4DYZA

Crystal structure of the apo form of human h-ferritin variant mic1
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
172
structure length
172
Chain Sequence
TSQVRQNYHQDSEAAINRQINLELYASYVYLSMSEYFDRDDVALKNFAKYFHHQSHEEHEHAHKLMKLQEQRGGRIFLQDIQKADEDDWESGLNAMEAALHLEKNVNQSLLELHKLATDKNDPHLADFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferritin heavy chain
publication title Re-engineering protein interfaces yields copper-inducible ferritin cage assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 74
structure length 172
sequence length 172
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4dyzA00
2CLUA 3KXUA 4PGIA 3PVTB 5J93A 1VEIA 4LYXA 5J8SA 4ISPA 5LG8A 1LKOA 2IY4A 2ZG8X 5K53A 4MUDA 5FFAA 5GN8B 2YJJA 2WTLA 1VELA 2C2FA 4YKHA 3EGMA 1YV1A 3Q4QA 1N1QA 2XJOA 5FEJA 1NF4A 1RCGA 3MPSA 5JKLA 1BCFA 3WVVA 1BFRA 1QYBA 1JKVA 3FI6A 3ERZA 3IQ1A 3E6RA 1UVHA 2CN7A 2ZA8A 2FG8A 2V2NA 4Y08A 1Z6OA 2Z90A 4RC6B 1HRSA 2JD60 3R2KA 4ZL5A 1JI4A 1EUMA 4CVRA 5GU1X 3F39A 3WVWA 4M33A 4DE6A 4XGSA 3R2HA 4EVCA 5LBHA 4U3GA 2G4HA 3UNOA 2V2OA 3SIDA 4MJYA 1H96A 1GWGA 1TKOA 3E1JA 5CMQA 3F32A 3OGHA 2BW1A 2CIHA 2QQYA 4Z5SA 4ZMCA 3AF7X 2XJNA 3E1NA 2FZFA 3GVYA 3QB9A 3SH6A 2FFXJ 2GS4A 5E2DA 1MFRA 2FG4A 3ES3A 3BT5A 4DYZA 3F33A 2IB0A 1LKMA 1JKUA 2BJYA 4DI0A 3VNXA 5GU0X 4OYNA 1YUXA 4ZLWA 3KA3A 5D8OA 5HJFA 2V15A 5D8QA 2V2JA 3PW8C 2QF9A 2VXXA 2IU2A 1JI5A 1LB3A 4ZJKA 3O7RA 3ISEA 3F37A 4RC5A 4ZKXA 4DYXA 4LPNA 1RCCA 2D5KA 3E1PA 2XJMA 4CVTA 4KVSA 4RC8A 3PW1A 1TK6A 5K52A 2CF7A 1IESA 4ZKHA 2CEIA 2VXIA 2V2IA 2YW6A 2GYQA 4TOHA 3RAVA 2ZG9X 3F36A 2CHPA 4TO9A 5CMRA 3F35A 3PVRB 2YW7A 3IS7A 1AEWA 3ISFA 4REUA 3E6SA 2X170 3T9JA 5D8XA 3UOFA 1DVBA 1XZ3A 1F33A 1R03A 3PWFA 2XKQA 2WLUA 5J9VA 3BVIA 4CY9A 4ITTA 4MKUA 3SE1A 4TOCA 3WVUA 2CLBA 4LQNA 5GU2X 5FFDA 1BG7A 1L8HA 4LQHA 1MOJA 3QVDA 2Z6MA 3SHXA 1SQ3A 4ML5A 2UX1A 3KA9A 1TKPA 5D8RA 2V2LA 1O9RA 5CZUA 1XZ1A 5ERKA 5ERJA 1RCEA 4TOEA 4MN9A 2V2SA 3QD8A 1DPSA 1JGCA 1JIGA 5JKMA 4QUWA 2HTNA 4M34A 5D8YA 4CMYA 4CYAA 3F38A 3H7GA 3NP2X 2ITBA 3AJQA 4EVEA 2FJCA 3UOIA 4RC7A 1DATA 1RYTA 4PGKA 3E1MA 2Y3QA 5C6FA 4AM2A 3AK9A 4II4A 1JTSA 5D8PA 1ZS3A 3BKNA 4ZTTA 3WNWA 4AM4A 2W0OA 1Z4AA 2BK6A 4LQJA 1VJXA 4M32A 2C6RA 3QZ3A 3KA6A 3PVYA 2C2JA 3EZ0A 3R2MA 2CN6A 5JACA 3Q4NA 3KWOA 3AJOA 2WLAA 3PVTA 2XGWA 2ZA7A 1F30A 3PZAA 3AF8X 2GYDA 5HJHA 3BVKA 1JYBA 2Z5QA 5GN8A 4E6KA 4Z3BA 3OJ5A 3A9QA 1NF6A 3PWQC 3U90A 3HIUA 3GE4A 3NP0X 5D8SA 4DASA 3E1OA 3KA4A 2FL0A 4LQVA 5JKLG 3BVLA 3FVBA 1VEQA 3O7SA 1KRQA 4LPJA 2YJKA 4IWJA 4KVRA 1YUZA 4TOFA 2V2PA 5FFCA 1NFVA 4LPMA 1QGHA 4IWKA 2C2UA 4R42A 3Q4RA 2ZURX 4EVBA 5FFBA 3PW8A 3RBCA 1B71A 2JD70 4XKUA 3QHBA 1OTKA 4RC6A 3AF9X 2JD80 4RC5B 4DYUA 3E2CA 1SOFA 1J30A 1S2ZA 3RE7A 5FFEA 5AXSA 2OC5A 3PW1B 3AK8A 3PWQA 3EZUA 5GU3X 4CYBA 2RBDA 1NNQA 3A68A 1TJOA 3R2OA 3IS8A 2ZA6A 2OH3A 4ZL6A 3E1LA 4XKTA 1S30A 2BKCA 1IERA 5JKMG 