3ERZA

Directing noble metal ion chemistry within a designed ferritin protein. mercury ions on the three-fold channel
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
172
structure length
172
Chain Sequence
TSQVRQNYDQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEERCHAEKLMKLQNQRGGRIFLQDIKKPDRDDWESGLNAMEAALQLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNCQVCAIKCLGDHVTNLRKMGAPESGLAEYLFDKHTLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferritin heavy chain
publication title Directing noble metal ion chemistry within a designed ferritin protein.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 74
structure length 172
sequence length 172
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2008-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3erzA00
4PGIA 5AXSA 1NF4A 1F33A 1S3QA 5J8WA 1RCIA 5ERJA 4TOAA 1VEIA 2PYBA 3O7SA 3WNWA 3F33A 3AJQA 1ZUJA 1NFVA 5FFCA 1DVBA 2OC5A 4DZ0A 4ITWA 3UNOA 1YV1A 2BK6A 1RYTA 2XJNA 5I4JA 2CN6A 3Q4NA 3E6RA 2YW7A 2CHPA 3E2CA 1S30A 4P18A 5D8RA 3IS7A 2C41A 5LG8A 5D8OA 1IERA 2IB0A 1TK6A 3KWOA 3VNXA 4OYNA 4DYZA 3PWQC 3GVYA 4CMYV 4TOEA 2IU2A 2Z6MA 2WLAA 5D8XA 3RD0A 5D8PA 4U3GA 1RCGA 4DE6A 1GWGA 5E1UA 1LB3A 2FZFA 5LG2A 1NF6A 3O7RA 1SQ3A 2V2PA 1RCCA 3QZ3A 2Z5PA 3BKNA 2Y3QA 1XZ3A 3IS8A 4LQJA 2YJJA 4KVRA 3BVKA 5D8YA 4E6KA 1R03A 1YUXA 1AEWA 4RC6B 3FVBA 5J93A 1BFRA 3SH6A 3GE4A 2ZG8X 2VZBA 1HRSA 4MJYA 2X170 4M35A 2YW6A 2FFXJ 1DATA 4LPNA 2JD60 2BKCA 2ITBA 3KX9A 4M32A 2VXIA 4PGKA 4AM5A 1JYBA 5GN8A 1QYBA 2F7NA 5E2DA 1JKVA 4YKHA 4QUWA 2Z5RA 2HTNA 3RGDA 3UOFA 4EVCA 1TKPA 3WVUA 1YUZA 1VJXA 2XKQA 4TOBA 1KRQA 4CVRA 4R42A 4ZKXA 4AM4A 1JI5A 2FG4A 3AF7X 3PW8A 1JTSA 1JKUA 1NNQA 4ISPA 4TOFA 2V2MA 2C2UA 4II4B 3HIUA 4RC7A 4RC5B 2FJCA 5CZUA 3NP0X 3KA3A 2YJKA 3EZUA 3F32A 4DYXA 4LQNA 3AJPA 3PVRB 2WLUA 2XJMA 3U90A 3SIDA 3F38A 4MKUA 5FEJA 2ZG7X 4PG0A 2FL0A 3OJ5A 2Z5QA 4ZMCA 4Z3BA 4ZKHA 1VLGA 1JI4A 5CMQA 3PVTA 4MY7A 3R2MA 3MPSA 1O9RA 2GYDA 4TOCA 4TO9A 4XGSA 4RC8A 3QB9A 1FHAA 2C6RA 3UOIA 5JKLG 4ZL6A 3PVYB 2CLUA 1XZ1A 4TW3A 4CVTA 1H96A 4TODA 5FFEA 5IX6A 2WTLA 4Z5SA 3A9QA 3BVIA 3TA8A 4ZKWA 5GU0X 4TOGA 1Z6OM 4M34A 2OH3A 3AF9X 3PWFA 1EUMA 1J30A 3F34A 4TOHA 3KA4A 3KA8A 3Q4OA 3NP2X 1O9IA 2FHAA 4EVBA 4MN9A 3F36A 1BG7A 3PWQA 3FI6A 2ZA8A 3R2OA 3RAVA 4DI0A 3AK8A 2BW1A 4CYAA 1TKOA 3WVVA 4REUA 3QHBA 3SHXA 5FFBA 5LBHA 5J9VA 5JKLA 4LPJA 4XKUA 2V2NA 3BT5A 3R2KA 1L8IA 4Y08A 4CMYA 1MOJA 2V2RA 3HL1A 2W0OA 5K52A 3RBCA 2D5KA 3R2RA 4RC5A 4IWJA 2V2IA 1Z4AA 1IESA 4LQVA 3RE7A 1N1QA 4ZTTA 2ZA7A 3F35A 3PVRA 3PW1B 2CF7A 5HJHA 3R2SA 3E1NA 4XKTA 3A68A 3E1OA 1UVHA 3AJOA 5HQOA 2CLBA 1LKPA 1B71A 4DASA 3E6SA 5FFDA 5FFAA 1DPSA 1BCFA 2V2OA 4CYBA 4ML5A 1ZS3A 5D8SA 3AF8X 3GHQA 1LKMA 2Z90A 2IY4A 2JD80 2FKZA 2G4HA 2V15A 3BVLA 1RCEA 2V2SA 5GU3X 4XKSA 3ISEA 2CIHA 4IWKA 1VEQA 3PVYA 4KVQA 1Z6OA 5GU2X 2C2FA 3F37A 3Q4RA 2XJOA 5GOUA 3EZ0A 2VXXA 4LPMA 4LYUA 4DYYA 