4DYZA

Crystal structure of the apo form of human h-ferritin variant mic1
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
172
structure length
172
Chain Sequence
b'TSQVRQNYHQDSEAAINRQINLELYASYVYLSMSEYFDRDDVALKNFAKYFHHQSHEEHEHAHKLMKLQEQRGGRIFLQDIQKADEDDWESGLNAMEAALHLEKNVNQSLLELHKLATDKNDPHLADFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferritin heavy chain
publication title Re-engineering protein interfaces yields copper-inducible ferritin cage assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 74
structure length 172
sequence length 172
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4dyzA00
4DI0A 2V2MA 5GU2X 3HL1A 3NP2X 5FFBA 2XJOA 2ZA7A 3MPSA 1XZ3A 1HRSA 4LYUA 4REUA 2GYQA 3FVBA 4ZL5A 3KX9A 2RBDA 5E2DA 1JREA 4CVTA 3AF7X 1DVBA 5C6FA 4LQHA 3PVRB 3E6SA 5JKMA 4Z5SA 3WNWA 2X170 4TOFA 3IQ1A 4LQVA 4EVDA 2Y3QA 3KWOA 1VELA 1UMNA 3RGDA 4DYUA 4QUWA 5LG8A 2FL0A 2BKCA 1RCDA 2FG8A 1JI5A 1Z4AA 4CVSA 3NOZX 4PGIA 4EVEA 3IS7A 1BCFA 3PWQC 1LB3A 3E1LA 2V2OA 4CVRA 4CYBA 3U90A 4ZKWA 1AEWA 1H96A 3UNOA 5E1UA 2YJJA 5IX6A 3SIDA 1JGCA 2ZG8X 1B71A 3IS8A 4DASA 1NNQA 1EUMA 2FJCA 4E6KA 1J30A 4ERUA 2ZA8A 1JIGA 3HIUA 1SQ3A 4DYXA 3E1MA 1RCEA 4LPMA 2ITBA 4XKUA 4LPNA 4TO9A 4TW3A 1QYBA 2Z5PA 5HQOA 1IESA 4TOAA 3PVRA 1JTSA 2CHIA 3O7RA 3R2KA 1JKUA 3F38A 4PG1A 3ERZA 3ISEA 3E1PA 3KA4A 3PWQA 2IY4A 3BVEA 4XGSA 1MOJA 4ZL6A 2Z5QA 1N1QA 4MJYA 1JI4A 4M32A 3O7SA 3EZUA 3UOIA 5J8SA 2Z5RA 1TJOA 5LS9A 4ITWA 4LQJA 2V2JA 1ZS3A 3Q4NA 4CMYA 2QQYA 3F34A 3GHQA 5GU3X 4RC8A 2FHAA 3OJ5A 4PG0A 5CZUA 4M34A 3AF8X 1TK6A 4KVRA 4YKHA 2BW1A 2ZG9X 1L8IA 4CYAA 2FZFA 4RC5B 4DE6A 3QHCA 3F33A 2ZA6A 1F30A 4ZTTA 4TOCA 1LKMA 3AK9A 5LBHA 3F37A 3Q4QA 2V2IA 3R2HA 1ZUJA 2D5KA 2CN6A 2ZURX 3RBCA 3BT5A 2CHPA 3ISFA 3PVTA 4MUDA 4TOGA 5JKMG 3A9QA 5JKLG 2CIHA 3A68A 1VLGA 2UX1A 3R2SA 2XKQA 5GU1X 3QHBA 3AJOA 4ZKHA 2IB0A 2QF9A 1DPSA 5D8QA 4DYYA 4TOBA 5D8RA 3R2OA 3KA6A 2FFXJ 2PYBA 2WLUA 4U3GA 3SH6A 5FEJA 2V2SA 1O9RA 1BFRA 4TODA 4DZ0A 4ZLWA 2FKZA 3WVWA 4IWKA 1R03A 2JD60 4Y08A 1L8HA 4MKUA 5J93A 4CVPA 3R2RA 1NF4A 2CF7A 2Z6MA 4TOEA 2BK6A 2JD80 4RC7B 1JKVA 2V2RA 3R2LA 3H7GA 5CMQA 4DYZA 1VEIA 1YUZA 3F35A 1GWGA 3R2MA 3Q4OA 4CY9A 5ERKA 2WLAA 4ZMCA 2IU2A 5D8SA 2V2PA 1UVHA 5D8YA 4II4B 1XZ1A 2C41A 3SE1A 2ZG7X 3FI6A 2XGWA 5CMRA 2BJYA 2CLUA 2VXIA 1RYTA 3F36A 2YW7A 3KA3A 3AK8A 3PZAA 5HJFA 1IERA 4XKSA 5GOUA 3NP0X 3BVIA 1S3QA 3EZ0A 1TKPA 4ETRA 3WVVA 2GYDA 5GN8B 2V15A 5FFCA 5LG2A 1DATA 3GE4A 2YJKA 1LKPA 3E1JA 4RC7A 3VNXA 2JD70 2W0OA 1S2ZA 3SHXA 5FFAA 1RCIA 1NFVA 2VZBA 5J9VA 2XJMA 3PW8C 4IWJA 4RC6B 5D8PA 2HR5A 1RCCA 4MN9A 4IXKA 3BVFA 2C2JA 3Q4RA 3KXUA 3PW1B 5D8OA 3UOFA 1TKOA 1NF6A 5JKLA 4KVQA 1QGHA 4II4A 5K53A 1LKOA 4AM4A 1OTKA 1F33A 2C2UA 2GS4A 4R42A 3PVYB 1RCGA 2CN7A 1O9IA 3TA8A 4ZJKA 4LQNA 3F39A 5D8XA 3KA9A 2C6RA 3BVLA 2HTNA 2CEIA 4CMYV 4AM2A 2CLBA 3QD8A 5GN8A 2OC5A 4KVSA 1KRQA 5I4JA 4RC5A 1S30A 