2V2MA 4ETRA 1RCDA 3TA8A 2V2RA 2HR5A 4CMYV 1UMNA 5LS9A 4IXKA 3NOZX 4CVPA 3KA8A 1S3QA 3FSEA 4PG0A 4PG1A 4EVDA 4KVQA 3E1QA 1Z6OM 5IX6A 1O9IA 2VZBA 4ITWA 4TODA 5HQOA 2ZG7X 3RD0A 3GHQA 4DZ0A 5J8WA 1L8IA 4P18A 1ZUJA 3R2LA 4ZKWA 4TOAA 4AM5A 4TOGA 2Z5RA 5I4JA 1JREA 4ISMA 3R2SA 4LYUA 5GOUA 2F7NA 3Q4OA 3BVEA 3HL1A 1VLGA 5E1UA 4TW3A 2CHIA 5LG2A 4XKSA 4MY7A 2FKZA 2FHAA 4M35A 2Z5PA 4RC7B 1RCIA 2C41A 4TOBA 2PYBA 3QHCA 4II4B 3KX9A 3PVRA 4CVSA 1LKPA 3RGDA 3AJPA 4ERUA 4A25A 4DYYA 3PVYB 3R2RA 3BVFA 1FHAA 3F34A
chains in the Genus database with same CATH superfamily
2CLUA 3KXUA 4PGIA 3PVTB 5J93A 1VEIA 4LYXA 5J8SA 4ISPA 5LG8A 1LKOA 2IY4A 2ZG8X 5K53A 4MUDA 5FFAA 5GN8B 2YJJA 2WTLA 1VELA 2C2FA 4YKHA 4YXJA 3EGMA 1YV1A 3Q4QA 1N1QA 2XJOA 5FEJA 1NF4A 3GGZA 1RCGA 3MPSA 5JKLA 1BCFA 3WVVA 1BFRA 1QYBA 1JKVA 3FI6A 3ERZA 3IQ1A 3E6RA 1UVHA 2CN7A 2ZA8A 2FG8A 2V2NA 4Y08A 1Z6OA 2Z90A 4RC6B 1HRSA 2JD60 3R2KA 4ZL5A 1JI4A 1EUMA 4CVRA 5GU1X 3F39A 3WVWA 4M33A 3DBYA 4DE6A 4XGSA 3R2HA 4EVCA 5LBHA 4U3GA 2G4HA 3UNOA 2V2OA 3SIDA 3JZAB 4MJYA 1H96A 1GWGA 1TKOA 3E1JA 5CMQA 3F32A 3OGHA 2BW1A 2CIHA 2QQYA 4Z5SA 3VV9A 4ZMCA 2MGYA 3AF7X 2XJNA 3E1NA 3UFBA 2FZFA 3GVYA 2AR0A 3QB9A 3SH6A 2FFXJ 2GS4A 5E2DA 1MFRA 2FG4A 3ES3A 3BT5A 4DYZA 3F33A 3FRRA 3VVAA 2IB0A 1LKMA 1JKUA 2BJYA 4DI0A 3VNXA 5GU0X 4OYNA 1YUXA 4ZLWA 3KA3A 5D8OA 5HJFA 2V15A 5D8QA 3FRSA 4X0JA 2V2JA 3PW8C 2QF9A 2VXXA 2IU2A 1JI5A 1LB3A 4ZJKA 3O7RA 3ISEA 3F37A 4RC5A 4ZKXA 4DYXA 4LPNA 1RCCA 2D5KA 3E1PA 2XJMA 5HU6D 3D19A 4CVTA 2V8UA 4KVSA 4RC8A 3C1ZA 3PW1A 1TK6A 5K52A 2CF7A 2WWXB 1IESA 4ZKHA 2CEIA 2VXIA 2V2IA 2YW6A 2GYQA 3M6JA 4TOHA 2G38B 3RAVA 2ZG9X 4YXMA 3F36A 2CHPA 4TO9A 5CMRA 3F35A 4MXPA 3PVRB 2YW7A 3IS7A 1AEWA 3ISFA 2Y44A 4REUA 3E6SA 2X170 3T9JA 5D8XA 3UOFA 1DVBA 1XZ3A 1F33A 1R03A 3PWFA 2XKQA 2WLUA 5J9VA 3BVIA 4CY9A 4ITTA 4MKUA 3SE1A 4TOCA 3WVUA 2CLBA 4LQNA 5GU2X 5FFDA 1BG7A 1L8HA 4LQHA 1MOJA 3C1YA 4WJG4 3QVDA 2Z6MA 3SHXA 3W54A 1SQ3A 4ML5A 2UX1A 3KA9A 1TKPA 5D8RA 3GGYA 2V2LA 3C23A 1O9RA 5CZUA 1XZ1A 5ERKA 5ERJA 1RCEA 4TOEA 4MN9A 2V2SA 3LKDA 1DPSA 1JGCA 1JIGA 3QD8A 5JKMA 4QUWA 4W4LB 2HTNA 4M34A 5D8YA 4CMYA 4CYAA 3F38A 3H7GA 3NP2X 2ITBA 3AJQA 4EVEA 2FJCA 3UOIA 4RC7A 1DATA 1RYTA 5JDOA 3V3KB 4PGKA 3E1MA 2Y3QA 5C6FA 4AM2A 3AK9A 2OKCA 4II4A 1JTSA 5D8PA 1ZS3A 3BKNA 4ZTTA 3WNWA 4AM4A 2W0OA 1Z4AA 2BK6A 4LQJA 1VJXA 4M32A 2C6RA 3QZ3A 3KA6A 3PVYA 4E40A 2C2JA 3EZ0A 3R2MA 2CN6A 5JACA 3Q4NA 3KWOA 3AJOA 2WLAA 3PVTA 2XGWA 2ZA7A 1F30A 3PZAA 3AF8X 2GYDA 5HJHA 3BVKA 1JYBA 2Z5QA 5GN8A 4E6KA 4Z3BA 3OJ5A 3A9QA 1NF6A 3PWQC 3U90A 3HIUA 3GE4A 3NP0X 5D8SA 4DASA 3E1OA 3C21A 2FL0A 3KA4A 4LQVA 5JKLG 3BVLA 3FVBA 1VEQA 3O7SA 1KRQA 4LPJA 2YJKA 4IWJA 4KVRA 1YUZA 4TOFA 2V2PA 5FFCA 1NFVA 4LPMA 1QGHA 4IWKA 2C2UA 4R42A 3JZ9A 3Q4RA 2ZURX 4EVBA 5FFBA 3PW8A 3RBCA 1B71A 2JD70 4XKUA 2N02A 3QHBA 1OTKA 3N6OA 3AF9X 2JD80 4RC6A 4RC5B 4DYUA 3E2CA 1SOFA 1J30A 1S2ZA 