2CF7A

Asp74ala mutant crystal structure for dps-like peroxide resistance protein dpr from streptococcus suis.
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
159
structure length
156
Chain Sequence
ASFSPRPDSKAVLNQAVADLSVAHSILHQVHWYMRGRGFMIWHPKMDEYMEEIDGYLAEMSERLITLGGAPFSTLKEFSENSQLKEVLGDYNVTIEEQLARVVEVFRYLAALFQKGFDVSDEEGDSVTNDIFNVAKASIEKHIWMLQAELGQAPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Peroxide resistance
molecule keywords DPR
publication title Iron incorporation in Streptococcus suis Dps-like peroxide resistance protein Dpr requires mobility in the ferroxidase center and leads to the formation of a ferrihydrite-like core.
pubmed doi rcsb
source organism Streptococcus suis
total genus 66
structure length 156
sequence length 159
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2006-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2cf7A00
3R2HA 3NP0X 3SH6A 3AJQA 4RC5A 3PVYA 4XKSA 3GHQA 4XKTA 1S2ZA 2ZURX 4RC6A 3SE1A 4ZMCA 3KA8A 2D5KA 1JREA 1RCEA 5FFEA 1VEQA 4TOFA 3FI6A 2V2NA 3HL1A 3R2LA 3PWQC 1TK6A 2F7NA 3R2SA 5JKLA 5FFBA 2JD70 1L8HA 3SHXA 3A9QA 2YW6A 3PWFA 1Z6OM 3KX9A 3BT5A 4LPNA 4LQNA 4U3GA 4ISPA 1HRSA 3F36A 2YJKA 3NP2X 3TA8A 3QB9A 4TO9A 1QGHA 2WLAA 2V2OA 4Z3BA 1IESA 5CZUA 3F34A 3BVLA 2FHAA 4EVDA 3E1QA 1S30A 5I4JA 4DASA 1JI5A 4PGIA 3F35A 3UOIA 3H7GA 3PVTB 5D8OA 2XJNA 3Q4OA 1JTSA 2ZA6A 1RYTA 4CYAA 1Z6OA 4KVQA 2Z5QA 1F30A 4CVSA 1H96A 5E2DA 4PGKA 5FFDA 2C2UA 3AK8A 2HTNA 1NF6A 2FG8A 4MUDA 5HJFA 4DYUA 1VLGA 2BJYA 5JKMA 1TJOA 3OGHA 4TW3A 5JACA 2RBDA 1RCGA 1AEWA 1MFRA 3E6RA 1FHAA 3RE7A 2V15A 3O7RA 3OJ5A 3Q4QA 3U90A 3F32A 1BFRA 4LQVA 2IY4A 4ITTA 1N1QA 2C41A 3E1PA 3AF9X 1SQ3A 1L8IA 3F39A 4M35A 4TODA 3UNOA 4DI0A 4E6KA 4IXKA 3PVTA 2V2RA 5J8SA 4ZJKA 1O9IA 2V2SA 1VEIA 1RCIA 3PZAA 3PW8C 3VNXA 4REUA 3KA9A 4M32A 5JKLG 1LKOA 2GYQA 1XZ3A 3WVWA 5D8XA 2FJCA 2V2IA 3QD8A 4CVTA 1LKMA 1R03A 1JYBA 2IB0A 4ZLWA 2Z90A 