4ZKHA

Crystal structure of the pmftn variant e44q soaked in iron (overnight)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
158
structure length
157
Chain Sequence
SEELLDLFNRQVTQEFTASQVYLSASIWFDQNDWEGMAAYMLAQSAEEREHGLGFVDFANKRNIPIELQAVPAPVSAEWSSPEDVWQSILELEQANTRSLLNLAEAASTCHDFAVMAFLNPFHLQQVNEEDKIGSILAKVTDENRTPGLLRSLDVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ferritin
publication title A Diatom Ferritin Optimized for Iron Oxidation but Not Iron Storage.
pubmed doi rcsb
source organism Pseudo-nitzschia multiseries
total genus 68
structure length 157
sequence length 158
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2015-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4zkhA00
4DYUA 1TJOA 3R2RA 5JKLA 1BG7A 4RC5B 2WLAA 4A25A 2V2IA 1RYTA 5D8SA 4U3GA 4TOHA 5CMQA 4ISMA 2JD80 3EZ0A 2C41A 3E6SA 4CVSA 3E1OA 2IB0A 3Q4QA 4XKTA 2ZG8X 1RCEA 2WLUA 3KWOA 3RAVA 5GU0X 4KVRA 4TO9A 4KVSA 4ZL5A 3A9QA 4CYAA 4DYZA 1MOJA 4LQHA 3R2SA 3WVUA 1JGCA 4TOGA 4ZTTA 4CMYV 1ZUJA 1BCFA 1JREA 3U90A 2FJCA 4ITWA 3NP2X 4RC8A 1LKMA 1YUXA 2C6RA 4PG1A 2CLBA 1AEWA 4CMYA 3PVYB 3E1JA 3FI6A 2ZA8A 3KA8A 1YUZA 4RC6A 5HJFA 3BKNA 3E1QA 5GU1X 3OGHA 3HIUA 1JKVA 4EVEA 5J8WA 4LPNA 1DATA 2CEIA 2C2UA 2V2NA 2XJOA 3F37A 3PVRA 3KA9A 5J9VA 3QZ3A 5D8XA 3R2KA 2W0OA 4DYYA 4REUA 4DZ0A 3KXUA 1F33A 3AF8X 3PWQC 2V2PA 3E1MA 1UVHA 2VZBA 5IX6A 3AJPA 4LPMA 2VXIA 1TKPA 3FSEA 4ITTA 4PGKA 2FL0A 4M35A 3PZAA 1HRSA 3WVWA 2Y3QA 3ISEA 5E2DA 2HR5A 4M33A 5FFEA 2V2LA 1SOFA 5FFAA 1Z4AA 3EZUA 4LQJA 1DVBA 2XJNA 3F33A 5JKMA 5I4JA 2GS4A 4TODA 1VELA 4II4A 5GU2X 3VNXA 2ZURX 2Z5PA 1NFVA 5D8RA 5GN8A 1O9IA 4ZKXA 3KX9A 3Q4OA 2Z6MA 5D8OA 4OYNA 2JD70 2CN6A 1KRQA 4MJYA 3AJOA 3PW1A 2ITBA 4QUWA 3GVYA 1O9RA 2GYDA 2ZG9X 2YJJA 4Z5SA 3Q4RA 3RGDA 5K52A 3E2CA 1L8IA 3BVEA 2Z90A 3AF9X 3QHBA 4AM4A 2YJKA 3BVFA 1S3QA 3WNWA 4CVTA 4CYBA 4DE6A 2ZA6A 5GOUA 1IESA 5LBHA 2BJYA 3BVKA 3OJ5A 2XGWA 2CLUA 3IS8A 3EGMA 2FG4A 4MKUA 3SIDA 3UOFA 3KA6A 4TW3A 1JIGA 1DPSA 3KA4A 4R42A 1LKOA 4Y08A 4LYUA 3PW8A 4P18A 3PVTB 4YKHA 3ISFA 3SHXA 4EVBA 3PVYA 5FFCA 2BK6A 3F38A 4EVDA 4TOEA 4TOAA 2Z5RA 5FFBA 4DYXA 2BKCA 3NOZX 4PGIA 3R2MA 2ZG7X 1L8HA 1VJXA 2V15A 2V2MA 1LKPA 2WTLA 5HJHA 2IY4A 4IWJA 3RD0A 3NP0X 3PWFA 3F35A 3F32A 1JI5A 3RE7A 4M32A 3BVLA 1QGHA 5LG2A 5CMRA 4CVRA 5C6FA 4ZJKA 1J30A 3IS7A 3TA8A 2X170 1ZS3A 2YW7A 1RCGA 3E1PA 3F34A 1JYBA 3MPSA 3ERZA 4XKUA 4MY7A 2CF7A 2BW1A 3O7RA 3SE1A 2CHIA 2RBDA 2XJMA 3HL1A 4Z3BA 4IXKA 2C2JA 2GYQA 4MN9A 4RC7B 1EUMA 2CHPA 1JKUA 3QB9A 3UNOA 3UOIA 1VEQA 5ERJA 1F30A 2JD60 5GN8B 3RBCA 1IERA 4IWKA 4M34A 3R2LA 3QVDA 5E1UA 3QD8A 2CN7A 4ZMCA 5JKLG 1JTSA 1NF6A 2QQYA 5J8SA 1RCIA 4LPJA 1H96A 1XZ1A 1YV1A 3AJQA 5J93A 4ZKWA 4RC5A 4DI0A 2V2OA 3F36A 4TOCA 2C2FA 2QF9A 1TK6A 4ML5A 4DASA 2FHAA 3QHCA 1Z6OA 3FVBA 4LYXA 4ZLWA 1GWGA 3AK9A 1RCCA 2OC5A 1B71A 3Q4NA 5LG8A 4CVPA 5GU3X 2FG8A 4RC6B 4TOFA 5CZUA 2F7NA 2FZFA 5K53A 