4M35A 3QB9A 3PWFA 3AJQA 3PW8A 3RAVA 2G4HA 3E6RA 1YUXA 3E1NA 4AM5A 1YV1A 3E1OA 3BVKA 2XJNA 3F32A 5JACA 3EGMA 3AJPA 4EVCA 4LYXA 4ISMA 4PGKA 3E2CA 5FFEA 4ML5A 4ZKXA 4RC6A 3OGHA 5AXSA 3PW1A 2FG4A 4MY7A 5J8WA 2V2NA 5FFDA 4OYNA 3AF9X 3RE7A 2Z90A 2VXXA 4TOHA 2OH3A 1MFRA 3RD0A 3T9JA 4ISPA 1FHAA 3BKNA 4P18A 3PVTB 3E1QA 3PVYA 2F7NA 1Z6OA 3KA8A 5ERJA 3GVYA 4XKTA 1Z6OM 2YW6A 4ITTA 5HJHA 4A25A 1SOFA 4LPJA 3FSEA 2V2LA 3QVDA 1VEQA 1VJXA 2C2FA 2WTLA 3WVUA 5GU0X 4Z3BA 5K52A 4M33A 3ES3A 4EVBA 1BG7A 3QZ3A 1JYBA
chains in the Genus database with same CATH superfamily
4W4LB 4DI0A 2V2MA 5GU2X 3HL1A 3NP2X 5FFBA 2XJOA 2ZA7A 3MPSA 1XZ3A 1HRSA 4LYUA 4REUA 2GYQA 3FVBA 4ZL5A 3KX9A 2RBDA 5E2DA 1JREA 4CVTA 3AF7X 1DVBA 2WWXB 5C6FA 4LQHA 3PVRB 3E6SA 5JKMA 4Z5SA 3WNWA 2X170 4YXJA 4TOFA 3IQ1A 4LQVA 4EVDA 2Y3QA 3KWOA 1VELA 1UMNA 3RGDA 4DYUA 4QUWA 5LG8A 2FL0A 2BKCA 1RCDA 2FG8A 1JI5A 1Z4AA 4CVSA 3NOZX 4PGIA 4EVEA 3IS7A 2CWLA 1BCFA 3PWQC 1LB3A 3E1LA 2V2OA 4CVRA 4CYBA 3U90A 4ZKWA 1AEWA 3C1ZA 1H96A 3UNOA 5E1UA 2YJJA 2AR0A 5IX6A 3SIDA 1JGCA 2ZG8X 1B71A 3IS8A 3W54A 4DASA 1NNQA 1EUMA 2FJCA 3C23A 4E6KA 1J30A 4ERUA 2ZA8A 1JIGA 3HIUA 1SQ3A 4DYXA 3E1MA 1RCEA 4LPMA 2ITBA 4XKUA 4LPNA 4TO9A 4TW3A 1QYBA 2Z5PA 5HQOA 1IESA 4TOAA 3PVRA 3C1YA 1JTSA 2CHIA 3O7RA 3R2KA 1JKUA 3F38A 4PG1A 3ERZA 3ISEA 3E1PA 3KA4A 3KDQA 3PWQA 2IY4A 3BVEA 4XGSA 1MOJA 4ZL6A 2Z5QA 1N1QA 4MJYA 1JI4A 4M32A 3O7SA 3EZUA 3UOIA 5J8SA 2Z5RA 1TJOA 5LS9A 4ITWA 4LQJA 2V2JA 1ZS3A 3Q4NA 4CMYA 2QQYA 3F34A 3GHQA 5GU3X 4RC8A 2FHAA 3OJ5A 4PG0A 5CZUA 4M34A 3AF8X 1TK6A 4KVRA 4YKHA 2BW1A 2ZG9X 1L8IA 4CYAA 3FRRA 2FZFA 4RC5B 4DE6A 3QHCA 3F33A 2ZA6A 1F30A 4ZTTA 4TOCA 1LKMA 3AK9A 5LBHA 3F37A 3Q4QA 2V2IA 3R2HA 1ZUJA 2D5KA 2CN6A 2ZURX 3RBCA 3BT5A 2CHPA 3ISFA 3PVTA 4MUDA 4TOGA 5JKMG 3A9QA 3C21A 5JKLG 2CIHA 3A68A 5JDOB 1VLGA 2UX1A 3R2SA 2XKQA 5GU1X 3QHBA 3AJOA 4ZKHA 3N6OA 2IB0A 2QF9A 1DPSA 4X0JA 5D8QA 4DYYA 4TOBA 5D8RA 3R2OA 3KA6A 2FFXJ 3L0MA 2PYBA 2WLUA 4U3GA 3SH6A 5FEJA 2V2SA 1O9RA 1BFRA 4TODA 4DZ0A 4ZLWA 2FKZA 3WVWA 4IWKA 1R03A 2JD60 4Y08A 1L8HA 3JZ9A 4MKUA 5J93A 4CVPA 3R2RA 1NF4A 2CF7A 2Z6MA 4TOEA 2BK6A 3JZAB 2JD80 4RC7B 3UFBA 1JKVA 2V2RA 3R2LA 3FRSA 2Y44A 3H7GA 5CMQA 2OKCA 4DYZA 1VEIA 1YUZA 3F35A 1GWGA 3R2MA 3V3KB 3Q4OA 4CY9A 5ERKA 2WLAA 4ZMCA 2IU2A 5D8SA 2V2PA 1UVHA 5D8YA 4II4B 1XZ1A 2C41A 3SE1A 2ZG7X 4KXRB 3FI6A 2XGWA 5CMRA 2BJYA 2CLUA 2VXIA 1RYTA 3F36A 2YW7A 3KA3A 3AK8A 3PZAA 5HJFA 1IERA 4XKSA 5GOUA 3NP0X 3BVIA 1S3QA 3EZ0A 1TKPA 4ETRA 3WVVA 2GYDA 2MGYA 5GN8B 2V15A 5FFCA 5LG2A 1DATA 3GE4A 2YJKA 1LKPA 3E1JA 4RC7A 3VNXA 2JD70 2W0OA 1S2ZA 3SHXA 5FFAA 1RCIA 1NFVA 2VZBA 3LKDA 5J9VA 2XJMA 3M6JA 3PW8C 4W4KB 4IWJA 4RC6B 5D8PA 2HR5A 1RCCA 4MN9A 4IXKA 3BVFA 2C2JA 3Q4RA 3KXUA 3PW1B 5D8OA 3UOFA 1TKOA 1NF6A 2V8UA 5JKLA 4KVQA 3D19A 1QGHA 4II4A 5K53A 1LKOA 4AM4A 4YXMA 1OTKA 1F33A 2C2UA 2GS4A 4R42A 3PVYB 2N02A 1RCGA 2CN7A 1O9IA 