1UMNA 3BVFA 4RC7B 5LS9A 4ITTA 1RCDA 4KVSA 3KA6A 2XGWA 4CY9A 2RBDA 2QF9A 2GYQA 4RC6A 3E1MA 5K53A 2CEIA 3H7GA 3E1LA 2HR5A 4PG1A 3E1PA 5ERKA 1F30A 4ISMA 3SE1A 3EGMA 3PVTB 3ISFA 1JGCA 1L8HA 2BJYA 3T9JA 5C6FA 3AK9A 5JKMG 4A25A 3Q4QA 5CMRA 2ZURX 3E1QA 3IQ1A 3FSEA 4ZLWA 4LYXA 3WVWA 1MFRA 1QGHA 2CHIA 4CVSA 3OGHA 3QD8A 5HJFA 3E1JA 2V2JA 3R2HA 4AM2A 2JD70 3NOZX 3PW8C 3PW1A 1JREA 2QQYA 4II4A 4MUDA 2GS4A 3KXUA 5D8QA 4EVDA 3ERZA 3QHCA 5JACA 4M33A 4IXKA 3KA9A 1TJOA 5J8SA 4CVPA 2UX1A 1SOFA 1JIGA 2CN7A 5JKMA 4LQHA 2ZG9X 1S2ZA 4DYUA 5GN8B 3R2LA 2FG8A 3F39A 4EVEA 3BVEA 4ERUA 1VELA 4ZL5A 2ZA6A 3ES3A 1OTKA 4ETRA 5GU1X 3QVDA 2V2LA 2C2JA 4ZJKA 3PZAA 1LKOA
chains in the Genus database with same CATH superfamily
4PGIA 5AXSA 1NF4A 1F33A 1S3QA 5J8WA 1RCIA 5ERJA 4TOAA 1VEIA 2PYBA 3O7SA 3WNWA 3F33A 3AJQA 1ZUJA 1NFVA 5FFCA 1DVBA 2OC5A 4DZ0A 4ITWA 3UNOA 1YV1A 2BK6A 1RYTA 2XJNA 4WJG4 5I4JA 2CN6A 3Q4NA 3VVAA 3E6RA 2YW7A 2CHPA 3E2CA 1S30A 4P18A 5D8RA 3IS7A 2C41A 5LG8A 5D8OA 1IERA 2IB0A 1TK6A 3KWOA 3VNXA 3GGYA 4OYNA 4DYZA 3PWQC 3GVYA 4CMYV 4TOEA 2IU2A 2Z6MA 2WLAA 5D8XA 3RD0A 5D8PA 4U3GA 1RCGA 4DE6A 1GWGA 5E1UA 1LB3A 2FZFA 5LG2A 1NF6A 3O7RA 1SQ3A 2V2PA 1RCCA 3QZ3A 2Z5PA 3BKNA 3FRRA 2Y3QA 1XZ3A 3IS8A 4LQJA 2YJJA 4KVRA 3BVKA 5D8YA 3V3KB 2OKCA 4E6KA 1R03A 1YUXA 1AEWA 4RC6B 3FVBA 5J93A 5HU6D 1BFRA 3SH6A 3GE4A 2ZG8X 2VZBA 1HRSA 4MJYA 2X170 4M35A 2YW6A 2G38B 3D19A 2FFXJ 1DATA 4LPNA 2JD60 2BKCA 2ITBA 3KX9A 4M32A 2VXIA 4PGKA 4AM5A 3KDQA 1JYBA 5GN8A 1QYBA 2F7NA 5E2DA 1JKVA 4YKHA 4QUWA 2Z5RA 2HTNA 3RGDA 3UOFA 4EVCA 1TKPA 3WVUA 1YUZA 1VJXA 2XKQA 4TOBA 1KRQA 4CVRA 4R42A 4ZKXA 4AM4A 1JI5A 2FG4A 3AF7X 3PW8A 1JTSA 1JKUA 1NNQA 4ISPA 2N02A 4TOFA 2V2MA 2C2UA 4II4B 3HIUA 4RC7A 4RC5B 2FJCA 5CZUA 3NP0X 3KA3A 2YJKA 3EZUA 3F32A 4DYXA 4LQNA 3AJPA 3PVRB 2WLUA 2XJMA 3N6OA 3U90A 3C23A 3SIDA 4MXPA 3F38A 4MKUA 5FEJA 3DBYA 2ZG7X 3LKDA 4PG0A 2FL0A 3OJ5A 2Z5QA 4ZMCA 4Z3BA 4ZKHA 1VLGA 1JI4A 5CMQA 3PVTA 4MY7A 3R2MA 3MPSA 1O9RA 2GYDA 4TOCA 4TO9A 4XGSA 4RC8A 3QB9A 1FHAA 2C6RA 3UOIA 2V8TA 5JKLG 4ZL6A 3PVYB 2CLUA 1XZ1A 4TW3A 4CVTA 1H96A 4TODA 5FFEA 5IX6A 2WTLA 4Z5SA 3A9QA 3BVIA 3TA8A 4ZKWA 5GU0X 4TOGA 3M6JA 1Z6OM 4M34A 2OH3A 3AF9X 3PWFA 1EUMA 1J30A 3F34A 2CWLA 4TOHA 3KA4A 3KA8A 3Q4OA 3NP2X 1O9IA 2FHAA 4EVBA 4MN9A 3F36A 1BG7A 4YXJA 3PWQA 3FI6A 2ZA8A 3R2OA 3RAVA 4DI0A 3AK8A 2BW1A 4CYAA 1TKOA 3WVVA 4REUA 3QHBA 3SHXA 5FFBA 5LBHA 5J9VA 5JKLA 4LPJA 4XKUA 2V2NA 3BT5A 3R2KA 1L8IA 2MGYA 2V8UA 4Y08A 4CMYA 1MOJA 2V2RA 3HL1A 2W0OA 5JDOB 3JZ9A 5K52A 3RBCA 3R2RA 2D5KA 4RC5A 3UFBA 4IWJA 2V2IA 1Z4AA 1IESA 4LQVA 3RE7A 1N1QA 4ZTTA 2ZA7A 3F35A 3PVRA 3PW1B 2CF7A 5HJHA 3R2SA 3E1NA 4XKTA 3A68A 3E1OA 1UVHA 3AJOA 4YXMA 2CLBA 1LKPA 1B71A 4DASA 5HQOA 3E6SA 5FFDA 5FFAA 1DPSA 1BCFA 2V2OA 4CYBA 4ML5A 1ZS3A 5D8SA 3AF8X 3GHQA 1LKMA 2Z90A 2IY4A 4X0JA 2JD80 2FKZA 2G4HA 2V15A 3BVLA 4YVZA 1RCEA 2V2SA 5GU3X 4XKSA 3ISEA 2CIHA 4IWKA 1VEQA 3PVYA 