2IU2A 4ETRA 2ZA7A 2CIHA 3ES3A 3PW8C 4ERUA 2G4HA 1VLGA 4PG0A 2OH3A 3E6RA 4EVCA 1XZ3A 1VEIA 2HTNA 3AF7X 3BVIA 3KA3A 1S2ZA 3F39A 3PVRB 2V2RA 2FKZA 5D8YA 1SQ3A 3R2OA 2D5KA 1LB3A 2XKQA 5FFDA 4E6KA 5HQOA 2V2JA 4ZL6A 4CY9A 3T9JA 3BT5A 1FHAA 2FFXJ 2VXXA 4LQNA 1JI4A 3O7SA 3PVTA 4LQVA 5LS9A 1RCDA 1OTKA 2V2SA 1R03A 2Z5QA 3WVVA 1UMNA 4AM5A 4MUDA 3IQ1A 5D8PA 3H7GA 3PWQA 3GHQA 1MFRA 4KVQA 1BFRA 3A68A 1QYBA 3E1NA 4ZKHA 1TKOA 4II4B 2PYBA 1Z6OM 5D8QA 4ISPA 5AXSA 4TOBA 3E1LA 5JKMG 5ERKA 4XKSA 3AK8A 1N1QA 2UX1A 1NNQA 3GE4A 3SH6A 1S30A 5FEJA 5JACA 3PW1B 2YW6A 4AM2A 3R2HA 4XGSA 4RC7A 1NF4A
chains in the Genus database with same CATH superfamily
4DYUA 3L0MA 1TJOA 3R2RA 5JKLA 1BG7A 4RC5B 2WLAA 4A25A 2V2IA 1RYTA 3JZAB 5D8SA 4U3GA 3VVAA 4TOHA 5CMQA 4ISMA 2JD80 3EZ0A 2C41A 3E6SA 4CVSA 3E1OA 2IB0A 3Q4QA 4XKTA 2ZG8X 3KDQA 1RCEA 2WLUA 3KWOA 3RAVA 5GU0X 3C1ZA 4KVRA 4TO9A 4KVSA 4ZL5A 3A9QA 2V8TA 4CYAA 4DYZA 1MOJA 2G38B 4LQHA 3R2SA 3WVUA 1JGCA 4TOGA 4ZTTA 4CMYV 1ZUJA 1BCFA 1JREA 3U90A 2FJCA 4ITWA 3NP2X 4RC8A 1LKMA 1YUXA 2C6RA 4PG1A 2CLBA 1AEWA 4CMYA 3PVYB 3E1JA 3FI6A 4X0JA 2ZA8A 3KA8A 1YUZA 4RC6A 5HJFA 3BKNA 3E1QA 5GU1X 3OGHA 3HIUA 1JKVA 4EVEA 5J8WA 4LPNA 4MXPA 1DATA 2CEIA 2C2UA 2V2NA 2XJOA 3F37A 3PVRA 3KA9A 5JDOA 5J9VA 3QZ3A 5D8XA 3R2KA 2W0OA 4DYYA 3C23A 4REUA 4DZ0A 3KXUA 1F33A 3AF8X 3PWQC 2V2PA 3E1MA 1UVHA 2VZBA 5IX6A 3FRRA 3AJPA 4LPMA 2VXIA 1TKPA 3FSEA 4ITTA 4PGKA 3JZ9A 2FL0A 4M35A 3PZAA 1HRSA 3WVWA 2Y3QA 3ISEA 5E2DA 2HR5A 4M33A 5FFEA 2V2LA 1SOFA 5FFAA 1Z4AA 3EZUA 4LQJA 1DVBA 2XJNA 3F33A 5JKMA 5I4JA 2GS4A 4TODA 1VELA 4II4A 5GU2X 3DBYA 3UFBA 3VNXA 2ZURX 2Z5PA 1NFVA 5D8RA 5GN8A 1O9IA 4ZKXA 3KX9A 3Q4OA 2Z6MA 5D8OA 4OYNA 2JD70 2CN6A 1KRQA 4MJYA 3AJOA 3PW1A 2ITBA 4QUWA 3GVYA 1O9RA 2GYDA 2ZG9X 2YJJA 3KHKA 4Z5SA 3Q4RA 3RGDA 5K52A 3E2CA 1L8IA 3BVEA 2CWLA 2Z90A 3AF9X 3QHBA 4AM4A 2YJKA 3C1YA 3BVFA 1S3QA 5HU6D 3WNWA 4CVTA 4CYBA 4DE6A 2ZA6A 5GOUA 1IESA 5LBHA 2BJYA 3BVKA 3OJ5A 2XGWA 2CLUA 3IS8A 3EGMA 2FG4A 4MKUA 3SIDA 3UOFA 3KA6A 4TW3A 1JIGA 1DPSA 3KA4A 4R42A 1LKOA 4Y08A 4LYUA 3PW8A 4P18A 3PVTB 4YKHA 3ISFA 3SHXA 2WWXB 3GGZA 3PVYA 4EVBA 5FFCA 2BK6A 3F38A 4EVDA 4TOEA 4TOAA 2Z5RA 5FFBA 4DYXA 2BKCA 3NOZX 4PGIA 3R2MA 4E40A 2Y44A 2ZG7X 1L8HA 1VJXA 2V15A 2V2MA 1LKPA 2WTLA 5HJHA 2IY4A 4IWJA 4WJG4 3RD0A 3NP0X 3PWFA 3F35A 3F32A 1JI5A 3RE7A 4M32A 3C21A 3BVLA 1QGHA 3GGYA 5LG2A 3V3KB 5CMRA 4CVRA 5C6FA 4ZJKA 1J30A 4W4KB 3IS7A 3TA8A 2X170 1ZS3A 2YW7A 1RCGA 3E1PA 3F34A 1JYBA 3MPSA 3ERZA 4XKUA 4MY7A 2CF7A 2BW1A 3O7RA 3SE1A 2CHIA 2RBDA 2XJMA 3HL1A 4YVZA 4Z3BA 4IXKA 2C2JA 2GYQA 4MN9A 4RC7B 1EUMA 2CHPA 1JKUA 3QB9A 3UNOA 3UOIA 1VEQA 5ERJA 1F30A 2JD60 5GN8B 3RBCA 1IERA 4IWKA 4M34A 3R2LA 3QVDA 5E1UA 3QD8A 2CN7A 4ZMCA 5JKLG 1JTSA 1NF6A 2QQYA 5J8SA 1RCIA 4LPJA 1H96A 1XZ1A 1YV1A 3AJQA 5J93A 3FRSA 4ZKWA 4RC5A 4DI0A 2V2OA 3F36A 4TOCA 3VV9A 2C2FA 2QF9A 1TK6A 4ML5A 4DASA 4YXJA 2FHAA 3QHCA 1Z6OA 3FVBA 