3RE7A 5FFEA 5AXSA 2OC5A 3PW1B 3AK8A 3PWQA 3EZUA 5GU3X 4CYBA 2RBDA 1NNQA 3A68A 1TJOA 3R2OA 3IS8A 2ZA6A 2OH3A 4ZL6A 3E1LA 4XKTA 1S30A 2CWLA 2BKCA 1IERA 3KDQA 5JKMG 2V2MA 4ETRA 1RCDA 3TA8A 2V2RA 2HR5A 4CMYV 1UMNA 5LS9A 4IXKA 3KHKA 3NOZX 4CVPA 3KA8A 1S3QA 3FSEA 4PG0A 3L0MA 4YVZA 4PG1A 4EVDA 4KVQA 3E1QA 4KXRB 1Z6OM 5IX6A 1O9IA 2VZBA 4ITWA 4TODA 5HQOA 2ZG7X 3RD0A 3GHQA 4DZ0A 5J8WA 1L8IA 4P18A 1ZUJA 3R2LA 2V8TA 4ZKWA 4TOAA 4AM5A 4TOGA 2Z5RA 5I4JA 1JREA 4ISMA 3R2SA 4LYUA 5GOUA 2F7NA 3Q4OA 3BVEA 3HL1A 1VLGA 5E1UA 4TW3A 2CHIA 5LG2A 4XKSA 4MY7A 2FKZA 2FHAA 4M35A 2Z5PA 4RC7B 1RCIA 2C41A 4TOBA 5JDOB 4W4KB 2PYBA 3QHCA 4II4B 3KX9A 3PVRA 4CVSA 1LKPA 3RGDA 3AJPA 4ERUA 4A25A 4DYYA 3PVYB 3R2RA 3BVFA 1FHAA 3F34A
chains in the Genus database with same CATH topology
2CLUA 3KXUA 4PGIA 3PVTB 5J93A 1VEIA 4LYXA 5J8SA 4ISPA 5LG8A 1LKOA 2IY4A 2ZG8X 5K53A 4MUDA 5FFAA 5GN8B 2YJJA 2WTLA 1VELA 2C2FA 4YKHA 4YXJA 3EGMA 1YV1A 3Q4QA 1N1QA 2XJOA 5FEJA 1NF4A 3GGZA 1RCGA 3MPSA 5JKLA 1BCFA 3WVVA 1BFRA 1QYBA 1JKVA 3FI6A 3ERZA 3IQ1A 3E6RA 1UVHA 2CN7A 2ZA8A 2FG8A 2V2NA 4Y08A 1Z6OA 2Z90A 4RC6B 1HRSA 2JD60 3R2KA 4ZL5A 1JI4A 1EUMA 4CVRA 5GU1X 3F39A 3WVWA 4M33A 3DBYA 4DE6A 4XGSA 3R2HA 4EVCA 5LBHA 4U3GA 2G4HA 3UNOA 2V2OA 3SIDA 3JZAB 4MJYA 1H96A 1GWGA 1TKOA 3E1JA 5CMQA 3F32A 3OGHA 2BW1A 2CIHA 2QQYA 4Z5SA 3VV9A 4ZMCA 2MGYA 3AF7X 2XJNA 3E1NA 3UFBA 2FZFA 3GVYA 2AR0A 3QB9A 3SH6A 2FFXJ 2GS4A 5E2DA 1MFRA 2FG4A 3ES3A 3BT5A 4DYZA 3F33A 3FRRA 3VVAA 2IB0A 1LKMA 1JKUA 2BJYA 4DI0A 3VNXA 5GU0X 4OYNA 1YUXA 4ZLWA 3KA3A 5D8OA 5HJFA 2V15A 5D8QA 3FRSA 4X0JA 2V2JA 3PW8C 2QF9A 2VXXA 2IU2A 1JI5A 1LB3A 4ZJKA 3O7RA 3ISEA 3F37A 4RC5A 4ZKXA 4DYXA 4LPNA 1RCCA 2D5KA 3E1PA 2XJMA 5HU6D 3D19A 4CVTA 2V8UA 4KVSA 4RC8A 3C1ZA 3PW1A 1TK6A 5K52A 2CF7A 2WWXB 1IESA 4ZKHA 2CEIA 2VXIA 2V2IA 2YW6A 2GYQA 3M6JA 4TOHA 2G38B 3RAVA 2ZG9X 4YXMA 3F36A 2CHPA 4TO9A 5CMRA 3F35A 4MXPA 3PVRB 2YW7A 3IS7A 1AEWA 3ISFA 2Y44A 4REUA 3E6SA 2X170 3T9JA 5D8XA 3UOFA 1DVBA 1XZ3A 1F33A 1R03A 3PWFA 2XKQA 2WLUA 5J9VA 3BVIA 4CY9A 4ITTA 4MKUA 3SE1A 4TOCA 3WVUA 2CLBA 4LQNA 5GU2X 5FFDA 1BG7A 1L8HA 4LQHA 1MOJA 3C1YA 4WJG4 3QVDA 2Z6MA 3SHXA 3W54A 1SQ3A 4ML5A 2UX1A 3KA9A 1TKPA 5D8RA 3GGYA 2V2LA 3C23A 1O9RA 5CZUA 1XZ1A 5ERKA 5ERJA 1RCEA 4TOEA 4MN9A 2V2SA 3LKDA 1DPSA 1JGCA 1JIGA 3QD8A 5JKMA 4QUWA 4W4LB 2HTNA 4M34A 5D8YA 4CMYA 4CYAA 3F38A 3H7GA 3NP2X 2ITBA 3AJQA 4EVEA 2FJCA 3UOIA 4RC7A 1DATA 1RYTA 5JDOA 3V3KB 4PGKA 3E1MA 2Y3QA 5C6FA 4AM2A 3AK9A 2OKCA 4II4A 1JTSA 5D8PA 1ZS3A 3BKNA 4ZTTA 3WNWA 4AM4A 2W0OA 1Z4AA 2BK6A 4LQJA 1VJXA 4M32A 2C6RA 3QZ3A 3KA6A 3PVYA 4E40A 2C2JA 3EZ0A 3R2MA 2CN6A 5JACA 3Q4NA 3KWOA 3AJOA 2WLAA 3PVTA 2XGWA 2ZA7A 1F30A 3PZAA 3AF8X 2GYDA 5HJHA 3BVKA 1JYBA 2Z5QA 5GN8A 4E6KA 4Z3BA 3OJ5A 3A9QA 1NF6A 3PWQC 3U90A 3HIUA 3GE4A 3NP0X 5D8SA 4DASA 3E1OA 3C21A 2FL0A 3KA4A 4LQVA 5JKLG 3BVLA 3FVBA 1VEQA 3O7SA 1KRQA 4LPJA 2YJKA 4IWJA 