3UOFA 4AM2A 3BKNA 5HJHA 4MJYA 2X170 3F37A 3PW1B 1EUMA 1QYBA 3FSEA 4DYXA 2CLUA 2CF7A 1YV1A 3WVUA 3GVYA 3E2CA 4YKHA 2FL0A 3BVFA 1IERA 4CYBA 5D8SA 4CVPA 5GN8B 4EVCA 5LS9A 5J9VA 3QVDA 1DVBA 1TKPA 2V2PA 2V2MA 4ETRA 4LQHA 4IWJA 5D8YA 1YUXA 4ZL6A 3IS8A 5IX6A 3PWQA 3WVVA 2VZBA 3AJOA 3QHBA 5LG2A 3SIDA 3HIUA 4MN9A 4ITWA 3WNWA 5JKMG 3IQ1A 4XGSA 4CVRA 5D8RA 3T9JA 1NNQA 1XZ1A 4DZ0A 3IS7A 5ERJA 3E1NA 2ZG7X 5GU0X 2VXXA 3E1OA 4Y08A 1DATA 2JD60 1NF4A 4DYZA 2XKQA 4RC7B 2OH3A 2QF9A 1BCFA 5CMRA 1OTKA 5GU3X 4RC8A 2ZA7A 2C6RA 2V2LA 2FZFA 4XKUA 4RC5B 3PVYB 4EVEA 1VJXA 2CLBA 4A25A 2CIHA 4EVBA 4ISMA 1ZS3A 4LYXA 4M33A 4TOHA 4CMYA 4PG1A 5GOUA 3KA6A 4Z5SA 1JI4A 4OYNA 5D8QA 4R42A 5K52A 3RBCA 1UMNA 3EZ0A 1SOFA 3Q4NA 4KVRA 4II4B 2ZA8A 2CN6A 1MOJA 1YUZA 1B71A 1JGCA 2FFXJ 5J8WA 3E1JA 4TOCA 4PG0A 1ZUJA 2YW7A 2IU2A 5K53A 2FKZA 2C2JA 5LG8A 4M34A 1S3QA 2ZG8X 3R2OA 2YJJA 2W0OA 3RGDA 3RAVA 2HR5A 2WLUA 5C6FA 4TOAA 3R2MA 3KA4A 1TKOA 3PW8A 3ISEA 5E1UA 4LPJA 3F38A 2Y3QA 2ITBA 3KA3A 1O9RA 2CHPA 1NFVA 4QUWA 3KXUA 4TOBA 4ZTTA 2CEIA 4LYUA 1JKVA 2VXIA 5FFAA 1BG7A 3RD0A 2QQYA 3EZUA 3ISFA 2XGWA 4II4A 3BVKA 5LBHA 5GU1X 3R2RA 3E1MA 3R2KA 3QZ3A 2V2JA 3ERZA 3PVRB 1LB3A 4CY9A 1Z4AA 4MKUA 2FG4A 3ES3A 2CN7A 2Z5RA 4LQJA 3A68A 3Q4RA 4P18A 3AF8X 4ZL5A 1UVHA 4TOGA 1VELA 3BVEA 1JKUA 3BVIA 3AK9A 3AF7X 3PW1A 2BKCA 4ZKHA 3FVBA 4AM5A 2OC5A 4CMYV 4ZKWA 3F33A 2XJMA 1KRQA 2Z6MA 4KVSA 3QHCA 4LPMA 3O7SA 5GN8A 3EGMA 2CHIA 4MY7A 4RC6B 3MPSA 2GYDA 3GE4A 3PVRA 4DYYA 5GU2X 2G4HA 5J93A 4DE6A 5ERKA 3E6SA 1F33A 5FFCA 2ZG9X 1RCCA 4AM4A 3AJPA 1JIGA 1J30A 5HQOA 1DPSA 2PYBA 3NOZX 2GS4A 2BW1A 4ZKXA 5D8PA 1GWGA 2C2FA 3KWOA 4ML5A 3E1LA 4ERUA 5AXSA 1LKPA 2WTLA 4TOEA 4RC7A 5FEJA 2BK6A 4IWKA 5CMQA 1RCDA 2Z5PA 2XJOA 2UX1A 2JD80
chains in the Genus database with same CATH superfamily