3TA8A 4ZJKA 4LQNA 3F39A 5D8XA 3KA9A 2C6RA 3BVLA 2HTNA 2CEIA 3VVAA 4CMYV 5HU6D 4AM2A 2CLBA 3QD8A 5GN8A 2OC5A 4KVSA 1KRQA 4MXPA 5I4JA 4RC5A 1S30A 4M35A 3QB9A 3PWFA 3VV9A 3AJQA 3PW8A 3RAVA 2G4HA 3E6RA 1YUXA 3E1NA 4AM5A 1YV1A 3E1OA 3BVKA 3GGYA 2XJNA 3F32A 2G38B 5JACA 3EGMA 3AJPA 4EVCA 5JDOA 4LYXA 4ISMA 4PGKA 3E2CA 5FFEA 4ML5A 4ZKXA 4RC6A 3OGHA 3GGZA 5AXSA 3PW1A 3KHKA 2FG4A 4MY7A 5J8WA 2V2NA 5FFDA 4OYNA 3AF9X 3RE7A 2Z90A 2VXXA 4TOHA 2OH3A 1MFRA 4WJG4 3RD0A 3T9JA 4ISPA 1FHAA 3BKNA 4P18A 3PVTB 3E1QA 3PVYA 2F7NA 1Z6OA 3KA8A 5ERJA 3GVYA 4XKTA 1Z6OM 2YW6A 4ITTA 2V8TA 5HJHA 4A25A 1SOFA 3DBYA 4LPJA 3FSEA 2V2LA 3QVDA 1VEQA 1VJXA 2C2FA 4E40A 2WTLA 3WVUA 5GU0X 4Z3BA 5K52A 4M33A 3ES3A 4YVZA 4EVBA 1BG7A 3QZ3A 1JYBA
chains in the Genus database with same CATH topology
4W4LB 4DI0A 2V2MA 5GU2X 3HL1A 3NP2X 5FFBA 2XJOA 2ZA7A 3MPSA 1XZ3A 1HRSA 4LYUA 4REUA 2GYQA 3FVBA 4ZL5A 3KX9A 2RBDA 5E2DA 1JREA 4CVTA 3AF7X 1DVBA 2WWXB 5C6FA 4LQHA 3PVRB 3E6SA 5JKMA 4Z5SA 3WNWA 2X170 4YXJA 4TOFA 3IQ1A 4LQVA 4EVDA 2Y3QA 3KWOA 1VELA 1UMNA 3RGDA 4DYUA 4QUWA 5LG8A 2FL0A 2BKCA 1RCDA 2FG8A 1JI5A 1Z4AA 4CVSA 3NOZX 4PGIA 4EVEA 3IS7A 2CWLA 1BCFA 3PWQC 1LB3A 3E1LA 2V2OA 4CVRA 4CYBA 3U90A 4ZKWA 1AEWA 3C1ZA 1H96A 3UNOA 5E1UA 2YJJA 2AR0A 5IX6A 3SIDA 1JGCA 2ZG8X 1B71A 3IS8A 3W54A 4DASA 1NNQA 1EUMA 2FJCA 3C23A 4E6KA 1J30A 4ERUA 2ZA8A 1JIGA 3HIUA 1SQ3A 4DYXA 3E1MA 1RCEA 4LPMA 2ITBA 4XKUA 4LPNA 4TO9A 4TW3A 1QYBA 2Z5PA 5HQOA 1IESA 4TOAA 3PVRA 3C1YA 1JTSA 2CHIA 3O7RA 3R2KA 1JKUA 3F38A 4PG1A 3ERZA 3ISEA 3E1PA 3KA4A 3KDQA 3PWQA 2IY4A 3BVEA 4XGSA 1MOJA 4ZL6A 2Z5QA 1N1QA 4MJYA 1JI4A 4M32A 3O7SA 3EZUA 3UOIA 5J8SA 2Z5RA 1TJOA 5LS9A 4ITWA 4LQJA 2V2JA 1ZS3A 3Q4NA 4CMYA 2QQYA 3F34A 3GHQA 5GU3X 4RC8A 2FHAA 3OJ5A 4PG0A 5CZUA 4M34A 3AF8X 1TK6A 4KVRA 4YKHA 2BW1A 2ZG9X 1L8IA 4CYAA 3FRRA 2FZFA 4RC5B 4DE6A 3QHCA 3F33A 2ZA6A 1F30A 4ZTTA 4TOCA 1LKMA 3AK9A 5LBHA 3F37A 3Q4QA 2V2IA 3R2HA 1ZUJA 2D5KA 2CN6A 2ZURX 3RBCA 3BT5A 2CHPA 3ISFA 3PVTA 4MUDA 4TOGA 5JKMG 3A9QA 3C21A 5JKLG 2CIHA 3A68A 5JDOB 1VLGA 2UX1A 3R2SA 2XKQA 5GU1X 3QHBA 3AJOA 4ZKHA 3N6OA 2IB0A 2QF9A 1DPSA 4X0JA 5D8QA 4DYYA 4TOBA 5D8RA 3R2OA 3KA6A 2FFXJ 3L0MA 2PYBA 2WLUA 4U3GA 3SH6A 5FEJA 2V2SA 1O9RA 1BFRA 4TODA 4DZ0A 4ZLWA 2FKZA 3WVWA 4IWKA 1R03A 2JD60 4Y08A 1L8HA 3JZ9A 4MKUA 5J93A 4CVPA 3R2RA 1NF4A 2CF7A 2Z6MA 4TOEA 2BK6A 3JZAB 2JD80 4RC7B 3UFBA 1JKVA 2V2RA 3R2LA 3FRSA 2Y44A 3H7GA 5CMQA 2OKCA 4DYZA 1VEIA 1YUZA 3F35A 1GWGA 3R2MA 3V3KB 3Q4OA 4CY9A 5ERKA 2WLAA 4ZMCA 2IU2A 5D8SA 2V2PA 1UVHA 5D8YA 4II4B 1XZ1A 2C41A 3SE1A 2ZG7X 4KXRB 3FI6A 2XGWA 5CMRA 2BJYA 2CLUA 2VXIA 1RYTA 3F36A 2YW7A 3KA3A 3AK8A 3PZAA 5HJFA 1IERA 4XKSA 5GOUA 3NP0X 3BVIA 1S3QA 3EZ0A 1TKPA 4ETRA 3WVVA 2GYDA 2MGYA 5GN8B 2V15A 5FFCA 5LG2A 1DATA 3GE4A 2YJKA 1LKPA 3E1JA 4RC7A 3VNXA 2JD70 2W0OA 1S2ZA 3SHXA 5FFAA 1RCIA 1NFVA 2VZBA 3LKDA 5J9VA 2XJMA 3M6JA 3PW8C 4W4KB 4IWJA 4RC6B 