4KVQA 4W4KB 3C21A 1Z6OA 5GU2X 2C2FA 3F37A 3Q4RA 2XJOA 5GOUA 3EZ0A 2VXXA 4LPMA 4LYUA 4DYYA 1UMNA 3BVFA 4RC7B 4E40A 5LS9A 3C1YA 4ITTA 1RCDA 4KVSA 3KA6A 2XGWA 4CY9A 4KXRB 2RBDA 3L0MA 2QF9A 2GYQA 4RC6A 3E1MA 5K53A 2CEIA 3H7GA 3E1LA 2HR5A 4PG1A 3E1PA 5ERKA 1F30A 4ISMA 3SE1A 3EGMA 3PVTB 3ISFA 1JGCA 1L8HA 2WWXB 3C1ZA 2BJYA 3T9JA 5C6FA 3AK9A 5JKMG 4A25A 3Q4QA 5CMRA 2ZURX 3VV9A 3E1QA 3IQ1A 3FSEA 3JZAB 4ZLWA 2Y44A 4LYXA 3WVWA 5JDOA 1MFRA 1QGHA 2CHIA 4CVSA 3OGHA 3QD8A 5HJFA 3E1JA 2V2JA 2AR0A 3R2HA 4AM2A 2JD70 3NOZX 3PW8C 3PW1A 1JREA 2QQYA 4II4A 4MUDA 2GS4A 3KXUA 5D8QA 4EVDA 3ERZA 3GGZA 3QHCA 5JACA 4M33A 4IXKA 3KA9A 1TJOA 5J8SA 4CVPA 2UX1A 1SOFA 1JIGA 2CN7A 5JKMA 4LQHA 2ZG9X 4W4LB 1S2ZA 4DYUA 5GN8B 3R2LA 2FG8A 3F39A 4EVEA 3BVEA 4ERUA 1VELA 4ZL5A 2ZA6A 3ES3A 1OTKA 4ETRA 3KHKA 5GU1X 3QVDA 2V2LA 2C2JA 4ZJKA 3FRSA 3PZAA 1LKOA 3W54A
chains in the Genus database with same CATH topology
4PGIA 5AXSA 1NF4A 1F33A 1S3QA 5J8WA 1RCIA 5ERJA 4TOAA 1VEIA 2PYBA 3O7SA 3WNWA 3F33A 3AJQA 1ZUJA 1NFVA 5FFCA 1DVBA 2OC5A 4DZ0A 4ITWA 3UNOA 1YV1A 2BK6A 1RYTA 2XJNA 4WJG4 5I4JA 2CN6A 3Q4NA 3VVAA 3E6RA 2YW7A 2CHPA 3E2CA 1S30A 4P18A 5D8RA 3IS7A 2C41A 5LG8A 5D8OA 1IERA 2IB0A 1TK6A 3KWOA 3VNXA 3GGYA 4OYNA 4DYZA 3PWQC 3GVYA 4CMYV 4TOEA 2IU2A 2Z6MA 2WLAA 5D8XA 3RD0A 5D8PA 4U3GA 1RCGA 4DE6A 1GWGA 5E1UA 1LB3A 2FZFA 5LG2A 1NF6A 3O7RA 1SQ3A 2V2PA 1RCCA 3QZ3A 2Z5PA 3BKNA 3FRRA 2Y3QA 1XZ3A 3IS8A 4LQJA 2YJJA 4KVRA 3BVKA 5D8YA 3V3KB 2OKCA 4E6KA 1R03A 1YUXA 1AEWA 4RC6B 3FVBA 5J93A 5HU6D 1BFRA 3SH6A 3GE4A 2ZG8X 2VZBA 1HRSA 4MJYA 2X170 4M35A 2YW6A 2G38B 3D19A 2FFXJ 1DATA 4LPNA 2JD60 2BKCA 2ITBA 3KX9A 4M32A 2VXIA 4PGKA 4AM5A 3KDQA 1JYBA 5GN8A 1QYBA 2F7NA 5E2DA 1JKVA 4YKHA 4QUWA 2Z5RA 2HTNA 3RGDA 3UOFA 4EVCA 1TKPA 3WVUA 1YUZA 1VJXA 2XKQA 4TOBA 1KRQA 4CVRA 4R42A 4ZKXA 4AM4A 1JI5A 2FG4A 3AF7X 3PW8A 1JTSA 1JKUA 1NNQA 4ISPA 2N02A 4TOFA 2V2MA 2C2UA 4II4B 3HIUA 4RC7A 4RC5B 2FJCA 5CZUA 3NP0X 3KA3A 2YJKA 3EZUA 3F32A 4DYXA 4LQNA 3AJPA 3PVRB 2WLUA 2XJMA 3N6OA 3U90A 3C23A 3SIDA 4MXPA 3F38A 4MKUA 5FEJA 3DBYA 2ZG7X 3LKDA 4PG0A 2FL0A 3OJ5A 2Z5QA 4ZMCA 4Z3BA 4ZKHA 1VLGA 1JI4A 5CMQA 3PVTA 4MY7A 3R2MA 3MPSA 1O9RA 2GYDA 4TOCA 4TO9A 4XGSA 4RC8A 3QB9A 1FHAA 2C6RA 3UOIA 2V8TA 5JKLG 4ZL6A 3PVYB 2CLUA 1XZ1A 4TW3A 4CVTA 1H96A 4TODA 5FFEA 5IX6A 2WTLA 4Z5SA 3A9QA 3BVIA 3TA8A 4ZKWA 5GU0X 4TOGA 3M6JA 1Z6OM 4M34A 2OH3A 3AF9X 3PWFA 1EUMA 1J30A 3F34A 2CWLA 4TOHA 3KA4A 3KA8A 3Q4OA 3NP2X 1O9IA 2FHAA 4EVBA 4MN9A 3F36A 1BG7A 4YXJA 3PWQA 3FI6A 2ZA8A 3R2OA 3RAVA 4DI0A 3AK8A 2BW1A 4CYAA 1TKOA 3WVVA 4REUA 3QHBA 3SHXA 5FFBA 5LBHA 5J9VA 5JKLA 4LPJA 4XKUA 2V2NA 3BT5A 3R2KA 1L8IA 2MGYA 2V8UA 4Y08A 4CMYA 1MOJA 2V2RA 3HL1A 2W0OA 5JDOB 3JZ9A 5K52A 3RBCA 3R2RA 2D5KA 4RC5A 3UFBA 4IWJA 2V2IA 1Z4AA 1IESA 4LQVA 3RE7A 1N1QA 4ZTTA 2ZA7A 3F35A 3PVRA 3PW1B 2CF7A 5HJHA 3R2SA 3E1NA 4XKTA 3A68A 3E1OA 1UVHA 3AJOA 4YXMA 2CLBA 1LKPA 1B71A 4DASA 5HQOA 