4LYXA 4ZLWA 2OKCA 1GWGA 3AK9A 1RCCA 3LKDA 2OC5A 1B71A 3Q4NA 5LG8A 4CVPA 5GU3X 2FG8A 4RC6B 4TOFA 5CZUA 2F7NA 2FZFA 5K53A 2IU2A 4ETRA 2ZA7A 2CIHA 3ES3A 4W4LB 2MGYA 3PW8C 4ERUA 2G4HA 1VLGA 4PG0A 3M6JA 2OH3A 3W54A 3E6RA 4EVCA 1XZ3A 1VEIA 2HTNA 3AF7X 3BVIA 3KA3A 1S2ZA 3F39A 3PVRB 2V2RA 5JDOB 2FKZA 5D8YA 1SQ3A 3R2OA 2D5KA 1LB3A 3D19A 2XKQA 5FFDA 4E6KA 5HQOA 2V2JA 4ZL6A 4CY9A 3T9JA 3BT5A 1FHAA 2FFXJ 2VXXA 4LQNA 1JI4A 3O7SA 3PVTA 2AR0A 4LQVA 5LS9A 1RCDA 1OTKA 2V2SA 1R03A 2Z5QA 3WVVA 1UMNA 4AM5A 4MUDA 3IQ1A 5D8PA 3H7GA 3PWQA 3GHQA 1MFRA 4KVQA 1BFRA 3A68A 1QYBA 3E1NA 4ZKHA 1TKOA 4II4B 2PYBA 1Z6OM 5D8QA 4ISPA 4YXMA 5AXSA 2N02A 4TOBA 3E1LA 5JKMG 5ERKA 4XKSA 3AK8A 1N1QA 2UX1A 1NNQA 3GE4A 2V8UA 3N6OA 4KXRB 3SH6A 1S30A 5FEJA 5JACA 3PW1B 2YW6A 4AM2A 3R2HA 4XGSA 4RC7A 1NF4A
chains in the Genus database with same CATH topology
4DYUA 3L0MA 1TJOA 3R2RA 5JKLA 1BG7A 4RC5B 2WLAA 4A25A 2V2IA 1RYTA 3JZAB 5D8SA 4U3GA 3VVAA 4TOHA 5CMQA 4ISMA 2JD80 3EZ0A 2C41A 3E6SA 4CVSA 3E1OA 2IB0A 3Q4QA 4XKTA 2ZG8X 3KDQA 1RCEA 2WLUA 3KWOA 3RAVA 5GU0X 3C1ZA 4KVRA 4TO9A 4KVSA 4ZL5A 3A9QA 2V8TA 4CYAA 4DYZA 1MOJA 2G38B 4LQHA 3R2SA 3WVUA 1JGCA 4TOGA 4ZTTA 4CMYV 1ZUJA 1BCFA 1JREA 3U90A 2FJCA 4ITWA 3NP2X 4RC8A 1LKMA 1YUXA 2C6RA 4PG1A 2CLBA 1AEWA 4CMYA 3PVYB 3E1JA 3FI6A 4X0JA 2ZA8A 3KA8A 1YUZA 4RC6A 5HJFA 3BKNA 3E1QA 5GU1X 3OGHA 3HIUA 1JKVA 4EVEA 5J8WA 4LPNA 4MXPA 1DATA 2CEIA 2C2UA 2V2NA 2XJOA 3F37A 3PVRA 3KA9A 5JDOA 5J9VA 3QZ3A 5D8XA 3R2KA 2W0OA 4DYYA 3C23A 4REUA 4DZ0A 3KXUA 1F33A 3AF8X 3PWQC 2V2PA 3E1MA 1UVHA 2VZBA 5IX6A 3FRRA 3AJPA 4LPMA 2VXIA 1TKPA 3FSEA 4ITTA 4PGKA 3JZ9A 2FL0A 4M35A 3PZAA 1HRSA 3WVWA 2Y3QA 3ISEA 5E2DA 2HR5A 4M33A 5FFEA 2V2LA 1SOFA 5FFAA 1Z4AA 3EZUA 4LQJA 1DVBA 2XJNA 3F33A 5JKMA 5I4JA 2GS4A 4TODA 1VELA 4II4A 5GU2X 3DBYA 3UFBA 3VNXA 2ZURX 2Z5PA 1NFVA 5D8RA 5GN8A 1O9IA 4ZKXA 3KX9A 3Q4OA 2Z6MA 5D8OA 4OYNA 2JD70 2CN6A 1KRQA 4MJYA 3AJOA 3PW1A 2ITBA 4QUWA 3GVYA 1O9RA 2GYDA 2ZG9X 2YJJA 3KHKA 4Z5SA 3Q4RA 3RGDA 5K52A 3E2CA 1L8IA 3BVEA 2CWLA 2Z90A 3AF9X 3QHBA 4AM4A 2YJKA 3C1YA 3BVFA 1S3QA 5HU6D 3WNWA 4CVTA 4CYBA 4DE6A 2ZA6A 5GOUA 1IESA 5LBHA 2BJYA 3BVKA 3OJ5A 2XGWA 2CLUA 3IS8A 3EGMA 2FG4A 4MKUA 3SIDA 3UOFA 3KA6A 4TW3A 1JIGA 1DPSA 3KA4A 4R42A 1LKOA 4Y08A 4LYUA 3PW8A 4P18A 3PVTB 4YKHA 3ISFA 3SHXA 2WWXB 3GGZA 3PVYA 4EVBA 5FFCA 2BK6A 3F38A 4EVDA 4TOEA 4TOAA 2Z5RA 5FFBA 4DYXA 2BKCA 3NOZX 4PGIA 3R2MA 4E40A 2Y44A 2ZG7X 1L8HA 1VJXA 2V15A 2V2MA 1LKPA 2WTLA 5HJHA 2IY4A 4IWJA 4WJG4 3RD0A 3NP0X 3PWFA 3F35A 3F32A 1JI5A 3RE7A 4M32A 3C21A 3BVLA 1QGHA 3GGYA 5LG2A 3V3KB 5CMRA 4CVRA 5C6FA 4ZJKA 1J30A 4W4KB 3IS7A 3TA8A 2X170 1ZS3A 2YW7A 1RCGA 3E1PA 3F34A 1JYBA 3MPSA 3ERZA 4XKUA 4MY7A 2CF7A 2BW1A 3O7RA 3SE1A 2CHIA 2RBDA 2XJMA 3HL1A 4YVZA 4Z3BA 4IXKA 2C2JA 2GYQA 4MN9A 4RC7B 1EUMA 2CHPA 1JKUA 3QB9A 3UNOA 3UOIA 1VEQA 5ERJA 1F30A 2JD60 5GN8B 3RBCA 1IERA 4IWKA 4M34A 3R2LA 3QVDA 5E1UA 