3R2HA 3NP0X 3SH6A 3AJQA 4RC5A 3PVYA 4XKSA 4X0JA 3GHQA 4XKTA 1S2ZA 2ZURX 4RC6A 3SE1A 4ZMCA 3KA8A 2D5KA 1JREA 1RCEA 5FFEA 1VEQA 3W54A 4TOFA 3FI6A 2V2NA 3HL1A 3R2LA 3PWQC 1TK6A 4WJG4 2F7NA 3R2SA 5JDOB 4KXRB 2G38B 5JKLA 5FFBA 2JD70 1L8HA 3SHXA 3A9QA 2YW6A 3PWFA 1Z6OM 3KX9A 3BT5A 4LPNA 4LQNA 4U3GA 3KHKA 4ISPA 1HRSA 3F36A 2YJKA 3NP2X 2V8UA 3TA8A 3QB9A 4TO9A 1QGHA 2WLAA 2V2OA 4Z3BA 2AR0A 1IESA 5CZUA 3F34A 2V8TA 3BVLA 2FHAA 4EVDA 3E1QA 1S30A 5I4JA 4DASA 1JI5A 4PGIA 3F35A 3UOIA 3H7GA 3PVTB 5D8OA 3JZAB 2XJNA 3Q4OA 1JTSA 2ZA6A 1RYTA 4CYAA 1Z6OA 4KVQA 2Z5QA 1F30A 5JDOA 4CVSA 1H96A 3FRRA 5E2DA 4PGKA 5FFDA 2C2UA 3AK8A 2HTNA 1NF6A 2FG8A 4MUDA 5HJFA 4DYUA 1VLGA 2BJYA 5JKMA 1TJOA 3OGHA 4TW3A 5JACA 2RBDA 1RCGA 1AEWA 1MFRA 3E6RA 1FHAA 3RE7A 2V15A 3O7RA 3OJ5A 3Q4QA 3U90A 3F32A 1BFRA 4LQVA 2IY4A 4ITTA 1N1QA 2C41A 3E1PA 3AF9X 1SQ3A 1L8IA 3F39A 4M35A 4TODA 3UNOA 4DI0A 4E6KA 4IXKA 3PVTA 2V2RA 5J8SA 4ZJKA 1O9IA 2V2SA 1VEIA 1RCIA 3PZAA 4E40A 3PW8C 3VNXA 4REUA 3KA9A 4M32A 5JKLG 1LKOA 2GYQA 1XZ3A 3WVWA 5D8XA 2FJCA 3M6JA 2V2IA 3QD8A 4CVTA 1LKMA 1R03A 1JYBA 2IB0A 4ZLWA 2Z90A 3UOFA 4AM2A 4W4LB 3BKNA 3C1YA 5HJHA 4MJYA 2X170 3F37A 3PW1B 1EUMA 1QYBA 3FSEA 4DYXA 2CLUA 2CF7A 1YV1A 3WVUA 3GVYA 3E2CA 4YKHA 2FL0A 3BVFA 1IERA 4CYBA 5D8SA 4CVPA 3GGZA 5GN8B 4EVCA 5LS9A 3C1ZA 5J9VA 4YVZA 3QVDA 1DVBA 1TKPA 2V2PA 2V2MA 4ETRA 3JZ9A 4LQHA 4IWJA 5D8YA 3D19A 1YUXA 4ZL6A 3IS8A 5IX6A 2N02A 3PWQA 3WVVA 2VZBA 3AJOA 3QHBA 3LKDA 5LG2A 3SIDA 3HIUA 4MN9A 4ITWA 3WNWA 5JKMG 3IQ1A 4XGSA 4CVRA 5D8RA 3T9JA 1NNQA 1XZ1A 4DZ0A 3IS7A 5ERJA 3VV9A 3E1NA 2ZG7X 5GU0X 2VXXA 3E1OA 4Y08A 1DATA 2JD60 1NF4A 4DYZA 2XKQA 4RC7B 2OH3A 2QF9A 1BCFA 5CMRA 1OTKA 5GU3X 4RC8A 3UFBA 2ZA7A 2C6RA 2V2LA 2FZFA 4XKUA 4RC5B 3PVYB 4EVEA 1VJXA 2CLBA 2Y44A 4A25A 2CIHA 4EVBA 4ISMA 1ZS3A 4LYXA 4M33A 4TOHA 4CMYA 4PG1A 5GOUA 3KA6A 4Z5SA 1JI4A 4OYNA 5D8QA 4R42A 4YXJA 5K52A 3RBCA 1UMNA 3EZ0A 3N6OA 1SOFA 3Q4NA 4KVRA 4II4B 2ZA8A 2CN6A 1MOJA 3L0MA 1YUZA 1B71A 1JGCA 2FFXJ 5J8WA 2OKCA 3E1JA 4TOCA 4PG0A 1ZUJA 2YW7A 2IU2A 3C21A 5K53A 2FKZA 2C2JA 