C41 A;  3WNW A;  3WVV A;  1IER A;  4PGI A;  5D8X A;  2PYB A;  2BJY A;  1TK6 A;  4ISP A;  3BVL A;  1YUZ A;  5D8S A;  2V2M A;  4LQN A;  2UX1 A;  4E6K A;  3R2L A;  2CEI A;  4KVS A;  3KA4 A;  5FFC A;  3PW1 B;  4LQJ A;  3E1Q A;  3BT5 A;  2Z5Q A;  1QGH A;  1TKO A;  4MXP A;  4TOC A;  3KWO A;  1S2Z A;  2Z90 A;  2YW6 A;  3EZU A;  3BVE A;  3L0M A;  2V15 A;  2FJC A;  2JD6 0;  4XKS A;  4AM2 A;  4ZKW A;  4EVD A;  3E6R A;  1JRE A;  1JTS A;  4ERU A;  2ITB A;  1XZ3 A;  3SHX A;  4CVS A;  2XJM A;  4ZKH A;  2C2U A;  4MJY A;  4KVR A;  4M35 A;  3Q4Q A;  4KXR B;  3H7G A;  2C2F A;  3RD0 A;  1NF6 A;  4MKU A;  2XJO A;  3LKD A;  2V2O A;  5JKL A;  2IU2 A;  4PG1 A;  1JKU A;  5C6F A;  1Z6O M;  3W54 A;  5K53 A;  4LPJ A;  1JYB A;  3VVA A;  4DYZ A;  3QHC A;  2OH3 A;  3UOF A;  3C1Z A;  2RBD A;  5HJF A;  3R2S A;  3UNO A;  2ZA7 A;  4ZL5 A;  5I4J A;  5J93 A;  4TOF A;  4ZLW A;  5D8R A;  1LKM A;  3PZA A;  1R03 A;  1L8I A;  4DI0 A;  2ZA8 A;  4CYA A;  4REU A;  5GU3 X;  5LS9 A;  4YKH A;  3IS8 A;  4RC6 A;  4RC5 A;  4TO9 A;  3R2K A;  2VXX A;  4XGS A;  2WTL A;  3KA8 A;  3PWF A;  2GYD A;  2IY4 A;  3PWQ C;  2XKQ A;  2FZF A;  3FSE A;  1VJX A;  4LYX A;  2QQY A;  2VXI A;  5J8W A;  2FG8 A;  3RE7 A;  4A25 A;  1OTK A;  2ZG7 X;  4DZ0 A;  5GU0 X;  2Z5P A;  5FFB A;  1NF4 A;  3KA9 A;  3E1P A;  5CMQ A;  3BKN A;  3E6S A;  3F37 A;  3GGY A;  2ZUR X;  3PVY B;  3UFB A;  3ES3 A;  3Q4R A;  3R2M A;  2QF9 A;  3AJP A;  1DAT A;  2C6R A;  2N02 A;  5D8Q A;  2MGY A;  3HL1 A;  5AXS A;  1YV1 A;  5ERJ A;  5K52 A;  4CMY A;  3M6J A;  2OKC A;  2FG4 A;  3Q4O A;  5D8P A;  2HTN A;  4II4 A;  5FFE A;  3EGM A;  5GU1 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...