3QD8A 2CN7A 4ZMCA 5JKLG 1JTSA 1NF6A 2QQYA 5J8SA 1RCIA 4LPJA 1H96A 1XZ1A 1YV1A 3AJQA 5J93A 3FRSA 4ZKWA 4RC5A 4DI0A 2V2OA 3F36A 4TOCA 3VV9A 2C2FA 2QF9A 1TK6A 4ML5A 4DASA 4YXJA 2FHAA 3QHCA 1Z6OA 3FVBA 4LYXA 4ZLWA 2OKCA 1GWGA 3AK9A 1RCCA 3LKDA 2OC5A 1B71A 3Q4NA 5LG8A 4CVPA 5GU3X 2FG8A 4RC6B 4TOFA 5CZUA 2F7NA 2FZFA 5K53A 2IU2A 4ETRA 2ZA7A 2CIHA 3ES3A 4W4LB 2MGYA 3PW8C 4ERUA 2G4HA 1VLGA 4PG0A 3M6JA 2OH3A 3W54A 3E6RA 4EVCA 1XZ3A 1VEIA 2HTNA 3AF7X 3BVIA 3KA3A 1S2ZA 3F39A 3PVRB 2V2RA 5JDOB 2FKZA 5D8YA 1SQ3A 3R2OA 2D5KA 1LB3A 3D19A 2XKQA 5FFDA 4E6KA 5HQOA 2V2JA 4ZL6A 4CY9A 3T9JA 3BT5A 1FHAA 2FFXJ 2VXXA 4LQNA 1JI4A 3O7SA 3PVTA 2AR0A 4LQVA 5LS9A 1RCDA 1OTKA 2V2SA 1R03A 2Z5QA 3WVVA 1UMNA 4AM5A 4MUDA 3IQ1A 5D8PA 3H7GA 3PWQA 3GHQA 1MFRA 4KVQA 1BFRA 3A68A 1QYBA 3E1NA 4ZKHA 1TKOA 4II4B 2PYBA 1Z6OM 5D8QA 4ISPA 4YXMA 5AXSA 2N02A 4TOBA 3E1LA 5JKMG 5ERKA 4XKSA 3AK8A 1N1QA 2UX1A 1NNQA 3GE4A 2V8UA 3N6OA 4KXRB 3SH6A 1S30A 5FEJA 5JACA 3PW1B 2YW6A 4AM2A 3R2HA 4XGSA 4RC7A 1NF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DYU A;  1TJO A;  3R2R A;  5JKL A;  1BG7 A;  4RC5 B;  2WLA A;  4A25 A;  2V2I A;  1RYT A;  5D8S A;  4U3G A;  4TOH A;  5CMQ A;  4ISM A;  2JD8 0;  3EZ0 A;  2C41 A;  3E6S A;  4CVS A;  3E1O A;  2IB0 A;  3Q4Q A;  4XKT A;  2ZG8 X;  1RCE A;  2WLU A;  3KWO A;  3RAV A;  5GU0 X;  4KVR A;  4TO9 A;  4KVS A;  4ZL5 A;  3A9Q A;  4CYA A;  4DYZ A;  1MOJ A;  4LQH A;  3R2S A;  3WVU A;  1JGC A;  4TOG A;  4ZTT A;  4CMY V;  1ZUJ A;  1BCF A;  1JRE A;  3U90 A;  2FJC A;  4ITW A;  3NP2 X;  4RC8 A;  1LKM A;  1YUX A;  2C6R A;  4PG1 A;  2CLB A;  1AEW A;  4CMY A;  3PVY B;  3E1J A;  3FI6 A;  2ZA8 A;  3KA8 A;  1YUZ A;  4RC6 A;  5HJF A;  3BKN A;  3E1Q A;  5GU1 X;  3OGH A;  3HIU A;  1JKV A;  4EVE A;  5J8W A;  4LPN A;  1DAT A;  2CEI A;  2C2U A;  2V2N A;  2XJO A;  3F37 A;  3PVR A;  3KA9 A;  5J9V A;  3QZ3 A;  5D8X A;  3R2K A;  2W0O A;  4DYY A;  4REU A;  4DZ0 A;  3KXU A;  1F33 A;  3AF8 X;  3PWQ C;  2V2P A;  3E1M A;  1UVH A;  2VZB A;  5IX6 A;  3AJP A;  4LPM A;  2VXI A;  1TKP A;  3FSE A;  4ITT A;  4PGK A;  2FL0 A;  4M35 A;  3PZA A;  1HRS A;  3WVW A;  2Y3Q A;  3ISE A;  5E2D A;  2HR5 A;  4M33 A;  5FFE A;  2V2L A;  1SOF A;  5FFA A;  1Z4A A;  3EZU A;  4LQJ A;  1DVB A;  2XJN A;  3F33 A;  5JKM A;  5I4J A;  2GS4 A;  4TOD A;  1VEL A;  4II4 A;  5GU2 X;  3VNX A;  2ZUR X;  2Z5P A;  1NFV A;  5D8R A;  5GN8 A;  1O9I A;  4ZKX A;  3KX9 A;  3Q4O A;  2Z6M A;  5D8O A;  4OYN A;  2JD7 0;  2CN6 A;  1KRQ A;  4MJY A;  3AJO A;  3PW1 A;  2ITB A;  4QUW A;  3GVY A;  1O9R A;  2GYD A;  2ZG9 X;  2YJJ A;  4Z5S A;  3Q4R A;  3RGD A;  5K52 A;  3E2C A;  1L8I A;  3BVE A;  2Z90 A;  3AF9 X;  3QHB A;  4AM4 A;  2YJK A;  3BVF A;  1S3Q A;  3WNW A;  4CVT A;  4CYB A;  4DE6 A;  2ZA6 A;  5GOU A;  1IES A;  5LBH A;  2BJY A;  3BVK A;  3OJ5 A;  2XGW A;  2CLU A;  3IS8 A;  3EGM A;  2FG4 A;  4MKU A;  3SID A;  3UOF A;  3KA6 A;  