5D8PA 2HR5A 1RCCA 4MN9A 4IXKA 3BVFA 2C2JA 3Q4RA 3KXUA 3PW1B 5D8OA 3UOFA 1TKOA 1NF6A 2V8UA 5JKLA 4KVQA 3D19A 1QGHA 4II4A 5K53A 1LKOA 4AM4A 4YXMA 1OTKA 1F33A 2C2UA 2GS4A 4R42A 3PVYB 2N02A 1RCGA 2CN7A 1O9IA 3TA8A 4ZJKA 4LQNA 3F39A 5D8XA 3KA9A 2C6RA 3BVLA 2HTNA 2CEIA 3VVAA 4CMYV 5HU6D 4AM2A 2CLBA 3QD8A 5GN8A 2OC5A 4KVSA 1KRQA 4MXPA 5I4JA 4RC5A 1S30A 4M35A 3QB9A 3PWFA 3VV9A 3AJQA 3PW8A 3RAVA 2G4HA 3E6RA 1YUXA 3E1NA 4AM5A 1YV1A 3E1OA 3BVKA 3GGYA 2XJNA 3F32A 2G38B 5JACA 3EGMA 3AJPA 4EVCA 5JDOA 4LYXA 4ISMA 4PGKA 3E2CA 5FFEA 4ML5A 4ZKXA 4RC6A 3OGHA 3GGZA 5AXSA 3PW1A 3KHKA 2FG4A 4MY7A 5J8WA 2V2NA 5FFDA 4OYNA 3AF9X 3RE7A 2Z90A 2VXXA 4TOHA 2OH3A 1MFRA 4WJG4 3RD0A 3T9JA 4ISPA 1FHAA 3BKNA 4P18A 3PVTB 3E1QA 3PVYA 2F7NA 1Z6OA 3KA8A 5ERJA 3GVYA 4XKTA 1Z6OM 2YW6A 4ITTA 2V8TA 5HJHA 4A25A 1SOFA 3DBYA 4LPJA 3FSEA 2V2LA 3QVDA 1VEQA 1VJXA 2C2FA 4E40A 2WTLA 3WVUA 5GU0X 4Z3BA 5K52A 4M33A 3ES3A 4YVZA 4EVBA 1BG7A 3QZ3A 1JYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DI0 A;  2V2M A;  5GU2 X;  3HL1 A;  3NP2 X;  5FFB A;  2XJO A;  2ZA7 A;  3MPS A;  1XZ3 A;  1HRS A;  4LYU A;  4REU A;  2GYQ A;  3FVB A;  4ZL5 A;  3KX9 A;  2RBD A;  5E2D A;  1JRE A;  4CVT A;  3AF7 X;  1DVB A;  5C6F A;  4LQH A;  3PVR B;  3E6S A;  5JKM A;  4Z5S A;  3WNW A;  2X17 0;  4TOF A;  3IQ1 A;  4LQV A;  4EVD A;  2Y3Q A;  3KWO A;  1VEL A;  1UMN A;  3RGD A;  4DYU A;  4QUW A;  5LG8 A;  2FL0 A;  2BKC A;  1RCD A;  2FG8 A;  1JI5 A;  1Z4A A;  4CVS A;  3NOZ X;  4PGI A;  4EVE A;  3IS7 A;  1BCF A;  3PWQ C;  1LB3 A;  3E1L A;  2V2O A;  4CVR A;  4CYB A;  3U90 A;  4ZKW A;  1AEW A;  1H96 A;  3UNO A;  5E1U A;  2YJJ A;  5IX6 A;  3SID A;  1JGC A;  2ZG8 X;  1B71 A;  3IS8 A;  4DAS A;  1NNQ A;  1EUM A;  2FJC A;  4E6K A;  1J30 A;  4ERU A;  2ZA8 A;  1JIG A;  3HIU A;  1SQ3 A;  4DYX A;  3E1M A;  1RCE A;  4LPM A;  2ITB A;  4XKU A;  4LPN A;  4TO9 A;  4TW3 A;  1QYB A;  2Z5P A;  5HQO A;  1IES A;  4TOA A;  3PVR A;  1JTS A;  2CHI A;  3O7R A;  3R2K A;  1JKU A;  3F38 A;  4PG1 A;  3ERZ A;  3ISE A;  3E1P A;  3KA4 A;  3PWQ A;  2IY4 A;  3BVE A;  4XGS A;  1MOJ A;  4ZL6 A;  2Z5Q A;  1N1Q A;  4MJY A;  1JI4 A;  4M32 A;  3O7S A;  3EZU A;  3UOI A;  5J8S A;  2Z5R A;  1TJO A;  5LS9 A;  4ITW A;  4LQJ A;  2V2J A;  1ZS3 A;  3Q4N A;  4CMY A;  2QQY A;  3F34 A;  3GHQ A;  5GU3 X;  4RC8 A;  2FHA A;  3OJ5 A;  4PG0 A;  5CZU A;  4M34 A;  3AF8 X;  1TK6 A;  4KVR A;  4YKH A;  2BW1 A;  2ZG9 X;  1L8I A;  4CYA A;  2FZF A;  4RC5 B;  4DE6 A;  3QHC A;  3F33 A;  2ZA6 A;  1F30 A;  4ZTT A;  4TOC A;  1LKM A;  3AK9 A;  5LBH A;  3F37 A;  3Q4Q A;  2V2I A;  3R2H A;  1ZUJ A;  2D5K A;  2CN6 A;  2ZUR X;  3RBC A;  3BT5 A;  2CHP A;  3ISF A;  3PVT A;  4MUD A;  4TOG A;  5JKM G;  3A9Q A;  5JKL G;  2CIH A;  3A68 A;  1VLG A;  2UX1 A;  3R2S A;  2XKQ A;  5GU1 X;  3QHB A;  3AJO A;  4ZKH A;  2IB0 A;  2QF9 A;  1DPS A;  5D8Q A;  4DYY A;  4TOB A;  5D8R A;  3R2O