3E6SA 5FFDA 5FFAA 1DPSA 1BCFA 2V2OA 4CYBA 4ML5A 1ZS3A 5D8SA 3AF8X 3GHQA 1LKMA 2Z90A 2IY4A 4X0JA 2JD80 2FKZA 2G4HA 2V15A 3BVLA 4YVZA 1RCEA 2V2SA 5GU3X 4XKSA 3ISEA 2CIHA 4IWKA 1VEQA 3PVYA 4KVQA 4W4KB 3C21A 1Z6OA 5GU2X 2C2FA 3F37A 3Q4RA 2XJOA 5GOUA 3EZ0A 2VXXA 4LPMA 4LYUA 4DYYA 1UMNA 3BVFA 4RC7B 4E40A 5LS9A 3C1YA 4ITTA 1RCDA 4KVSA 3KA6A 2XGWA 4CY9A 4KXRB 2RBDA 3L0MA 2QF9A 2GYQA 4RC6A 3E1MA 5K53A 2CEIA 3H7GA 3E1LA 2HR5A 4PG1A 3E1PA 5ERKA 1F30A 4ISMA 3SE1A 3EGMA 3PVTB 3ISFA 1JGCA 1L8HA 2WWXB 3C1ZA 2BJYA 3T9JA 5C6FA 3AK9A 5JKMG 4A25A 3Q4QA 5CMRA 2ZURX 3VV9A 3E1QA 3IQ1A 3FSEA 3JZAB 4ZLWA 2Y44A 4LYXA 3WVWA 5JDOA 1MFRA 1QGHA 2CHIA 4CVSA 3OGHA 3QD8A 5HJFA 3E1JA 2V2JA 2AR0A 3R2HA 4AM2A 2JD70 3NOZX 3PW8C 3PW1A 1JREA 2QQYA 4II4A 4MUDA 2GS4A 3KXUA 5D8QA 4EVDA 3ERZA 3GGZA 3QHCA 5JACA 4M33A 4IXKA 3KA9A 1TJOA 5J8SA 4CVPA 2UX1A 1SOFA 1JIGA 2CN7A 5JKMA 4LQHA 2ZG9X 4W4LB 1S2ZA 4DYUA 5GN8B 3R2LA 2FG8A 3F39A 4EVEA 3BVEA 4ERUA 1VELA 4ZL5A 2ZA6A 3ES3A 1OTKA 4ETRA 3KHKA 5GU1X 3QVDA 2V2LA 2C2JA 4ZJKA 3FRSA 3PZAA 1LKOA 3W54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PGI A;  5AXS A;  1NF4 A;  1F33 A;  1S3Q A;  5J8W A;  1RCI A;  5ERJ A;  4TOA A;  1VEI A;  2PYB A;  3O7S A;  3WNW A;  3F33 A;  3AJQ A;  1ZUJ A;  1NFV A;  5FFC A;  1DVB A;  2OC5 A;  4DZ0 A;  4ITW A;  3UNO A;  1YV1 A;  2BK6 A;  1RYT A;  2XJN A;  5I4J A;  2CN6 A;  3Q4N A;  3E6R A;  2YW7 A;  2CHP A;  3E2C A;  1S30 A;  4P18 A;  5D8R A;  3IS7 A;  2C41 A;  5LG8 A;  5D8O A;  1IER A;  2IB0 A;  1TK6 A;  3KWO A;  3VNX A;  4OYN A;  4DYZ A;  3PWQ C;  3GVY A;  4CMY V;  4TOE A;  2IU2 A;  2Z6M A;  2WLA A;  5D8X A;  3RD0 A;  5D8P A;  4U3G A;  1RCG A;  4DE6 A;  1GWG A;  5E1U A;  1LB3 A;  2FZF A;  5LG2 A;  1NF6 A;  3O7R A;  1SQ3 A;  2V2P A;  1RCC A;  3QZ3 A;  2Z5P A;  3BKN A;  2Y3Q A;  1XZ3 A;  3IS8 A;  4LQJ A;  2YJJ A;  4KVR A;  3BVK A;  5D8Y A;  4E6K A;  1R03 A;  1YUX A;  1AEW A;  4RC6 B;  3FVB A;  5J93 A;  1BFR A;  3SH6 A;  3GE4 A;  2ZG8 X;  2VZB A;  1HRS A;  4MJY A;  2X17 0;  4M35 A;  2YW6 A;  2FFX J;  1DAT A;  4LPN A;  2JD6 0;  2BKC A;  2ITB A;  3KX9 A;  4M32 A;  2VXI A;  4PGK A;  4AM5 A;  1JYB A;  5GN8 A;  1QYB A;  2F7N A;  5E2D A;  1JKV A;  4YKH A;  4QUW A;  2Z5R A;  2HTN A;  3RGD A;  3UOF A;  4EVC A;  1TKP A;  3WVU A;  1YUZ A;  1VJX A;  2XKQ A;  4TOB A;  1KRQ A;  4CVR A;  4R42 A;  4ZKX A;  4AM4 A;  1JI5 A;  2FG4 A;  3AF7 X;  3PW8 A;  1JTS A;  1JKU A;  1NNQ A;  4ISP A;  4TOF A;  2V2M A;  2C2U A;  4II4 B;  3HIU A;  4RC7 A;  4RC5 B;  2FJC A;  5CZU A;  3NP0 X;  3KA3 A;  2YJK A;  3EZU A;  3F32 A;  4DYX A;  4LQN A;  3AJP A;  3PVR B;  2WLU A;  2XJM A;  3U90 A;  3SID A;  3F38 A;  4MKU A;  5FEJ A;  2ZG7 X;  4PG0 A;  2FL0 A;  3OJ5 A;  2Z5Q A;  4ZMC A;  4Z3B A;  4ZKH A;  1VLG A;  1JI4 A;  5CMQ A;  3PVT A;  4MY7 A;  3R2M A;  3MPS A;  1O9R A;  2GYD A;  4TOC A;  4TO9 A;  4XGS A;  4RC8 A;  3QB9 A;  1FHA A;  2C6R A;  3UOI