4KVRA 1YUZA 4TOFA 2V2PA 5FFCA 1NFVA 4LPMA 1QGHA 4IWKA 2C2UA 4R42A 3JZ9A 3Q4RA 2ZURX 4EVBA 5FFBA 3PW8A 3RBCA 1B71A 2JD70 4XKUA 2N02A 3QHBA 1OTKA 3N6OA 3AF9X 2JD80 4RC6A 4RC5B 4DYUA 3E2CA 1SOFA 1J30A 1S2ZA 3RE7A 5FFEA 5AXSA 2OC5A 3PW1B 3AK8A 3PWQA 3EZUA 5GU3X 4CYBA 2RBDA 1NNQA 3A68A 1TJOA 3R2OA 3IS8A 2ZA6A 2OH3A 4ZL6A 3E1LA 4XKTA 1S30A 2CWLA 2BKCA 1IERA 3KDQA 5JKMG 2V2MA 4ETRA 1RCDA 3TA8A 2V2RA 2HR5A 4CMYV 1UMNA 5LS9A 4IXKA 3KHKA 3NOZX 4CVPA 3KA8A 1S3QA 3FSEA 4PG0A 3L0MA 4YVZA 4PG1A 4EVDA 4KVQA 3E1QA 4KXRB 1Z6OM 5IX6A 1O9IA 2VZBA 4ITWA 4TODA 5HQOA 2ZG7X 3RD0A 3GHQA 4DZ0A 5J8WA 1L8IA 4P18A 1ZUJA 3R2LA 2V8TA 4ZKWA 4TOAA 4AM5A 4TOGA 2Z5RA 5I4JA 1JREA 4ISMA 3R2SA 4LYUA 5GOUA 2F7NA 3Q4OA 3BVEA 3HL1A 1VLGA 5E1UA 4TW3A 2CHIA 5LG2A 4XKSA 4MY7A 2FKZA 2FHAA 4M35A 2Z5PA 4RC7B 1RCIA 2C41A 4TOBA 5JDOB 4W4KB 2PYBA 3QHCA 4II4B 3KX9A 3PVRA 4CVSA 1LKPA 3RGDA 3AJPA 4ERUA 4A25A 4DYYA 3PVYB 3R2RA 3BVFA 1FHAA 3F34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CLU A;  3KXU A;  4PGI A;  3PVT B;  5J93 A;  1VEI A;  4LYX A;  5J8S A;  4ISP A;  5LG8 A;  1LKO A;  2IY4 A;  2ZG8 X;  5K53 A;  4MUD A;  5FFA A;  5GN8 B;  2YJJ A;  2WTL A;  1VEL A;  2C2F A;  4YKH A;  3EGM A;  1YV1 A;  3Q4Q A;  1N1Q A;  2XJO A;  5FEJ A;  1NF4 A;  1RCG A;  3MPS A;  5JKL A;  1BCF A;  3WVV A;  1BFR A;  1QYB A;  1JKV A;  3FI6 A;  3ERZ A;  3IQ1 A;  3E6R A;  1UVH A;  2CN7 A;  2ZA8 A;  2FG8 A;  2V2N A;  4Y08 A;  1Z6O A;  2Z90 A;  4RC6 B;  1HRS A;  2JD6 0;  3R2K A;  4ZL5 A;  1JI4 A;  1EUM A;  4CVR A;  5GU1 X;  3F39 A;  3WVW A;  4M33 A;  4DE6 A;  4XGS A;  3R2H A;  4EVC A;  5LBH A;  4U3G A;  2G4H A;  3UNO A;  2V2O A;  3SID A;  4MJY A;  1H96 A;  1GWG A;  1TKO A;  3E1J A;  5CMQ A;  3F32 A;  3OGH A;  2BW1 A;  2CIH A;  2QQY A;  4Z5S A;  4ZMC A;  3AF7 X;  2XJN A;  3E1N A;  2FZF A;  3GVY A;  3QB9 A;  3SH6 A;  2FFX J;  2GS4 A;  5E2D A;  1MFR A;  2FG4 A;  3ES3 A;  3BT5 A;  4DYZ A;  3F33 A;  2IB0 A;  1LKM A;  1JKU A;  2BJY A;  4DI0 A;  3VNX A;  5GU0 X;  4OYN A;  1YUX A;  4ZLW A;  3KA3 A;  5D8O A;  5HJF A;  2V15 A;  5D8Q A;  2V2J A;  3PW8 C;  2QF9 A;  2VXX A;  2IU2 A;  1JI5 A;  1LB3 A;  4ZJK A;  3O7R A;  3ISE A;  3F37 A;  4RC5 A;  4ZKX A;  4DYX A;  4LPN A;  1RCC A;  2D5K A;  3E1P A;  2XJM A;  4CVT A;  4KVS A;  4RC8 A;  3PW1 A;  1TK6 A;  5K52 A;  2CF7 A;  1IES A;  4ZKH A;  2CEI A;  2VXI A;  2V2I A;  2YW6 A;  2GYQ A;  4TOH A;  3RAV A;  2ZG9 X;  3F36 A;  2CHP A;  4TO9 A;  5CMR A;  3F35 A;  3PVR B;  2YW7 A;  3IS7 A;  1AEW A;  3ISF A;  4REU A;  3E6S A;  2X17 0;  3T9J A;  5D8X A;  3UOF A;  1DVB A;  1XZ3 A;  1F33 A;  1R03 A;  3PWF A;  2XKQ A;  2WLU A;  5J9V A;  3BVI A;  4CY9 A;  4ITT A;  4MKU A;  3SE1 A;  4TOC A;  3WVU A;  2CLB A;  4LQN A;  5GU2 X;  5FFD A;  1BG7 A;  1L8H A;  4LQH A;  1MOJ A;  3QVD A;  2Z6M A;  3SHX A;  1SQ3 A;  4ML5 A;  2UX1 A;  3KA9 A;  1TKP A;  5D8R A;  2V2L A;  1O9R A;  