A;  3KA6 A;  2FFX J;  2PYB A;  2WLU A;  4U3G A;  3SH6 A;  5FEJ A;  2V2S A;  1O9R A;  1BFR A;  4TOD A;  4DZ0 A;  4ZLW A;  2FKZ A;  3WVW A;  4IWK A;  1R03 A;  2JD6 0;  4Y08 A;  1L8H A;  4MKU A;  5J93 A;  4CVP A;  3R2R A;  1NF4 A;  2CF7 A;  2Z6M A;  4TOE A;  2BK6 A;  2JD8 0;  4RC7 B;  1JKV A;  2V2R A;  3R2L A;  3H7G A;  5CMQ A;  4DYZ A;  1VEI A;  1YUZ A;  3F35 A;  1GWG A;  3R2M A;  3Q4O A;  4CY9 A;  5ERK A;  2WLA A;  4ZMC A;  2IU2 A;  5D8S A;  2V2P A;  1UVH A;  5D8Y A;  4II4 B;  1XZ1 A;  2C41 A;  3SE1 A;  2ZG7 X;  3FI6 A;  2XGW A;  5CMR A;  2BJY A;  2CLU A;  2VXI A;  1RYT A;  3F36 A;  2YW7 A;  3KA3 A;  3AK8 A;  3PZA A;  5HJF A;  1IER A;  4XKS A;  5GOU A;  3NP0 X;  3BVI A;  1S3Q A;  3EZ0 A;  1TKP A;  4ETR A;  3WVV A;  2GYD A;  5GN8 B;  2V15 A;  5FFC A;  5LG2 A;  1DAT A;  3GE4 A;  2YJK A;  1LKP A;  3E1J A;  4RC7 A;  3VNX A;  2JD7 0;  2W0O A;  1S2Z A;  3SHX A;  5FFA A;  1RCI A;  1NFV A;  2VZB A;  5J9V A;  2XJM A;  3PW8 C;  4IWJ A;  4RC6 B;  5D8P A;  2HR5 A;  1RCC A;  4MN9 A;  4IXK A;  3BVF A;  2C2J A;  3Q4R A;  3KXU A;  3PW1 B;  5D8O A;  3UOF A;  1TKO A;  1NF6 A;  5JKL A;  4KVQ A;  1QGH A;  4II4 A;  5K53 A;  1LKO A;  4AM4 A;  1OTK A;  1F33 A;  2C2U A;  2GS4 A;  4R42 A;  3PVY B;  1RCG A;  2CN7 A;  1O9I A;  3TA8 A;  4ZJK A;  4LQN A;  3F39 A;  5D8X A;  3KA9 A;  2C6R A;  3BVL A;  2HTN A;  2CEI A;  4CMY V;  4AM2 A;  2CLB A;  3QD8 A;  5GN8 A;  2OC5 A;  4KVS A;  1KRQ A;  5I4J A;  4RC5 A;  1S30 A;  4M35 A;  3QB9 A;  3PWF A;  3AJQ A;  3PW8 A;  3RAV A;  2G4H A;  3E6R A;  1YUX A;  3E1N A;  4AM5 A;  1YV1 A;  3E1O A;  3BVK A;  2XJN A;  3F32 A;  5JAC A;  3EGM A;  3AJP A;  4EVC A;  4LYX A;  4ISM A;  4PGK A;  3E2C A;  5FFE A;  4ML5 A;  4ZKX A;  4RC6 A;  3OGH A;  5AXS A;  3PW1 A;  2FG4 A;  4MY7 A;  5J8W A;  2V2N A;  5FFD A;  4OYN A;  3AF9 X;  3RE7 A;  2Z90 A;  2VXX A;  4TOH A;  2OH3 A;  1MFR A;  3RD0 A;  3T9J A;  4ISP A;  1FHA A;  3BKN A;  4P18 A;  3PVT B;  3E1Q A;  3PVY A;  2F7N A;  1Z6O A;  3KA8 A;  5ERJ A;  3GVY A;  4XKT A;  1Z6O M;  2YW6 A;  4ITT A;  5HJH A;  4A25 A;  1SOF A;  4LPJ A;  3FSE A;  2V2L A;  3QVD A;  1VEQ A;  1VJX A;  2C2F A;  2WTL A;  3WVU A;  5GU0 X;  4Z3B A;  5K52 A;  4M33 A;  3ES3 A;  4EVB A;  1BG7 A;  3QZ3 A;  1JYB A; 
#chains in the Genus database with same CATH topology
 4W4L B;  4DI0 A;  2V2M A;  5GU2 X;  3HL1 A;  3NP2 X;  5FFB A;  2XJO A;  2ZA7 A;  3MPS A;  1XZ3 A;  1HRS A;  4LYU A;  4REU A;  2GYQ A;  3FVB A;  4ZL5 A;  3KX9 A;  2RBD A;  5E2D A;  1JRE A;  4CVT A;  3AF7 X;  1DVB A;  2WWX B;  5C6F A;  4LQH A;  3PVR B;  3E6S A;  5JKM A;  4Z5S A;  3WNW A;  2X17 0;  4YXJ A;  4TOF A;  3IQ1 A;  4LQV A;  4EVD A;  2Y3Q A;  3KWO A;  1VEL A;  1UMN A;  3RGD A;  4DYU A;  4QUW A;  5LG8 A;  2FL0 A;  2BKC A;  1RCD A;  2FG8 A;  1JI5 A;  1Z4A A;  4CVS A;  3NOZ X;  4PGI A;  4EVE A;  3IS7 A;  2CWL A;  1BCF A;  3PWQ C;  1LB3 A;  3E1L A;  