A;  5JKL G;  4ZL6 A;  3PVY B;  2CLU A;  1XZ1 A;  4TW3 A;  4CVT A;  1H96 A;  4TOD A;  5FFE A;  5IX6 A;  2WTL A;  4Z5S A;  3A9Q A;  3BVI A;  3TA8 A;  4ZKW A;  5GU0 X;  4TOG A;  1Z6O M;  4M34 A;  2OH3 A;  3AF9 X;  3PWF A;  1EUM A;  1J30 A;  3F34 A;  4TOH A;  3KA4 A;  3KA8 A;  3Q4O A;  3NP2 X;  1O9I A;  2FHA A;  4EVB A;  4MN9 A;  3F36 A;  1BG7 A;  3PWQ A;  3FI6 A;  2ZA8 A;  3R2O A;  3RAV A;  4DI0 A;  3AK8 A;  2BW1 A;  4CYA A;  1TKO A;  3WVV A;  4REU A;  3QHB A;  3SHX A;  5FFB A;  5LBH A;  5J9V A;  5JKL A;  4LPJ A;  4XKU A;  2V2N A;  3BT5 A;  3R2K A;  1L8I A;  4Y08 A;  4CMY A;  1MOJ A;  2V2R A;  3HL1 A;  2W0O A;  5K52 A;  3RBC A;  2D5K A;  3R2R A;  4RC5 A;  4IWJ A;  2V2I A;  1Z4A A;  1IES A;  4LQV A;  3RE7 A;  1N1Q A;  4ZTT A;  2ZA7 A;  3F35 A;  3PVR A;  3PW1 B;  2CF7 A;  5HJH A;  3R2S A;  3E1N A;  4XKT A;  3A68 A;  3E1O A;  1UVH A;  3AJO A;  5HQO A;  2CLB A;  1LKP A;  1B71 A;  4DAS A;  3E6S A;  5FFD A;  5FFA A;  1DPS A;  1BCF A;  2V2O A;  4CYB A;  4ML5 A;  1ZS3 A;  5D8S A;  3AF8 X;  3GHQ A;  1LKM A;  2Z90 A;  2IY4 A;  2JD8 0;  2FKZ A;  2G4H A;  2V15 A;  3BVL A;  1RCE A;  2V2S A;  5GU3 X;  4XKS A;  3ISE A;  2CIH A;  4IWK A;  1VEQ A;  3PVY A;  4KVQ A;  1Z6O A;  5GU2 X;  2C2F A;  3F37 A;  3Q4R A;  2XJO A;  5GOU A;  3EZ0 A;  2VXX A;  4LPM A;  4LYU A;  4DYY A;  1UMN A;  3BVF A;  4RC7 B;  5LS9 A;  4ITT A;  1RCD A;  4KVS A;  3KA6 A;  2XGW A;  4CY9 A;  2RBD A;  2QF9 A;  2GYQ A;  4RC6 A;  3E1M A;  5K53 A;  2CEI A;  3H7G A;  3E1L A;  2HR5 A;  4PG1 A;  3E1P A;  5ERK A;  1F30 A;  4ISM A;  3SE1 A;  3EGM A;  3PVT B;  3ISF A;  1JGC A;  1L8H A;  2BJY A;  3T9J A;  5C6F A;  3AK9 A;  5JKM G;  4A25 A;  3Q4Q A;  5CMR A;  2ZUR X;  3E1Q A;  3IQ1 A;  3FSE A;  4ZLW A;  4LYX A;  3WVW A;  1MFR A;  1QGH A;  2CHI A;  4CVS A;  3OGH A;  3QD8 A;  5HJF A;  3E1J A;  2V2J A;  3R2H A;  4AM2 A;  2JD7 0;  3NOZ X;  3PW8 C;  3PW1 A;  1JRE A;  2QQY A;  4II4 A;  4MUD A;  2GS4 A;  3KXU A;  5D8Q A;  4EVD A;  3ERZ A;  3QHC A;  5JAC A;  4M33 A;  4IXK A;  3KA9 A;  1TJO A;  5J8S A;  4CVP A;  2UX1 A;  1SOF A;  1JIG A;  2CN7 A;  5JKM A;  4LQH A;  2ZG9 X;  1S2Z A;  4DYU A;  5GN8 B;  3R2L A;  2FG8 A;  3F39 A;  4EVE A;  3BVE A;  4ERU A;  1VEL A;  4ZL5 A;  2ZA6 A;  3ES3 A;  1OTK A;  4ETR A;  5GU1 X;  3QVD A;  2V2L A;  2C2J A;  4ZJK A;  3PZA A;  1LKO A; 
#chains in the Genus database with same CATH topology
 4PGI A;  5AXS A;  1NF4 A;  1F33 A;  1S3Q A;  5J8W A;  1RCI A;  5ERJ A;  4TOA A;  1VEI A;  2PYB A;  3O7S A;  3WNW A;  3F33 A;  3AJQ A;  1ZUJ A;  1NFV A;  5FFC A;  1DVB A;  2OC5 A;  4DZ0 A;  4ITW A;  3UNO A;  1YV1 A;  2BK6 A;  1RYT A;  2XJN A;  4WJG 4;  5I4J A;  2CN6 A;  3Q4N A;  3VVA A;  3E6R A;  2YW7 A;  2CHP A;  3E2C A;  1S30 A;  4P18 A;  5D8R A;  3IS7 A;  2C41 A;  5LG8 A;  5D8O A;  1IER A;  2IB0 A;  1TK6 A;  3KWO A;  3VNX A;  3GGY A;  4OYN A;  4DYZ A;  3PWQ C;  3GVY A;  4CMY V;  4TOE A;  