5LG8A 3KDQA 4M34A 1S3QA 2ZG8X 3R2OA 2YJJA 2W0OA 3RGDA 3RAVA 3VVAA 2HR5A 2WLUA 2CWLA 4W4KB 5C6FA 4TOAA 3R2MA 3KA4A 1TKOA 3PW8A 3ISEA 5E1UA 4LPJA 3F38A 2Y3QA 2ITBA 3KA3A 1O9RA 2CHPA 1NFVA 4QUWA 3KXUA 4TOBA 4ZTTA 2CEIA 4LYUA 1JKVA 2VXIA 5FFAA 1BG7A 3RD0A 2QQYA 3EZUA 3ISFA 2XGWA 4II4A 3BVKA 5LBHA 5GU1X 3R2RA 3E1MA 3R2KA 3QZ3A 2V2JA 3ERZA 3PVRB 1LB3A 4CY9A 1Z4AA 4MKUA 2FG4A 3ES3A 2CN7A 4YXMA 2Z5RA 3GGYA 4LQJA 2MGYA 3A68A 2WWXB 3Q4RA 4P18A 3AF8X 4ZL5A 1UVHA 4TOGA 1VELA 3BVEA 1JKUA 3BVIA 3AK9A 3AF7X 3PW1A 2BKCA 4ZKHA 3FVBA 4AM5A 2OC5A 4CMYV 4ZKWA 3F33A 2XJMA 4MXPA 1KRQA 2Z6MA 4KVSA 3QHCA 4LPMA 3O7SA 5GN8A 3EGMA 2CHIA 4MY7A 4RC6B 3MPSA 3C23A 2GYDA 3GE4A 3PVRA 4DYYA 5GU2X 2G4HA 5J93A 4DE6A 5ERKA 3E6SA 1F33A 5FFCA 2ZG9X 1RCCA 4AM4A 3AJPA 1JIGA 1J30A 5HQOA 1DPSA 2PYBA 3NOZX 2GS4A 2BW1A 4ZKXA 5D8PA 1GWGA 2C2FA 3KWOA 4ML5A 3E1LA 5HU6D 4ERUA 5AXSA 1LKPA 2WTLA 3DBYA 4TOEA 4RC7A 5FEJA 2BK6A 4IWKA 5CMQA 1RCDA 2Z5PA 3FRSA 3V3KB 2XJOA 2UX1A 2JD80
chains in the Genus database with same CATH topology
3R2HA 3NP0X 3SH6A 3AJQA 4RC5A 3PVYA 4XKSA 4X0JA 3GHQA 4XKTA 1S2ZA 2ZURX 4RC6A 3SE1A 4ZMCA 3KA8A 2D5KA 1JREA 1RCEA 5FFEA 1VEQA 3W54A 4TOFA 3FI6A 2V2NA 3HL1A 3R2LA 3PWQC 1TK6A 4WJG4 2F7NA 3R2SA 5JDOB 4KXRB 2G38B 5JKLA 5FFBA 2JD70 1L8HA 3SHXA 3A9QA 2YW6A 3PWFA 1Z6OM 3KX9A 3BT5A 4LPNA 4LQNA 4U3GA 3KHKA 4ISPA 1HRSA 3F36A 2YJKA 3NP2X 2V8UA 3TA8A 3QB9A 4TO9A 1QGHA 2WLAA 2V2OA 4Z3BA 2AR0A 1IESA 5CZUA 3F34A 2V8TA 3BVLA 2FHAA 4EVDA 3E1QA 1S30A 5I4JA 4DASA 1JI5A 4PGIA 3F35A 3UOIA 3H7GA 3PVTB 5D8OA 3JZAB 2XJNA 3Q4OA 1JTSA 2ZA6A 1RYTA 4CYAA 1Z6OA 4KVQA 2Z5QA 1F30A 5JDOA 4CVSA 1H96A 3FRRA 5E2DA 4PGKA 5FFDA 2C2UA 3AK8A 2HTNA 1NF6A 2FG8A 4MUDA 5HJFA 4DYUA 1VLGA 2BJYA 5JKMA 1TJOA 3OGHA 4TW3A 5JACA 2RBDA 1RCGA 1AEWA 1MFRA 3E6RA 1FHAA 3RE7A 2V15A 3O7RA 3OJ5A 3Q4QA 3U90A 3F32A 1BFRA 4LQVA 2IY4A 4ITTA 1N1QA 2C41A 3E1PA 3AF9X 1SQ3A 1L8IA 3F39A 4M35A 4TODA 3UNOA 4DI0A 