5CZU A;  1XZ1 A;  5ERK A;  5ERJ A;  1RCE A;  4TOE A;  4MN9 A;  2V2S A;  3QD8 A;  1DPS A;  1JGC A;  1JIG A;  5JKM A;  4QUW A;  2HTN A;  4M34 A;  5D8Y A;  4CMY A;  4CYA A;  3F38 A;  3H7G A;  3NP2 X;  2ITB A;  3AJQ A;  4EVE A;  2FJC A;  3UOI A;  4RC7 A;  1DAT A;  1RYT A;  4PGK A;  3E1M A;  2Y3Q A;  5C6F A;  4AM2 A;  3AK9 A;  4II4 A;  1JTS A;  5D8P A;  1ZS3 A;  3BKN A;  4ZTT A;  3WNW A;  4AM4 A;  2W0O A;  1Z4A A;  2BK6 A;  4LQJ A;  1VJX A;  4M32 A;  2C6R A;  3QZ3 A;  3KA6 A;  3PVY A;  2C2J A;  3EZ0 A;  3R2M A;  2CN6 A;  5JAC A;  3Q4N A;  3KWO A;  3AJO A;  2WLA A;  3PVT A;  2XGW A;  2ZA7 A;  1F30 A;  3PZA A;  3AF8 X;  2GYD A;  5HJH A;  3BVK A;  1JYB A;  2Z5Q A;  5GN8 A;  4E6K A;  4Z3B A;  3OJ5 A;  3A9Q A;  1NF6 A;  3PWQ C;  3U90 A;  3HIU A;  3GE4 A;  3NP0 X;  5D8S A;  4DAS A;  3E1O A;  3KA4 A;  2FL0 A;  4LQV A;  5JKL G;  3BVL A;  3FVB A;  1VEQ A;  3O7S A;  1KRQ A;  4LPJ A;  2YJK A;  4IWJ A;  4KVR A;  1YUZ A;  4TOF A;  2V2P A;  5FFC A;  1NFV A;  4LPM A;  1QGH A;  4IWK A;  2C2U A;  4R42 A;  3Q4R A;  2ZUR X;  4EVB A;  5FFB A;  3PW8 A;  3RBC A;  1B71 A;  2JD7 0;  4XKU A;  3QHB A;  1OTK A;  4RC6 A;  3AF9 X;  2JD8 0;  4RC5 B;  4DYU A;  3E2C A;  1SOF A;  1J30 A;  1S2Z A;  3RE7 A;  5FFE A;  5AXS A;  2OC5 A;  3PW1 B;  3AK8 A;  3PWQ A;  3EZU A;  5GU3 X;  4CYB A;  2RBD A;  1NNQ A;  3A68 A;  1TJO A;  3R2O A;  3IS8 A;  2ZA6 A;  2OH3 A;  4ZL6 A;  3E1L A;  4XKT A;  1S30 A;  2BKC A;  1IER A;  5JKM G;  2V2M A;  4ETR A;  1RCD A;  3TA8 A;  2V2R A;  2HR5 A;  4CMY V;  1UMN A;  5LS9 A;  4IXK A;  3NOZ X;  4CVP A;  3KA8 A;  1S3Q A;  3FSE A;  4PG0 A;  4PG1 A;  4EVD A;  4KVQ A;  3E1Q A;  1Z6O M;  5IX6 A;  1O9I A;  2VZB A;  4ITW A;  4TOD A;  5HQO A;  2ZG7 X;  3RD0 A;  3GHQ A;  4DZ0 A;  5J8W A;  1L8I A;  4P18 A;  1ZUJ A;  3R2L A;  4ZKW A;  4TOA A;  4AM5 A;  4TOG A;  2Z5R A;  5I4J A;  1JRE A;  4ISM A;  3R2S A;  4LYU A;  5GOU A;  2F7N A;  3Q4O A;  3BVE A;  3HL1 A;  1VLG A;  5E1U A;  4TW3 A;  2CHI A;  5LG2 A;  4XKS A;  4MY7 A;  2FKZ A;  2FHA A;  4M35 A;  2Z5P A;  4RC7 B;  1RCI A;  2C41 A;  4TOB A;  2PYB A;  3QHC A;  4II4 B;  3KX9 A;  3PVR A;  4CVS A;  1LKP A;  3RGD A;  3AJP A;  4ERU A;  4A25 A;  4DYY A;  3PVY B;  3R2R A;  3BVF A;  1FHA A;  3F34 A; 
#chains in the Genus database with same CATH topology
 2CLU A;  3KXU A;  4PGI A;  3PVT B;  5J93 A;  1VEI A;  4LYX A;  5J8S A;  4ISP A;  5LG8 A;  1LKO A;  2IY4 A;  2ZG8 X;  5K53 A;  4MUD A;  5FFA A;  5GN8 B;  2YJJ A;  2WTL A;  1VEL A;  2C2F A;  4YKH A;  4YXJ A;  3EGM A;  1YV1 A;  3Q4Q A;  1N1Q A;  2XJO A;  5FEJ A;  1NF4 A;  3GGZ A;  1RCG A;  3MPS A;  5JKL A;  1BCF A;  3WVV A;  1BFR A;  1QYB A;  1JKV A;  3FI6 A;  3ERZ A;  3IQ1 A;  3E6R A;  1UVH A;  2CN7 A;  2ZA8 A;  2FG8 A;  2V2N A;  4Y08 A;  1Z6O A;  2Z90 A;  4RC6 B;  1HRS A;  2JD6 0;  3R2K A;  4ZL5 A;  1JI4 A;  1EUM A;  4CVR A;  5GU1 X;  3F39 A;  3WVW A;  