2V2O A;  4CVR A;  4CYB A;  3U90 A;  4ZKW A;  1AEW A;  3C1Z A;  1H96 A;  3UNO A;  5E1U A;  2YJJ A;  2AR0 A;  5IX6 A;  3SID A;  1JGC A;  2ZG8 X;  1B71 A;  3IS8 A;  3W54 A;  4DAS A;  1NNQ A;  1EUM A;  2FJC A;  3C23 A;  4E6K A;  1J30 A;  4ERU A;  2ZA8 A;  1JIG A;  3HIU A;  1SQ3 A;  4DYX A;  3E1M A;  1RCE A;  4LPM A;  2ITB A;  4XKU A;  4LPN A;  4TO9 A;  4TW3 A;  1QYB A;  2Z5P A;  5HQO A;  1IES A;  4TOA A;  3PVR A;  3C1Y A;  1JTS A;  2CHI A;  3O7R A;  3R2K A;  1JKU A;  3F38 A;  4PG1 A;  3ERZ A;  3ISE A;  3E1P A;  3KA4 A;  3KDQ A;  3PWQ A;  2IY4 A;  3BVE A;  4XGS A;  1MOJ A;  4ZL6 A;  2Z5Q A;  1N1Q A;  4MJY A;  1JI4 A;  4M32 A;  3O7S A;  3EZU A;  3UOI A;  5J8S A;  2Z5R A;  1TJO A;  5LS9 A;  4ITW A;  4LQJ A;  2V2J A;  1ZS3 A;  3Q4N A;  4CMY A;  2QQY A;  3F34 A;  3GHQ A;  5GU3 X;  4RC8 A;  2FHA A;  3OJ5 A;  4PG0 A;  5CZU A;  4M34 A;  3AF8 X;  1TK6 A;  4KVR A;  4YKH A;  2BW1 A;  2ZG9 X;  1L8I A;  4CYA A;  3FRR A;  2FZF A;  4RC5 B;  4DE6 A;  3QHC A;  3F33 A;  2ZA6 A;  1F30 A;  4ZTT A;  4TOC A;  1LKM A;  3AK9 A;  5LBH A;  3F37 A;  3Q4Q A;  2V2I A;  3R2H A;  1ZUJ A;  2D5K A;  2CN6 A;  2ZUR X;  3RBC A;  3BT5 A;  2CHP A;  3ISF A;  3PVT A;  4MUD A;  4TOG A;  5JKM G;  3A9Q A;  3C21 A;  5JKL G;  2CIH A;  3A68 A;  5JDO B;  1VLG A;  2UX1 A;  3R2S A;  2XKQ A;  5GU1 X;  3QHB A;  3AJO A;  4ZKH A;  3N6O A;  2IB0 A;  2QF9 A;  1DPS A;  4X0J A;  5D8Q A;  4DYY A;  4TOB A;  5D8R A;  3R2O A;  3KA6 A;  2FFX J;  3L0M A;  2PYB A;  2WLU A;  4U3G A;  3SH6 A;  5FEJ A;  2V2S A;  1O9R A;  1BFR A;  4TOD A;  4DZ0 A;  4ZLW A;  2FKZ A;  3WVW A;  4IWK A;  1R03 A;  2JD6 0;  4Y08 A;  1L8H A;  3JZ9 A;  4MKU A;  5J93 A;  4CVP A;  3R2R A;  1NF4 A;  2CF7 A;  2Z6M A;  4TOE A;  2BK6 A;  3JZA B;  2JD8 0;  4RC7 B;  3UFB A;  1JKV A;  2V2R A;  3R2L A;  3FRS A;  2Y44 A;  3H7G A;  5CMQ A;  2OKC A;  4DYZ A;  1VEI A;  1YUZ A;  3F35 A;  1GWG A;  3R2M A;  3V3K B;  3Q4O A;  4CY9 A;  5ERK A;  2WLA A;  4ZMC A;  2IU2 A;  5D8S A;  2V2P A;  1UVH A;  5D8Y A;  4II4 B;  1XZ1 A;  2C41 A;  3SE1 A;  2ZG7 X;  4KXR B;  3FI6 A;  2XGW A;  5CMR A;  2BJY A;  2CLU A;  2VXI A;  1RYT A;  3F36 A;  2YW7 A;  3KA3 A;  3AK8 A;  3PZA A;  5HJF A;  1IER A;  4XKS A;  5GOU A;  3NP0 X;  3BVI A;  1S3Q A;  3EZ0 A;  1TKP A;  4ETR A;  3WVV A;  2GYD A;  2MGY A;  5GN8 B;  2V15 A;  5FFC A;  5LG2 A;  1DAT A;  3GE4 A;  2YJK A;  1LKP A;  3E1J A;  4RC7 A;  3VNX A;  2JD7 0;  2W0O A;  1S2Z A;  3SHX A;  5FFA A;  1RCI A;  1NFV A;  2VZB A;  3LKD A;  5J9V A;  2XJM A;  3M6J A;  3PW8 C;  4W4K B;  4IWJ A;  4RC6 B;  5D8P A;  2HR5 A;  1RCC A;  4MN9 A;  4IXK A;  3BVF A;  2C2J A;  3Q4R A;  3KXU A;  3PW1 B;  5D8O A;  3UOF A;  1TKO A;  1NF6 A;  2V8U A;  5JKL A;  4KVQ A;  3D19 A;  1QGH A;  4II4 A;  5K53 A;  1LKO A;  4AM4 A;  4YXM A;  1OTK A;  1F33 A;  2C2U A;  2GS4 A;  4R42 A;  3PVY B;  2N02 A;  1RCG A;  2CN7 A;  1O9I A;  3TA8 A;  