4TW3 A;  1JIG A;  1DPS A;  3KA4 A;  4R42 A;  1LKO A;  4Y08 A;  4LYU A;  3PW8 A;  4P18 A;  3PVT B;  4YKH A;  3ISF A;  3SHX A;  4EVB A;  3PVY A;  5FFC A;  2BK6 A;  3F38 A;  4EVD A;  4TOE A;  4TOA A;  2Z5R A;  5FFB A;  4DYX A;  2BKC A;  3NOZ X;  4PGI A;  3R2M A;  2ZG7 X;  1L8H A;  1VJX A;  2V15 A;  2V2M A;  1LKP A;  2WTL A;  5HJH A;  2IY4 A;  4IWJ A;  3RD0 A;  3NP0 X;  3PWF A;  3F35 A;  3F32 A;  1JI5 A;  3RE7 A;  4M32 A;  3BVL A;  1QGH A;  5LG2 A;  5CMR A;  4CVR A;  5C6F A;  4ZJK A;  1J30 A;  3IS7 A;  3TA8 A;  2X17 0;  1ZS3 A;  2YW7 A;  1RCG A;  3E1P A;  3F34 A;  1JYB A;  3MPS A;  3ERZ A;  4XKU A;  4MY7 A;  2CF7 A;  2BW1 A;  3O7R A;  3SE1 A;  2CHI A;  2RBD A;  2XJM A;  3HL1 A;  4Z3B A;  4IXK A;  2C2J A;  2GYQ A;  4MN9 A;  4RC7 B;  1EUM A;  2CHP A;  1JKU A;  3QB9 A;  3UNO A;  3UOI A;  1VEQ A;  5ERJ A;  1F30 A;  2JD6 0;  5GN8 B;  3RBC A;  1IER A;  4IWK A;  4M34 A;  3R2L A;  3QVD A;  5E1U A;  3QD8 A;  2CN7 A;  4ZMC A;  5JKL G;  1JTS A;  1NF6 A;  2QQY A;  5J8S A;  1RCI A;  4LPJ A;  1H96 A;  1XZ1 A;  1YV1 A;  3AJQ A;  5J93 A;  4ZKW A;  4RC5 A;  4DI0 A;  2V2O A;  3F36 A;  4TOC A;  2C2F A;  2QF9 A;  1TK6 A;  4ML5 A;  4DAS A;  2FHA A;  3QHC A;  1Z6O A;  3FVB A;  4LYX A;  4ZLW A;  1GWG A;  3AK9 A;  1RCC A;  2OC5 A;  1B71 A;  3Q4N A;  5LG8 A;  4CVP A;  5GU3 X;  2FG8 A;  4RC6 B;  4TOF A;  5CZU A;  2F7N A;  2FZF A;  5K53 A;  2IU2 A;  4ETR A;  2ZA7 A;  2CIH A;  3ES3 A;  3PW8 C;  4ERU A;  2G4H A;  1VLG A;  4PG0 A;  2OH3 A;  3E6R A;  4EVC A;  1XZ3 A;  1VEI A;  2HTN A;  3AF7 X;  3BVI A;  3KA3 A;  1S2Z A;  3F39 A;  3PVR B;  2V2R A;  2FKZ A;  5D8Y A;  1SQ3 A;  3R2O A;  2D5K A;  1LB3 A;  2XKQ A;  5FFD A;  4E6K A;  5HQO A;  2V2J A;  4ZL6 A;  4CY9 A;  3T9J A;  3BT5 A;  1FHA A;  2FFX J;  2VXX A;  4LQN A;  1JI4 A;  3O7S A;  3PVT A;  4LQV A;  5LS9 A;  1RCD A;  1OTK A;  2V2S A;  1R03 A;  2Z5Q A;  3WVV A;  1UMN A;  4AM5 A;  4MUD A;  3IQ1 A;  5D8P A;  3H7G A;  3PWQ A;  3GHQ A;  1MFR A;  4KVQ A;  1BFR A;  3A68 A;  1QYB A;  3E1N A;  4ZKH A;  1TKO A;  4II4 B;  2PYB A;  1Z6O M;  5D8Q A;  4ISP A;  5AXS A;  4TOB A;  3E1L A;  5JKM G;  5ERK A;  4XKS A;  3AK8 A;  1N1Q A;  2UX1 A;  1NNQ A;  3GE4 A;  3SH6 A;  1S30 A;  5FEJ A;  5JAC A;  3PW1 B;  2YW6 A;  4AM2 A;  3R2H A;  4XGS A;  4RC7 A;  1NF4 A; 
#chains in the Genus database with same CATH topology
 4DYU A;  3L0M A;  1TJO A;  3R2R A;  5JKL A;  1BG7 A;  4RC5 B;  2WLA A;  4A25 A;  2V2I A;  1RYT A;  3JZA B;  5D8S A;  4U3G A;  3VVA A;  4TOH A;  5CMQ A;  4ISM A;  2JD8 0;  3EZ0 A;  2C41 A;  3E6S A;  4CVS A;  3E1O A;  2IB0 A;  3Q4Q A;  4XKT A;  2ZG8 X;  3KDQ A;  1RCE A;  2WLU A;  3KWO A;  3RAV A;  5GU0 X;  3C1Z A;  4KVR A;  4TO9 A;  4KVS A;  4ZL5 A;  3A9Q A;  2V8T A;  4CYA A;  4DYZ A;  1MOJ A;  2G38 B;  4LQH A;  3R2S A;  3WVU A;  1JGC A;  4TOG A;  4ZTT A;  4CMY V;  1ZUJ A;  1BCF A;  1JRE A;  3U90 A;  2FJC A;  4ITW A;  3NP2 