4M33 A;  3DBY A;  4DE6 A;  4XGS A;  3R2H A;  4EVC A;  5LBH A;  4U3G A;  2G4H A;  3UNO A;  2V2O A;  3SID A;  3JZA B;  4MJY A;  1H96 A;  1GWG A;  1TKO A;  3E1J A;  5CMQ A;  3F32 A;  3OGH A;  2BW1 A;  2CIH A;  2QQY A;  4Z5S A;  3VV9 A;  4ZMC A;  2MGY A;  3AF7 X;  2XJN A;  3E1N A;  3UFB A;  2FZF A;  3GVY A;  2AR0 A;  3QB9 A;  3SH6 A;  2FFX J;  2GS4 A;  5E2D A;  1MFR A;  2FG4 A;  3ES3 A;  3BT5 A;  4DYZ A;  3F33 A;  3FRR A;  3VVA A;  2IB0 A;  1LKM A;  1JKU A;  2BJY A;  4DI0 A;  3VNX A;  5GU0 X;  4OYN A;  1YUX A;  4ZLW A;  3KA3 A;  5D8O A;  5HJF A;  2V15 A;  5D8Q A;  3FRS A;  4X0J A;  2V2J A;  3PW8 C;  2QF9 A;  2VXX A;  2IU2 A;  1JI5 A;  1LB3 A;  4ZJK A;  3O7R A;  3ISE A;  3F37 A;  4RC5 A;  4ZKX A;  4DYX A;  4LPN A;  1RCC A;  2D5K A;  3E1P A;  2XJM A;  5HU6 D;  3D19 A;  4CVT A;  2V8U A;  4KVS A;  4RC8 A;  3C1Z A;  3PW1 A;  1TK6 A;  5K52 A;  2CF7 A;  2WWX B;  1IES A;  4ZKH A;  2CEI A;  2VXI A;  2V2I A;  2YW6 A;  2GYQ A;  3M6J A;  4TOH A;  2G38 B;  3RAV A;  2ZG9 X;  4YXM A;  3F36 A;  2CHP A;  4TO9 A;  5CMR A;  3F35 A;  4MXP A;  3PVR B;  2YW7 A;  3IS7 A;  1AEW A;  3ISF A;  2Y44 A;  4REU A;  3E6S A;  2X17 0;  3T9J A;  5D8X A;  3UOF A;  1DVB A;  1XZ3 A;  1F33 A;  1R03 A;  3PWF A;  2XKQ A;  2WLU A;  5J9V A;  3BVI A;  4CY9 A;  4ITT A;  4MKU A;  3SE1 A;  4TOC A;  3WVU A;  2CLB A;  4LQN A;  5GU2 X;  5FFD A;  1BG7 A;  1L8H A;  4LQH A;  1MOJ A;  3C1Y A;  4WJG 4;  3QVD A;  2Z6M A;  3SHX A;  3W54 A;  1SQ3 A;  4ML5 A;  2UX1 A;  3KA9 A;  1TKP A;  5D8R A;  3GGY A;  2V2L A;  3C23 A;  1O9R A;  5CZU A;  1XZ1 A;  5ERK A;  5ERJ A;  1RCE A;  4TOE A;  4MN9 A;  2V2S A;  3LKD A;  1DPS A;  1JGC A;  1JIG A;  3QD8 A;  5JKM A;  4QUW A;  4W4L B;  2HTN A;  4M34 A;  5D8Y A;  4CMY A;  4CYA A;  3F38 A;  3H7G A;  3NP2 X;  2ITB A;  3AJQ A;  4EVE A;  2FJC A;  3UOI A;  4RC7 A;  1DAT A;  1RYT A;  5JDO A;  3V3K B;  4PGK A;  3E1M A;  2Y3Q A;  5C6F A;  4AM2 A;  3AK9 A;  2OKC A;  4II4 A;  1JTS A;  5D8P A;  1ZS3 A;  3BKN A;  4ZTT A;  3WNW A;  4AM4 A;  2W0O A;  1Z4A A;  2BK6 A;  4LQJ A;  1VJX A;  4M32 A;  2C6R A;  3QZ3 A;  3KA6 A;  3PVY A;  4E40 A;  2C2J A;  3EZ0 A;  3R2M A;  2CN6 A;  5JAC A;  3Q4N A;  3KWO A;  3AJO A;  2WLA A;  3PVT A;  2XGW A;  2ZA7 A;  1F30 A;  3PZA A;  3AF8 X;  2GYD A;  5HJH A;  3BVK A;  1JYB A;  2Z5Q A;  5GN8 A;  4E6K A;  4Z3B A;  3OJ5 A;  3A9Q A;  1NF6 A;  3PWQ C;  3U90 A;  3HIU A;  3GE4 A;  3NP0 X;  5D8S A;  4DAS A;  3E1O A;  3C21 A;  2FL0 A;  3KA4 A;  4LQV A;  5JKL G;  3BVL A;  3FVB A;  1VEQ A;  3O7S A;  1KRQ A;  4LPJ A;  2YJK A;  4IWJ A;  4KVR A;  1YUZ A;  4TOF A;  2V2P A;  5FFC A;  1NFV A;  4LPM A;  1QGH A;  4IWK A;  2C2U A;  4R42 A;  3JZ9 A;  3Q4R A;  2ZUR X;  4EVB A;  5FFB A;  3PW8 A;  3RBC A;  1B71 A;  2JD7 0;  4XKU A;  2N02 A;  3QHB A;  1OTK A;  3N6O A;  3AF9 X;  2JD8 0;  4RC6 A;  4RC5 B;  4DYU A;  3E2C A;  1SOF A;  1J30 A;  1S2Z A;  