2IU2 A;  2Z6M A;  2WLA A;  5D8X A;  3RD0 A;  5D8P A;  4U3G A;  1RCG A;  4DE6 A;  1GWG A;  5E1U A;  1LB3 A;  2FZF A;  5LG2 A;  1NF6 A;  3O7R A;  1SQ3 A;  2V2P A;  1RCC A;  3QZ3 A;  2Z5P A;  3BKN A;  3FRR A;  2Y3Q A;  1XZ3 A;  3IS8 A;  4LQJ A;  2YJJ A;  4KVR A;  3BVK A;  5D8Y A;  3V3K B;  2OKC A;  4E6K A;  1R03 A;  1YUX A;  1AEW A;  4RC6 B;  3FVB A;  5J93 A;  5HU6 D;  1BFR A;  3SH6 A;  3GE4 A;  2ZG8 X;  2VZB A;  1HRS A;  4MJY A;  2X17 0;  4M35 A;  2YW6 A;  2G38 B;  3D19 A;  2FFX J;  1DAT A;  4LPN A;  2JD6 0;  2BKC A;  2ITB A;  3KX9 A;  4M32 A;  2VXI A;  4PGK A;  4AM5 A;  3KDQ A;  1JYB A;  5GN8 A;  1QYB A;  2F7N A;  5E2D A;  1JKV A;  4YKH A;  4QUW A;  2Z5R A;  2HTN A;  3RGD A;  3UOF A;  4EVC A;  1TKP A;  3WVU A;  1YUZ A;  1VJX A;  2XKQ A;  4TOB A;  1KRQ A;  4CVR A;  4R42 A;  4ZKX A;  4AM4 A;  1JI5 A;  2FG4 A;  3AF7 X;  3PW8 A;  1JTS A;  1JKU A;  1NNQ A;  4ISP A;  2N02 A;  4TOF A;  2V2M A;  2C2U A;  4II4 B;  3HIU A;  4RC7 A;  4RC5 B;  2FJC A;  5CZU A;  3NP0 X;  3KA3 A;  2YJK A;  3EZU A;  3F32 A;  4DYX A;  4LQN A;  3AJP A;  3PVR B;  2WLU A;  2XJM A;  3N6O A;  3U90 A;  3C23 A;  3SID A;  4MXP A;  3F38 A;  4MKU A;  5FEJ A;  3DBY A;  2ZG7 X;  3LKD A;  4PG0 A;  2FL0 A;  3OJ5 A;  2Z5Q A;  4ZMC A;  4Z3B A;  4ZKH A;  1VLG A;  1JI4 A;  5CMQ A;  3PVT A;  4MY7 A;  3R2M A;  3MPS A;  1O9R A;  2GYD A;  4TOC A;  4TO9 A;  4XGS A;  4RC8 A;  3QB9 A;  1FHA A;  2C6R A;  3UOI A;  2V8T A;  5JKL G;  4ZL6 A;  3PVY B;  2CLU A;  1XZ1 A;  4TW3 A;  4CVT A;  1H96 A;  4TOD A;  5FFE A;  5IX6 A;  2WTL A;  4Z5S A;  3A9Q A;  3BVI A;  3TA8 A;  4ZKW A;  5GU0 X;  4TOG A;  3M6J A;  1Z6O M;  4M34 A;  2OH3 A;  3AF9 X;  3PWF A;  1EUM A;  1J30 A;  3F34 A;  2CWL A;  4TOH A;  3KA4 A;  3KA8 A;  3Q4O A;  3NP2 X;  1O9I A;  2FHA A;  4EVB A;  4MN9 A;  3F36 A;  1BG7 A;  4YXJ A;  3PWQ A;  3FI6 A;  2ZA8 A;  3R2O A;  3RAV A;  4DI0 A;  3AK8 A;  2BW1 A;  4CYA A;  1TKO A;  3WVV A;  4REU A;  3QHB A;  3SHX A;  5FFB A;  5LBH A;  5J9V A;  5JKL A;  4LPJ A;  4XKU A;  2V2N A;  3BT5 A;  3R2K A;  1L8I A;  2MGY A;  2V8U A;  4Y08 A;  4CMY A;  1MOJ A;  2V2R A;  3HL1 A;  2W0O A;  5JDO B;  3JZ9 A;  5K52 A;  3RBC A;  3R2R A;  2D5K A;  4RC5 A;  3UFB A;  4IWJ A;  2V2I A;  1Z4A A;  1IES A;  4LQV A;  3RE7 A;  1N1Q A;  4ZTT A;  2ZA7 A;  3F35 A;  3PVR A;  3PW1 B;  2CF7 A;  5HJH A;  3R2S A;  3E1N A;  4XKT A;  3A68 A;  3E1O A;  1UVH A;  3AJO A;  4YXM A;  2CLB A;  1LKP A;  1B71 A;  4DAS A;  5HQO A;  3E6S A;  5FFD A;  5FFA A;  1DPS A;  1BCF A;  2V2O A;  4CYB A;  4ML5 A;  1ZS3 A;  5D8S A;  3AF8 X;  3GHQ A;  1LKM A;  2Z90 A;  2IY4 A;  4X0J A;  2JD8 0;  2FKZ A;  2G4H A;  2V15 A;  3BVL A;  4YVZ A;  1RCE A;  2V2S A;  5GU3 X;  4XKS A;  3ISE A;  2CIH A;  4IWK A;  1VEQ A;  3PVY A;  4KVQ A;  4W4K B;  3C21 A;  1Z6O A;  5GU2 X;  2C2F A;  3F37 A;  3Q4R A;  2XJO A;  5GOU A;  3EZ0 A;  2VXX A;  4LPM A;  4LYU A;  4DYY A;  1UMN A;  3BVF