X;  4RC8 A;  1LKM A;  1YUX A;  2C6R A;  4PG1 A;  2CLB A;  1AEW A;  4CMY A;  3PVY B;  3E1J A;  3FI6 A;  4X0J A;  2ZA8 A;  3KA8 A;  1YUZ A;  4RC6 A;  5HJF A;  3BKN A;  3E1Q A;  5GU1 X;  3OGH A;  3HIU A;  1JKV A;  4EVE A;  5J8W A;  4LPN A;  4MXP A;  1DAT A;  2CEI A;  2C2U A;  2V2N A;  2XJO A;  3F37 A;  3PVR A;  3KA9 A;  5JDO A;  5J9V A;  3QZ3 A;  5D8X A;  3R2K A;  2W0O A;  4DYY A;  3C23 A;  4REU A;  4DZ0 A;  3KXU A;  1F33 A;  3AF8 X;  3PWQ C;  2V2P A;  3E1M A;  1UVH A;  2VZB A;  5IX6 A;  3FRR A;  3AJP A;  4LPM A;  2VXI A;  1TKP A;  3FSE A;  4ITT A;  4PGK A;  3JZ9 A;  2FL0 A;  4M35 A;  3PZA A;  1HRS A;  3WVW A;  2Y3Q A;  3ISE A;  5E2D A;  2HR5 A;  4M33 A;  5FFE A;  2V2L A;  1SOF A;  5FFA A;  1Z4A A;  3EZU A;  4LQJ A;  1DVB A;  2XJN A;  3F33 A;  5JKM A;  5I4J A;  2GS4 A;  4TOD A;  1VEL A;  4II4 A;  5GU2 X;  3DBY A;  3UFB A;  3VNX A;  2ZUR X;  2Z5P A;  1NFV A;  5D8R A;  5GN8 A;  1O9I A;  4ZKX A;  3KX9 A;  3Q4O A;  2Z6M A;  5D8O A;  4OYN A;  2JD7 0;  2CN6 A;  1KRQ A;  4MJY A;  3AJO A;  3PW1 A;  2ITB A;  4QUW A;  3GVY A;  1O9R A;  2GYD A;  2ZG9 X;  2YJJ A;  3KHK A;  4Z5S A;  3Q4R A;  3RGD A;  5K52 A;  3E2C A;  1L8I A;  3BVE A;  2CWL A;  2Z90 A;  3AF9 X;  3QHB A;  4AM4 A;  2YJK A;  3C1Y A;  3BVF A;  1S3Q A;  5HU6 D;  3WNW A;  4CVT A;  4CYB A;  4DE6 A;  2ZA6 A;  5GOU A;  1IES A;  5LBH A;  2BJY A;  3BVK A;  3OJ5 A;  2XGW A;  2CLU A;  3IS8 A;  3EGM A;  2FG4 A;  4MKU A;  3SID A;  3UOF A;  3KA6 A;  4TW3 A;  1JIG A;  1DPS A;  3KA4 A;  4R42 A;  1LKO A;  4Y08 A;  4LYU A;  3PW8 A;  4P18 A;  3PVT B;  4YKH A;  3ISF A;  3SHX A;  2WWX B;  3GGZ A;  3PVY A;  4EVB A;  5FFC A;  2BK6 A;  3F38 A;  4EVD A;  4TOE A;  4TOA A;  2Z5R A;  5FFB A;  4DYX A;  2BKC A;  3NOZ X;  4PGI A;  3R2M A;  4E40 A;  2Y44 A;  2ZG7 X;  1L8H A;  1VJX A;  2V15 A;  2V2M A;  1LKP A;  2WTL A;  5HJH A;  2IY4 A;  4IWJ A;  4WJG 4;  3RD0 A;  3NP0 X;  3PWF A;  3F35 A;  3F32 A;  1JI5 A;  3RE7 A;  4M32 A;  3C21 A;  3BVL A;  1QGH A;  3GGY A;  5LG2 A;  3V3K B;  5CMR A;  4CVR A;  5C6F A;  4ZJK A;  1J30 A;  4W4K B;  3IS7 A;  3TA8 A;  2X17 0;  1ZS3 A;  2YW7 A;  1RCG A;  3E1P A;  3F34 A;  1JYB A;  3MPS A;  3ERZ A;  4XKU A;  4MY7 A;  2CF7 A;  2BW1 A;  3O7R A;  3SE1 A;  2CHI A;  2RBD A;  2XJM A;  3HL1 A;  4YVZ A;  4Z3B A;  4IXK A;  2C2J A;  2GYQ A;  4MN9 A;  4RC7 B;  1EUM A;  2CHP A;  1JKU A;  3QB9 A;  3UNO A;  3UOI A;  1VEQ A;  5ERJ A;  1F30 A;  2JD6 0;  5GN8 B;  3RBC A;  1IER A;  4IWK A;  4M34 A;  3R2L A;  3QVD A;  5E1U A;  3QD8 A;  2CN7 A;  4ZMC A;  5JKL G;  1JTS A;  1NF6 A;  2QQY A;  5J8S A;  1RCI A;  4LPJ A;  1H96 A;  1XZ1 A;  1YV1 A;  3AJQ A;  5J93 A;  3FRS A;  4ZKW A;  4RC5 A;  4DI0 A;  2V2O A;  3F36 A;  4TOC A;  3VV9 A;  2C2F A;  2QF9 A;  1TK6 A;  4ML5 A;  4DAS A;  4YXJ A;  2FHA A;  3QHC A;  1Z6O A;  3FVB A;  4LYX A;  4ZLW A;  2OKC A;  1GWG A;  3AK9 A;  1RCC A;  3LKD A;  2OC5 A;  1B71 