3RE7 A;  5FFE A;  5AXS A;  2OC5 A;  3PW1 B;  3AK8 A;  3PWQ A;  3EZU A;  5GU3 X;  4CYB A;  2RBD A;  1NNQ A;  3A68 A;  1TJO A;  3R2O A;  3IS8 A;  2ZA6 A;  2OH3 A;  4ZL6 A;  3E1L A;  4XKT A;  1S30 A;  2CWL A;  2BKC A;  1IER A;  3KDQ A;  5JKM G;  2V2M A;  4ETR A;  1RCD A;  3TA8 A;  2V2R A;  2HR5 A;  4CMY V;  1UMN A;  5LS9 A;  4IXK A;  3KHK A;  3NOZ X;  4CVP A;  3KA8 A;  1S3Q A;  3FSE A;  4PG0 A;  3L0M A;  4YVZ A;  4PG1 A;  4EVD A;  4KVQ A;  3E1Q A;  4KXR B;  1Z6O M;  5IX6 A;  1O9I A;  2VZB A;  4ITW A;  4TOD A;  5HQO A;  2ZG7 X;  3RD0 A;  3GHQ A;  4DZ0 A;  5J8W A;  1L8I A;  4P18 A;  1ZUJ A;  3R2L A;  2V8T A;  4ZKW A;  4TOA A;  4AM5 A;  4TOG A;  2Z5R A;  5I4J A;  1JRE A;  4ISM A;  3R2S A;  4LYU A;  5GOU A;  2F7N A;  3Q4O A;  3BVE A;  3HL1 A;  1VLG A;  5E1U A;  4TW3 A;  2CHI A;  5LG2 A;  4XKS A;  4MY7 A;  2FKZ A;  2FHA A;  4M35 A;  2Z5P A;  4RC7 B;  1RCI A;  2C41 A;  4TOB A;  5JDO B;  4W4K B;  2PYB A;  3QHC A;  4II4 B;  3KX9 A;  3PVR A;  4CVS A;  1LKP A;  3RGD A;  3AJP A;  4ERU A;  4A25 A;  4DYY A;  3PVY B;  3R2R A;  3BVF A;  1FHA A;  3F34 A; 
#chains in the Genus database with same CATH homology
 2CLU A;  3KXU A;  4PGI A;  3PVT B;  5J93 A;  1VEI A;  4LYX A;  5J8S A;  4ISP A;  5LG8 A;  1LKO A;  2IY4 A;  2ZG8 X;  5K53 A;  4MUD A;  5FFA A;  5GN8 B;  2YJJ A;  2WTL A;  1VEL A;  2C2F A;  4YKH A;  4YXJ A;  3EGM A;  1YV1 A;  3Q4Q A;  1N1Q A;  2XJO A;  5FEJ A;  1NF4 A;  3GGZ A;  1RCG A;  3MPS A;  5JKL A;  1BCF A;  3WVV A;  1BFR A;  1QYB A;  1JKV A;  3FI6 A;  3ERZ A;  3IQ1 A;  3E6R A;  1UVH A;  2CN7 A;  2ZA8 A;  2FG8 A;  2V2N A;  4Y08 A;  1Z6O A;  2Z90 A;  4RC6 B;  1HRS A;  2JD6 0;  3R2K A;  4ZL5 A;  1JI4 A;  1EUM A;  4CVR A;  5GU1 X;  3F39 A;  3WVW A;  4M33 A;  3DBY A;  4DE6 A;  4XGS A;  3R2H A;  4EVC A;  5LBH A;  4U3G A;  2G4H A;  3UNO A;  2V2O A;  3SID A;  3JZA B;  4MJY A;  1H96 A;  1GWG A;  1TKO A;  3E1J A;  5CMQ A;  3F32 A;  3OGH A;  2BW1 A;  2CIH A;  2QQY A;  4Z5S A;  3VV9 A;  4ZMC A;  2MGY A;  3AF7 X;  2XJN A;  3E1N A;  3UFB A;  2FZF A;  3GVY A;  2AR0 A;  3QB9 A;  3SH6 A;  2FFX J;  2GS4 A;  5E2D A;  1MFR A;  2FG4 A;  3ES3 A;  3BT5 A;  4DYZ A;  3F33 A;  3FRR A;  3VVA A;  2IB0 A;  1LKM A;  1JKU A;  2BJY A;  4DI0 A;  3VNX A;  5GU0 X;  4OYN A;  1YUX A;  4ZLW A;  3KA3 A;  5D8O A;  5HJF A;  2V15 A;  5D8Q A;  3FRS A;  4X0J A;  2V2J A;  3PW8 C;  2QF9 A;  2VXX A;  2IU2 A;  1JI5 A;  1LB3 A;  4ZJK A;  3O7R A;  3ISE A;  3F37 A;  4RC5 A;  4ZKX A;  4DYX A;  4LPN A;  1RCC A;  2D5K A;  3E1P A;  2XJM A;  5HU6 D;  3D19 A;  4CVT A;  2V8U A;  4KVS A;  4RC8 A;  3C1Z A;  3PW1 A;  1TK6 A;  5K52 A;  2CF7 A;  2WWX B;  1IES A;  4ZKH A;  2CEI A;  2VXI A;  2V2I A;  2YW6 A;  2GYQ A;  3M6J A;  4TOH A;  2G38 B;  3RAV A;  2ZG9 X;  4YXM A;  3F36 A;  2CHP A;  4TO9 A;  5CMR A;  3F35 A;  4MXP A;  3PVR B;  2YW7 A;  3IS7 A;  1AEW A;  3ISF A;  2Y44 A;  4REU A;  3E6S