A;  4RC7 B;  4E40 A;  5LS9 A;  3C1Y A;  4ITT A;  1RCD A;  4KVS A;  3KA6 A;  2XGW A;  4CY9 A;  4KXR B;  2RBD A;  3L0M A;  2QF9 A;  2GYQ A;  4RC6 A;  3E1M A;  5K53 A;  2CEI A;  3H7G A;  3E1L A;  2HR5 A;  4PG1 A;  3E1P A;  5ERK A;  1F30 A;  4ISM A;  3SE1 A;  3EGM A;  3PVT B;  3ISF A;  1JGC A;  1L8H A;  2WWX B;  3C1Z A;  2BJY A;  3T9J A;  5C6F A;  3AK9 A;  5JKM G;  4A25 A;  3Q4Q A;  5CMR A;  2ZUR X;  3VV9 A;  3E1Q A;  3IQ1 A;  3FSE A;  3JZA B;  4ZLW A;  2Y44 A;  4LYX A;  3WVW A;  5JDO A;  1MFR A;  1QGH A;  2CHI A;  4CVS A;  3OGH A;  3QD8 A;  5HJF A;  3E1J A;  2V2J A;  2AR0 A;  3R2H A;  4AM2 A;  2JD7 0;  3NOZ X;  3PW8 C;  3PW1 A;  1JRE A;  2QQY A;  4II4 A;  4MUD A;  2GS4 A;  3KXU A;  5D8Q A;  4EVD A;  3ERZ A;  3GGZ A;  3QHC A;  5JAC A;  4M33 A;  4IXK A;  3KA9 A;  1TJO A;  5J8S A;  4CVP A;  2UX1 A;  1SOF A;  1JIG A;  2CN7 A;  5JKM A;  4LQH A;  2ZG9 X;  4W4L B;  1S2Z A;  4DYU A;  5GN8 B;  3R2L A;  2FG8 A;  3F39 A;  4EVE A;  3BVE A;  4ERU A;  1VEL A;  4ZL5 A;  2ZA6 A;  3ES3 A;  1OTK A;  4ETR A;  3KHK A;  5GU1 X;  3QVD A;  2V2L A;  2C2J A;  4ZJK A;  3FRS A;  3PZA A;  1LKO A;  3W54 A; 
#chains in the Genus database with same CATH homology
 4PGI A;  5AXS A;  1NF4 A;  1F33 A;  1S3Q A;  5J8W A;  1RCI A;  5ERJ A;  4TOA A;  1VEI A;  2PYB A;  3O7S A;  3WNW A;  3F33 A;  3AJQ A;  1ZUJ A;  1NFV A;  5FFC A;  1DVB A;  2OC5 A;  4DZ0 A;  4ITW A;  3UNO A;  1YV1 A;  2BK6 A;  1RYT A;  2XJN A;  4WJG 4;  5I4J A;  2CN6 A;  3Q4N A;  3VVA A;  3E6R A;  2YW7 A;  2CHP A;  3E2C A;  1S30 A;  4P18 A;  5D8R A;  3IS7 A;  2C41 A;  5LG8 A;  5D8O A;  1IER A;  2IB0 A;  1TK6 A;  3KWO A;  3VNX A;  3GGY A;  4OYN A;  4DYZ A;  3PWQ C;  3GVY A;  4CMY V;  4TOE A;  2IU2 A;  2Z6M A;  2WLA A;  5D8X A;  3RD0 A;  5D8P A;  4U3G A;  1RCG A;  4DE6 A;  1GWG A;  5E1U A;  1LB3 A;  2FZF A;  5LG2 A;  1NF6 A;  3O7R A;  1SQ3 A;  2V2P A;  1RCC A;  3QZ3 A;  2Z5P A;  3BKN A;  3FRR A;  2Y3Q A;  1XZ3 A;  3IS8 A;  4LQJ A;  2YJJ A;  4KVR A;  3BVK A;  5D8Y A;  3V3K B;  2OKC A;  4E6K A;  1R03 A;  1YUX A;  1AEW A;  4RC6 B;  3FVB A;  5J93 A;  5HU6 D;  1BFR A;  3SH6 A;  3GE4 A;  2ZG8 X;  2VZB A;  1HRS A;  4MJY A;  2X17 0;  4M35 A;  2YW6 A;  2G38 B;  3D19 A;  2FFX J;  1DAT A;  4LPN A;  2JD6 0;  2BKC A;  2ITB A;  3KX9 A;  4M32 A;  2VXI A;  4PGK A;  4AM5 A;  3KDQ A;  1JYB A;  5GN8 A;  1QYB A;  2F7N A;  5E2D A;  1JKV A;  4YKH A;  4QUW A;  2Z5R A;  2HTN A;  3RGD A;  3UOF A;  4EVC A;  1TKP A;  3WVU A;  1YUZ A;  1VJX A;  2XKQ A;  4TOB A;  1KRQ A;  4CVR A;  4R42 A;  4ZKX A;  4AM4 A;  1JI5 A;  2FG4 A;  3AF7 X;  3PW8 A;  1JTS A;  1JKU A;  1NNQ A;  4ISP A;  2N02 A;  4TOF A;  2V2M A;  2C2U A;  4II4 B;  3HIU A;  4RC7 A;  4RC5 B;  2FJC A;  5CZU A;  3NP0 X;  3KA3 A;  2YJK A;  3EZU A;  3F32 A;  4DYX A;  4LQN A;  3AJP A;  3PVR B;  2WLU A;  2XJM A;  3N6O A;  3U90 A;  3C23 A;  3SID A;  4MXP A;  3F38 A;  4MKU A;  5FEJ A;  3DBY A;  