A;  3Q4N A;  5LG8 A;  4CVP A;  5GU3 X;  2FG8 A;  4RC6 B;  4TOF A;  5CZU A;  2F7N A;  2FZF A;  5K53 A;  2IU2 A;  4ETR A;  2ZA7 A;  2CIH A;  3ES3 A;  4W4L B;  2MGY A;  3PW8 C;  4ERU A;  2G4H A;  1VLG A;  4PG0 A;  3M6J A;  2OH3 A;  3W54 A;  3E6R A;  4EVC A;  1XZ3 A;  1VEI A;  2HTN A;  3AF7 X;  3BVI A;  3KA3 A;  1S2Z A;  3F39 A;  3PVR B;  2V2R A;  5JDO B;  2FKZ A;  5D8Y A;  1SQ3 A;  3R2O A;  2D5K A;  1LB3 A;  3D19 A;  2XKQ A;  5FFD A;  4E6K A;  5HQO A;  2V2J A;  4ZL6 A;  4CY9 A;  3T9J A;  3BT5 A;  1FHA A;  2FFX J;  2VXX A;  4LQN A;  1JI4 A;  3O7S A;  3PVT A;  2AR0 A;  4LQV A;  5LS9 A;  1RCD A;  1OTK A;  2V2S A;  1R03 A;  2Z5Q A;  3WVV A;  1UMN A;  4AM5 A;  4MUD A;  3IQ1 A;  5D8P A;  3H7G A;  3PWQ A;  3GHQ A;  1MFR A;  4KVQ A;  1BFR A;  3A68 A;  1QYB A;  3E1N A;  4ZKH A;  1TKO A;  4II4 B;  2PYB A;  1Z6O M;  5D8Q A;  4ISP A;  4YXM A;  5AXS A;  2N02 A;  4TOB A;  3E1L A;  5JKM G;  5ERK A;  4XKS A;  3AK8 A;  1N1Q A;  2UX1 A;  1NNQ A;  3GE4 A;  2V8U A;  3N6O A;  4KXR B;  3SH6 A;  1S30 A;  5FEJ A;  5JAC A;  3PW1 B;  2YW6 A;  4AM2 A;  3R2H A;  4XGS A;  4RC7 A;  1NF4 A; 
#chains in the Genus database with same CATH homology
 4DYU A;  3L0M A;  1TJO A;  3R2R A;  5JKL A;  1BG7 A;  4RC5 B;  2WLA A;  4A25 A;  2V2I A;  1RYT A;  3JZA B;  5D8S A;  4U3G A;  3VVA A;  4TOH A;  5CMQ A;  4ISM A;  2JD8 0;  3EZ0 A;  2C41 A;  3E6S A;  4CVS A;  3E1O A;  2IB0 A;  3Q4Q A;  4XKT A;  2ZG8 X;  3KDQ A;  1RCE A;  2WLU A;  3KWO A;  3RAV A;  5GU0 X;  3C1Z A;  4KVR A;  4TO9 A;  4KVS A;  4ZL5 A;  3A9Q A;  2V8T A;  4CYA A;  4DYZ A;  1MOJ A;  2G38 B;  4LQH A;  3R2S A;  3WVU A;  1JGC A;  4TOG A;  4ZTT A;  4CMY V;  1ZUJ A;  1BCF A;  1JRE A;  3U90 A;  2FJC A;  4ITW A;  3NP2 X;  4RC8 A;  1LKM A;  1YUX A;  2C6R A;  4PG1 A;  2CLB A;  1AEW A;  4CMY A;  3PVY B;  3E1J A;  3FI6 A;  4X0J A;  2ZA8 A;  3KA8 A;  1YUZ A;  4RC6 A;  5HJF A;  3BKN A;  3E1Q A;  5GU1 X;  3OGH A;  3HIU A;  1JKV A;  4EVE A;  5J8W A;  4LPN A;  4MXP A;  1DAT A;  2CEI A;  2C2U A;  2V2N A;  2XJO A;  3F37 A;  3PVR A;  3KA9 A;  5JDO A;  5J9V A;  3QZ3 A;  5D8X A;  3R2K A;  2W0O A;  4DYY A;  3C23 A;  4REU A;  4DZ0 A;  3KXU A;  1F33 A;  3AF8 X;  3PWQ C;  2V2P A;  3E1M A;  1UVH A;  2VZB A;  5IX6 A;  3FRR A;  3AJP A;  4LPM A;  2VXI A;  1TKP A;  3FSE A;  4ITT A;  4PGK A;  3JZ9 A;  2FL0 A;  4M35 A;  3PZA A;  1HRS A;  3WVW A;  2Y3Q A;  3ISE A;  5E2D A;  2HR5 A;  4M33 A;  5FFE A;  2V2L A;  1SOF A;  5FFA A;  1Z4A A;  3EZU A;  4LQJ A;  1DVB A;  2XJN A;  3F33 A;  5JKM A;  5I4J A;  2GS4 A;  4TOD A;  1VEL A;  4II4 A;  5GU2 X;  3DBY A;  3UFB A;  3VNX A;  2ZUR X;  2Z5P A;  1NFV A;  5D8R A;  5GN8 A;  1O9I A;  4ZKX A;  3KX9 A;  3Q4O A;  2Z6M A;  5D8O A;  4OYN A;  2JD7 0;  2CN6 A;  1KRQ A;  4MJY A;  3AJO A;  3PW1 A;  2ITB A;  4QUW A;  3GVY A;  1O9R A;  2GYD A;  2ZG9 X;  2YJJ A;  3KHK A;  4Z5S A;  3Q4R A;  3RGD A;  5K52 A;  3E2C A;  