A;  2X17 0;  3T9J A;  5D8X A;  3UOF A;  1DVB A;  1XZ3 A;  1F33 A;  1R03 A;  3PWF A;  2XKQ A;  2WLU A;  5J9V A;  3BVI A;  4CY9 A;  4ITT A;  4MKU A;  3SE1 A;  4TOC A;  3WVU A;  2CLB A;  4LQN A;  5GU2 X;  5FFD A;  1BG7 A;  1L8H A;  4LQH A;  1MOJ A;  3C1Y A;  4WJG 4;  3QVD A;  2Z6M A;  3SHX A;  3W54 A;  1SQ3 A;  4ML5 A;  2UX1 A;  3KA9 A;  1TKP A;  5D8R A;  3GGY A;  2V2L A;  3C23 A;  1O9R A;  5CZU A;  1XZ1 A;  5ERK A;  5ERJ A;  1RCE A;  4TOE A;  4MN9 A;  2V2S A;  3LKD A;  1DPS A;  1JGC A;  1JIG A;  3QD8 A;  5JKM A;  4QUW A;  4W4L B;  2HTN A;  4M34 A;  5D8Y A;  4CMY A;  4CYA A;  3F38 A;  3H7G A;  3NP2 X;  2ITB A;  3AJQ A;  4EVE A;  2FJC A;  3UOI A;  4RC7 A;  1DAT A;  1RYT A;  5JDO A;  3V3K B;  4PGK A;  3E1M A;  2Y3Q A;  5C6F A;  4AM2 A;  3AK9 A;  2OKC A;  4II4 A;  1JTS A;  5D8P A;  1ZS3 A;  3BKN A;  4ZTT A;  3WNW A;  4AM4 A;  2W0O A;  1Z4A A;  2BK6 A;  4LQJ A;  1VJX A;  4M32 A;  2C6R A;  3QZ3 A;  3KA6 A;  3PVY A;  4E40 A;  2C2J A;  3EZ0 A;  3R2M A;  2CN6 A;  5JAC A;  3Q4N A;  3KWO A;  3AJO A;  2WLA A;  3PVT A;  2XGW A;  2ZA7 A;  1F30 A;  3PZA A;  3AF8 X;  2GYD A;  5HJH A;  3BVK A;  1JYB A;  2Z5Q A;  5GN8 A;  4E6K A;  4Z3B A;  3OJ5 A;  3A9Q A;  1NF6 A;  3PWQ C;  3U90 A;  3HIU A;  3GE4 A;  3NP0 X;  5D8S A;  4DAS A;  3E1O A;  3C21 A;  2FL0 A;  3KA4 A;  4LQV A;  5JKL G;  3BVL A;  3FVB A;  1VEQ A;  3O7S A;  1KRQ A;  4LPJ A;  2YJK A;  4IWJ A;  4KVR A;  1YUZ A;  4TOF A;  2V2P A;  5FFC A;  1NFV A;  4LPM A;  1QGH A;  4IWK A;  2C2U A;  4R42 A;  3JZ9 A;  3Q4R A;  2ZUR X;  4EVB A;  5FFB A;  3PW8 A;  3RBC A;  1B71 A;  2JD7 0;  4XKU A;  2N02 A;  3QHB A;  1OTK A;  3N6O A;  3AF9 X;  2JD8 0;  4RC6 A;  4RC5 B;  4DYU A;  3E2C A;  1SOF A;  1J30 A;  1S2Z A;  3RE7 A;  5FFE A;  5AXS A;  2OC5 A;  3PW1 B;  3AK8 A;  3PWQ A;  3EZU A;  5GU3 X;  4CYB A;  2RBD A;  1NNQ A;  3A68 A;  1TJO A;  3R2O A;  3IS8 A;  2ZA6 A;  2OH3 A;  4ZL6 A;  3E1L A;  4XKT A;  1S30 A;  2CWL A;  2BKC A;  1IER A;  3KDQ A;  5JKM G;  2V2M A;  4ETR A;  1RCD A;  3TA8 A;  2V2R A;  2HR5 A;  4CMY V;  1UMN A;  5LS9 A;  4IXK A;  3KHK A;  3NOZ X;  4CVP A;  3KA8 A;  1S3Q A;  3FSE A;  4PG0 A;  3L0M A;  4YVZ A;  4PG1 A;  4EVD A;  4KVQ A;  3E1Q A;  4KXR B;  1Z6O M;  5IX6 A;  1O9I A;  2VZB A;  4ITW A;  4TOD A;  5HQO A;  2ZG7 X;  3RD0 A;  3GHQ A;  4DZ0 A;  5J8W A;  1L8I A;  4P18 A;  1ZUJ A;  3R2L A;  2V8T A;  4ZKW A;  4TOA A;  4AM5 A;  4TOG A;  2Z5R A;  5I4J A;  1JRE A;  4ISM A;  3R2S A;  4LYU A;  5GOU A;  2F7N A;  3Q4O A;  3BVE A;  3HL1 A;  1VLG A;  5E1U A;  4TW3 A;  2CHI A;  5LG2 A;  4XKS A;  4MY7 A;  2FKZ A;  2FHA A;  4M35 A;  2Z5P A;  4RC7 B;  1RCI A;  2C41 A;  4TOB A;  5JDO B;  4W4K B;  2PYB A;  3QHC A;  4II4 B;  3KX9 A;  3PVR A;  4CVS A;  1LKP A;  3RGD A;  3AJP A;  4ERU A;  4A25 A;  4DYY A;  3PVY B;  3R2R A;  3BVF A;  1FHA A;  3F34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...