2ZG7 X;  3LKD A;  4PG0 A;  2FL0 A;  3OJ5 A;  2Z5Q A;  4ZMC A;  4Z3B A;  4ZKH A;  1VLG A;  1JI4 A;  5CMQ A;  3PVT A;  4MY7 A;  3R2M A;  3MPS A;  1O9R A;  2GYD A;  4TOC A;  4TO9 A;  4XGS A;  4RC8 A;  3QB9 A;  1FHA A;  2C6R A;  3UOI A;  2V8T A;  5JKL G;  4ZL6 A;  3PVY B;  2CLU A;  1XZ1 A;  4TW3 A;  4CVT A;  1H96 A;  4TOD A;  5FFE A;  5IX6 A;  2WTL A;  4Z5S A;  3A9Q A;  3BVI A;  3TA8 A;  4ZKW A;  5GU0 X;  4TOG A;  3M6J A;  1Z6O M;  4M34 A;  2OH3 A;  3AF9 X;  3PWF A;  1EUM A;  1J30 A;  3F34 A;  2CWL A;  4TOH A;  3KA4 A;  3KA8 A;  3Q4O A;  3NP2 X;  1O9I A;  2FHA A;  4EVB A;  4MN9 A;  3F36 A;  1BG7 A;  4YXJ A;  3PWQ A;  3FI6 A;  2ZA8 A;  3R2O A;  3RAV A;  4DI0 A;  3AK8 A;  2BW1 A;  4CYA A;  1TKO A;  3WVV A;  4REU A;  3QHB A;  3SHX A;  5FFB A;  5LBH A;  5J9V A;  5JKL A;  4LPJ A;  4XKU A;  2V2N A;  3BT5 A;  3R2K A;  1L8I A;  2MGY A;  2V8U A;  4Y08 A;  4CMY A;  1MOJ A;  2V2R A;  3HL1 A;  2W0O A;  5JDO B;  3JZ9 A;  5K52 A;  3RBC A;  3R2R A;  2D5K A;  4RC5 A;  3UFB A;  4IWJ A;  2V2I A;  1Z4A A;  1IES A;  4LQV A;  3RE7 A;  1N1Q A;  4ZTT A;  2ZA7 A;  3F35 A;  3PVR A;  3PW1 B;  2CF7 A;  5HJH A;  3R2S A;  3E1N A;  4XKT A;  3A68 A;  3E1O A;  1UVH A;  3AJO A;  4YXM A;  2CLB A;  1LKP A;  1B71 A;  4DAS A;  5HQO A;  3E6S A;  5FFD A;  5FFA A;  1DPS A;  1BCF A;  2V2O A;  4CYB A;  4ML5 A;  1ZS3 A;  5D8S A;  3AF8 X;  3GHQ A;  1LKM A;  2Z90 A;  2IY4 A;  4X0J A;  2JD8 0;  2FKZ A;  2G4H A;  2V15 A;  3BVL A;  4YVZ A;  1RCE A;  2V2S A;  5GU3 X;  4XKS A;  3ISE A;  2CIH A;  4IWK A;  1VEQ A;  3PVY A;  4KVQ A;  4W4K B;  3C21 A;  1Z6O A;  5GU2 X;  2C2F A;  3F37 A;  3Q4R A;  2XJO A;  5GOU A;  3EZ0 A;  2VXX A;  4LPM A;  4LYU A;  4DYY A;  1UMN A;  3BVF A;  4RC7 B;  4E40 A;  5LS9 A;  3C1Y A;  4ITT A;  1RCD A;  4KVS A;  3KA6 A;  2XGW A;  4CY9 A;  4KXR B;  2RBD A;  3L0M A;  2QF9 A;  2GYQ A;  4RC6 A;  3E1M A;  5K53 A;  2CEI A;  3H7G A;  3E1L A;  2HR5 A;  4PG1 A;  3E1P A;  5ERK A;  1F30 A;  4ISM A;  3SE1 A;  3EGM A;  3PVT B;  3ISF A;  1JGC A;  1L8H A;  2WWX B;  3C1Z A;  2BJY A;  3T9J A;  5C6F A;  3AK9 A;  5JKM G;  4A25 A;  3Q4Q A;  5CMR A;  2ZUR X;  3VV9 A;  3E1Q A;  3IQ1 A;  3FSE A;  3JZA B;  4ZLW A;  2Y44 A;  4LYX A;  3WVW A;  5JDO A;  1MFR A;  1QGH A;  2CHI A;  4CVS A;  3OGH A;  3QD8 A;  5HJF A;  3E1J A;  2V2J A;  2AR0 A;  3R2H A;  4AM2 A;  2JD7 0;  3NOZ X;  3PW8 C;  3PW1 A;  1JRE A;  2QQY A;  4II4 A;  4MUD A;  2GS4 A;  3KXU A;  5D8Q A;  4EVD A;  3ERZ A;  3GGZ A;  3QHC A;  5JAC A;  4M33 A;  4IXK A;  3KA9 A;  1TJO A;  5J8S A;  4CVP A;  2UX1 A;  1SOF A;  1JIG A;  2CN7 A;  5JKM A;  4LQH A;  2ZG9 X;  4W4L B;  1S2Z A;  4DYU A;  5GN8 B;  3R2L A;  2FG8 A;  3F39 A;  4EVE A;  3BVE A;  4ERU A;  1VEL A;  4ZL5 A;  2ZA6 A;  3ES3 A;  1OTK A;  4ETR A;  3KHK A;  5GU1 X;  3QVD A;  2V2L A;  2C2J A;  4ZJK A;  3FRS A;  3PZA A;  1LKO A;  3W54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...