1L8I A;  3BVE A;  2CWL A;  2Z90 A;  3AF9 X;  3QHB A;  4AM4 A;  2YJK A;  3C1Y A;  3BVF A;  1S3Q A;  5HU6 D;  3WNW A;  4CVT A;  4CYB A;  4DE6 A;  2ZA6 A;  5GOU A;  1IES A;  5LBH A;  2BJY A;  3BVK A;  3OJ5 A;  2XGW A;  2CLU A;  3IS8 A;  3EGM A;  2FG4 A;  4MKU A;  3SID A;  3UOF A;  3KA6 A;  4TW3 A;  1JIG A;  1DPS A;  3KA4 A;  4R42 A;  1LKO A;  4Y08 A;  4LYU A;  3PW8 A;  4P18 A;  3PVT B;  4YKH A;  3ISF A;  3SHX A;  2WWX B;  3GGZ A;  3PVY A;  4EVB A;  5FFC A;  2BK6 A;  3F38 A;  4EVD A;  4TOE A;  4TOA A;  2Z5R A;  5FFB A;  4DYX A;  2BKC A;  3NOZ X;  4PGI A;  3R2M A;  4E40 A;  2Y44 A;  2ZG7 X;  1L8H A;  1VJX A;  2V15 A;  2V2M A;  1LKP A;  2WTL A;  5HJH A;  2IY4 A;  4IWJ A;  4WJG 4;  3RD0 A;  3NP0 X;  3PWF A;  3F35 A;  3F32 A;  1JI5 A;  3RE7 A;  4M32 A;  3C21 A;  3BVL A;  1QGH A;  3GGY A;  5LG2 A;  3V3K B;  5CMR A;  4CVR A;  5C6F A;  4ZJK A;  1J30 A;  4W4K B;  3IS7 A;  3TA8 A;  2X17 0;  1ZS3 A;  2YW7 A;  1RCG A;  3E1P A;  3F34 A;  1JYB A;  3MPS A;  3ERZ A;  4XKU A;  4MY7 A;  2CF7 A;  2BW1 A;  3O7R A;  3SE1 A;  2CHI A;  2RBD A;  2XJM A;  3HL1 A;  4YVZ A;  4Z3B A;  4IXK A;  2C2J A;  2GYQ A;  4MN9 A;  4RC7 B;  1EUM A;  2CHP A;  1JKU A;  3QB9 A;  3UNO A;  3UOI A;  1VEQ A;  5ERJ A;  1F30 A;  2JD6 0;  5GN8 B;  3RBC A;  1IER A;  4IWK A;  4M34 A;  3R2L A;  3QVD A;  5E1U A;  3QD8 A;  2CN7 A;  4ZMC A;  5JKL G;  1JTS A;  1NF6 A;  2QQY A;  5J8S A;  1RCI A;  4LPJ A;  1H96 A;  1XZ1 A;  1YV1 A;  3AJQ A;  5J93 A;  3FRS A;  4ZKW A;  4RC5 A;  4DI0 A;  2V2O A;  3F36 A;  4TOC A;  3VV9 A;  2C2F A;  2QF9 A;  1TK6 A;  4ML5 A;  4DAS A;  4YXJ A;  2FHA A;  3QHC A;  1Z6O A;  3FVB A;  4LYX A;  4ZLW A;  2OKC A;  1GWG A;  3AK9 A;  1RCC A;  3LKD A;  2OC5 A;  1B71 A;  3Q4N A;  5LG8 A;  4CVP A;  5GU3 X;  2FG8 A;  4RC6 B;  4TOF A;  5CZU A;  2F7N A;  2FZF A;  5K53 A;  2IU2 A;  4ETR A;  2ZA7 A;  2CIH A;  3ES3 A;  4W4L B;  2MGY A;  3PW8 C;  4ERU A;  2G4H A;  1VLG A;  4PG0 A;  3M6J A;  2OH3 A;  3W54 A;  3E6R A;  4EVC A;  1XZ3 A;  1VEI A;  2HTN A;  3AF7 X;  3BVI A;  3KA3 A;  1S2Z A;  3F39 A;  3PVR B;  2V2R A;  5JDO B;  2FKZ A;  5D8Y A;  1SQ3 A;  3R2O A;  2D5K A;  1LB3 A;  3D19 A;  2XKQ A;  5FFD A;  4E6K A;  5HQO A;  2V2J A;  4ZL6 A;  4CY9 A;  3T9J A;  3BT5 A;  1FHA A;  2FFX J;  2VXX A;  4LQN A;  1JI4 A;  3O7S A;  3PVT A;  2AR0 A;  4LQV A;  5LS9 A;  1RCD A;  1OTK A;  2V2S A;  1R03 A;  2Z5Q A;  3WVV A;  1UMN A;  4AM5 A;  4MUD A;  3IQ1 A;  5D8P A;  3H7G A;  3PWQ A;  3GHQ A;  1MFR A;  4KVQ A;  1BFR A;  3A68 A;  1QYB A;  3E1N A;  4ZKH A;  1TKO A;  4II4 B;  2PYB A;  1Z6O M;  5D8Q A;  4ISP A;  4YXM A;  5AXS A;  2N02 A;  4TOB A;  3E1L A;  5JKM G;  5ERK A;  4XKS A;  3AK8 A;  1N1Q A;  2UX1 A;  1NNQ A;  3GE4 A;  2V8U A;  3N6O A;  4KXR B;  3SH6 A;  1S30 A;  5FEJ A;  5JAC A;  3PW1 B;  2YW6 A;  4AM2 A;  3R2H A;  4XGS A;  4RC7 A;  1NF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...