4ZJK A;  4LQN A;  3F39 A;  5D8X A;  3KA9 A;  2C6R A;  3BVL A;  2HTN A;  2CEI A;  3VVA A;  4CMY V;  5HU6 D;  4AM2 A;  2CLB A;  3QD8 A;  5GN8 A;  2OC5 A;  4KVS A;  1KRQ A;  4MXP A;  5I4J A;  4RC5 A;  1S30 A;  4M35 A;  3QB9 A;  3PWF A;  3VV9 A;  3AJQ A;  3PW8 A;  3RAV A;  2G4H A;  3E6R A;  1YUX A;  3E1N A;  4AM5 A;  1YV1 A;  3E1O A;  3BVK A;  3GGY A;  2XJN A;  3F32 A;  2G38 B;  5JAC A;  3EGM A;  3AJP A;  4EVC A;  5JDO A;  4LYX A;  4ISM A;  4PGK A;  3E2C A;  5FFE A;  4ML5 A;  4ZKX A;  4RC6 A;  3OGH A;  3GGZ A;  5AXS A;  3PW1 A;  3KHK A;  2FG4 A;  4MY7 A;  5J8W A;  2V2N A;  5FFD A;  4OYN A;  3AF9 X;  3RE7 A;  2Z90 A;  2VXX A;  4TOH A;  2OH3 A;  1MFR A;  4WJG 4;  3RD0 A;  3T9J A;  4ISP A;  1FHA A;  3BKN A;  4P18 A;  3PVT B;  3E1Q A;  3PVY A;  2F7N A;  1Z6O A;  3KA8 A;  5ERJ A;  3GVY A;  4XKT A;  1Z6O M;  2YW6 A;  4ITT A;  2V8T A;  5HJH A;  4A25 A;  1SOF A;  3DBY A;  4LPJ A;  3FSE A;  2V2L A;  3QVD A;  1VEQ A;  1VJX A;  2C2F A;  4E40 A;  2WTL A;  3WVU A;  5GU0 X;  4Z3B A;  5K52 A;  4M33 A;  3ES3 A;  4YVZ A;  4EVB A;  1BG7 A;  3QZ3 A;  1JYB A; 
#chains in the Genus database with same CATH homology
 4W4L B;  4DI0 A;  2V2M A;  5GU2 X;  3HL1 A;  3NP2 X;  5FFB A;  2XJO A;  2ZA7 A;  3MPS A;  1XZ3 A;  1HRS A;  4LYU A;  4REU A;  2GYQ A;  3FVB A;  4ZL5 A;  3KX9 A;  2RBD A;  5E2D A;  1JRE A;  4CVT A;  3AF7 X;  1DVB A;  2WWX B;  5C6F A;  4LQH A;  3PVR B;  3E6S A;  5JKM A;  4Z5S A;  3WNW A;  2X17 0;  4YXJ A;  4TOF A;  3IQ1 A;  4LQV A;  4EVD A;  2Y3Q A;  3KWO A;  1VEL A;  1UMN A;  3RGD A;  4DYU A;  4QUW A;  5LG8 A;  2FL0 A;  2BKC A;  1RCD A;  2FG8 A;  1JI5 A;  1Z4A A;  4CVS A;  3NOZ X;  4PGI A;  4EVE A;  3IS7 A;  2CWL A;  1BCF A;  3PWQ C;  1LB3 A;  3E1L A;  2V2O A;  4CVR A;  4CYB A;  3U90 A;  4ZKW A;  1AEW A;  3C1Z A;  1H96 A;  3UNO A;  5E1U A;  2YJJ A;  2AR0 A;  5IX6 A;  3SID A;  1JGC A;  2ZG8 X;  1B71 A;  3IS8 A;  3W54 A;  4DAS A;  1NNQ A;  1EUM A;  2FJC A;  3C23 A;  4E6K A;  1J30 A;  4ERU A;  2ZA8 A;  1JIG A;  3HIU A;  1SQ3 A;  4DYX A;  3E1M A;  1RCE A;  4LPM A;  2ITB A;  4XKU A;  4LPN A;  4TO9 A;  4TW3 A;  1QYB A;  2Z5P A;  5HQO A;  1IES A;  4TOA A;  3PVR A;  3C1Y A;  1JTS A;  2CHI A;  3O7R A;  3R2K A;  1JKU A;  3F38 A;  4PG1 A;  3ERZ A;  3ISE A;  3E1P A;  3KA4 A;  3KDQ A;  3PWQ A;  2IY4 A;  3BVE A;  4XGS A;  1MOJ A;  4ZL6 A;  2Z5Q A;  1N1Q A;  4MJY A;  1JI4 A;  4M32 A;  3O7S A;  3EZU A;  3UOI A;  5J8S A;  2Z5R A;  1TJO A;  5LS9 A;  4ITW A;  4LQJ A;  2V2J A;  1ZS3 A;  3Q4N A;  4CMY A;  2QQY A;  3F34 A;  3GHQ A;  5GU3 X;  4RC8 A;  2FHA A;  3OJ5 A;  4PG0 A;  5CZU A;  4M34 A;  3AF8 X;  1TK6 A;  4KVR A;  4YKH A;  2BW1 A;  2ZG9 X;  1L8I A;  4CYA A;  3FRR A;  2FZF A;  4RC5 B;  4DE6 A;  3QHC A;  3F33 A;  2ZA6 A;  1F30 A;  4ZTT A;  4TOC A;  1LKM A;  3AK9 A;  5LBH A;  3F37 A;  3Q4Q A;  2V2I A;  3R2H A;  1ZUJ A;  2D5K A;  2CN6 A;  2ZUR X;  3RBC A;  3BT5 A;  2CHP A;  3ISF A;  3PVT A;  4MUD A;  4TOG A;  5JKM G;  3A9Q A;  3C21 A;  5JKL G;  2CIH A;  3A68 A;  5JDO B;  1VLG A;  2UX1 A;  3R2S A;  2XKQ A;  5GU1 X;  3QHB A;  3AJO A;  4ZKH A;  3N6O A;  2IB0 A;  2QF9 A;  1DPS A;  4X0J A;  5D8Q A;  4DYY A;  4TOB A;  5D8R A;  3R2O A;  3KA6 A;  2FFX J;  3L0M A;  2PYB A;  2WLU A;  4U3G A;  3SH6 A;  5FEJ A;  2V2S A;  1O9R A;  1BFR A;  4TOD A;  4DZ0 A;  4ZLW A;  2FKZ A;  3WVW A;  4IWK A;  1R03 A;  2JD6 0;  4Y08 A;  1L8H A;  3JZ9 A;  4MKU A;  5J93 A;  4CVP A;  3R2R A;  1NF4 A;  2CF7 A;  2Z6M A;  4TOE A;  2BK6 A;  3JZA B;  2JD8 0;  4RC7 B;  3UFB A;  1JKV A;  2V2R A;  3R2L A;  3FRS A;  2Y44 A;  3H7G A;  5CMQ A;  2OKC A;  4DYZ A;  1VEI A;  1YUZ A;  3F35 A;  1GWG A;  3R2M A;  3V3K B;  3Q4O A;  4CY9 A;  5ERK A;  2WLA A;  4ZMC A;  2IU2 A;  5D8S A;  2V2P A;  1UVH A;  5D8Y A;  4II4 B;  1XZ1 A;  2C41 A;  3SE1 A;  2ZG7 X;  4KXR B;  3FI6 A;  2XGW A;  5CMR A;  2BJY A;  2CLU A;  2VXI A;  1RYT A;  3F36 A;  2YW7 A;  3KA3 A;  3AK8 A;  3PZA A;  5HJF A;  1IER A;  4XKS A;  5GOU A;  3NP0 X;  3BVI A;  1S3Q A;  3EZ0 A;  1TKP A;  4ETR A;  3WVV A;  2GYD A;  2MGY A;  5GN8 B;  2V15 A;  5FFC A;  5LG2 A;  1DAT A;  3GE4 A;  2YJK A;  1LKP A;  3E1J A;  4RC7 A;  3VNX A;  2JD7 0;  2W0O A;  1S2Z A;  3SHX A;  5FFA A;  1RCI A;  1NFV A;  2VZB A;  3LKD A;  5J9V A;  2XJM A;  3M6J A;  3PW8 C;  4W4K B;  4IWJ A;  4RC6 B;  5D8P A;  2HR5 A;  1RCC A;  4MN9 A;  4IXK A;  3BVF A;  2C2J A;  3Q4R A;  3KXU A;  3PW1 B;  5D8O A;  3UOF A;  1TKO A;  1NF6 A;  2V8U A;  5JKL A;  4KVQ A;  3D19 A;  1QGH A;  4II4 A;  5K53 A;  1LKO A;  4AM4 A;  4YXM A;  1OTK A;  1F33 A;  2C2U A;  2GS4 A;  4R42 A;  3PVY B;  2N02 A;  1RCG A;  2CN7 A;  1O9I A;  3TA8 A;  4ZJK A;  4LQN A;  3F39 A;  5D8X A;  3KA9 A;  2C6R A;  3BVL A;  2HTN A;  2CEI A;  3VVA A;  4CMY V;  5HU6 D;  4AM2 A;  2CLB A;  3QD8 A;  5GN8 A;  2OC5 A;  4KVS A;  1KRQ A;  4MXP A;  5I4J A;  4RC5 A;  1S30 A;  4M35 A;  3QB9 A;  3PWF A;  3VV9 A;  3AJQ A;  3PW8 A;  3RAV A;  2G4H A;  3E6R A;  1YUX A;  3E1N A;  4AM5 A;  1YV1 A;  3E1O A;  3BVK A;  3GGY A;  2XJN A;  3F32 A;  2G38 B;  5JAC A;  3EGM A;  3AJP A;  4EVC A;  5JDO A;  4LYX A;  4ISM A;  4PGK A;  3E2C A;  5FFE A;  4ML5 A;  4ZKX A;  4RC6 A;  3OGH A;  3GGZ A;  5AXS A;  3PW1 A;  3KHK A;  2FG4 A;  4MY7 A;  5J8W A;  2V2N A;  5FFD A;  4OYN A;  3AF9 X;  3RE7 A;  2Z90 A;  2VXX A;  4TOH A;  2OH3 A;  1MFR A;  4WJG 4;  3RD0 A;  3T9J A;  4ISP A;  1FHA A;  3BKN A;  4P18 A;  3PVT B;  3E1Q A;  3PVY A;  2F7N A;  1Z6O A;  3KA8 A;  5ERJ A;  3GVY A;  4XKT A;  1Z6O M;  2YW6 A;  4ITT A;  2V8T A;  5HJH A;  4A25 A;  1SOF A;  3DBY A;  4LPJ A;  3FSE A;  2V2L A;  3QVD A;  1VEQ A;  1VJX A;  2C2F A;  4E40 A;  2WTL A;  3WVU A;  5GU0 X;  4Z3B A;  5K52 A;  4M33 A;  3ES3 A;  4YVZ A;  4EVB A;  1BG7 A;  3QZ3 A;  1JYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...