4E6KA 4IXKA 3PVTA 2V2RA 5J8SA 4ZJKA 1O9IA 2V2SA 1VEIA 1RCIA 3PZAA 4E40A 3PW8C 3VNXA 4REUA 3KA9A 4M32A 5JKLG 1LKOA 2GYQA 1XZ3A 3WVWA 5D8XA 2FJCA 3M6JA 2V2IA 3QD8A 4CVTA 1LKMA 1R03A 1JYBA 2IB0A 4ZLWA 2Z90A 3UOFA 4AM2A 4W4LB 3BKNA 3C1YA 5HJHA 4MJYA 2X170 3F37A 3PW1B 1EUMA 1QYBA 3FSEA 4DYXA 2CLUA 2CF7A 1YV1A 3WVUA 3GVYA 3E2CA 4YKHA 2FL0A 3BVFA 1IERA 4CYBA 5D8SA 4CVPA 3GGZA 5GN8B 4EVCA 5LS9A 3C1ZA 5J9VA 4YVZA 3QVDA 1DVBA 1TKPA 2V2PA 2V2MA 4ETRA 3JZ9A 4LQHA 4IWJA 5D8YA 3D19A 1YUXA 4ZL6A 3IS8A 5IX6A 2N02A 3PWQA 3WVVA 2VZBA 3AJOA 3QHBA 3LKDA 5LG2A 3SIDA 3HIUA 4MN9A 4ITWA 3WNWA 5JKMG 3IQ1A 4XGSA 4CVRA 5D8RA 3T9JA 1NNQA 1XZ1A 4DZ0A 3IS7A 5ERJA 3VV9A 3E1NA 2ZG7X 5GU0X 2VXXA 3E1OA 4Y08A 1DATA 2JD60 1NF4A 4DYZA 2XKQA 4RC7B 2OH3A 2QF9A 1BCFA 5CMRA 1OTKA 5GU3X 4RC8A 3UFBA 2ZA7A 2C6RA 2V2LA 2FZFA 4XKUA 4RC5B 3PVYB 4EVEA 1VJXA 2CLBA 2Y44A 4A25A 2CIHA 4EVBA 4ISMA 1ZS3A 4LYXA 4M33A 4TOHA 4CMYA 4PG1A 5GOUA 3KA6A 4Z5SA 1JI4A 4OYNA 5D8QA 4R42A 4YXJA 5K52A 3RBCA 1UMNA 3EZ0A 3N6OA 1SOFA 3Q4NA 4KVRA 4II4B 2ZA8A 2CN6A 1MOJA 3L0MA 1YUZA 1B71A 1JGCA 2FFXJ 5J8WA 2OKCA 3E1JA 4TOCA 4PG0A 1ZUJA 2YW7A 2IU2A 3C21A 5K53A 2FKZA 2C2JA 5LG8A 3KDQA 4M34A 1S3QA 2ZG8X 3R2OA 2YJJA 2W0OA 3RGDA 3RAVA 3VVAA 2HR5A 2WLUA 2CWLA 4W4KB 5C6FA 4TOAA 3R2MA 3KA4A 1TKOA 3PW8A 3ISEA 5E1UA 4LPJA 3F38A 2Y3QA 2ITBA 3KA3A 1O9RA 2CHPA 1NFVA 4QUWA 3KXUA 4TOBA 4ZTTA 2CEIA 4LYUA 1JKVA 2VXIA 5FFAA 1BG7A 3RD0A 2QQYA 3EZUA 3ISFA 2XGWA 4II4A 3BVKA 5LBHA 5GU1X 3R2RA 3E1MA 3R2KA 3QZ3A 2V2JA 3ERZA 3PVRB 1LB3A 4CY9A 1Z4AA 4MKUA 2FG4A 3ES3A 2CN7A 4YXMA 2Z5RA 3GGYA 4LQJA 2MGYA 3A68A 2WWXB 3Q4RA 4P18A 3AF8X 4ZL5A 1UVHA 4TOGA 1VELA 3BVEA 1JKUA 3BVIA 3AK9A 3AF7X 3PW1A 2BKCA 4ZKHA 3FVBA 4AM5A 2OC5A 4CMYV 4ZKWA 3F33A 2XJMA 4MXPA 1KRQA 2Z6MA 4KVSA 3QHCA 4LPMA 3O7SA 5GN8A 3EGMA 2CHIA 4MY7A 4RC6B 3MPSA 3C23A 2GYDA 3GE4A 3PVRA 4DYYA 5GU2X 2G4HA 5J93A 4DE6A 5ERKA 3E6SA 1F33A 5FFCA 2ZG9X 1RCCA 4AM4A 3AJPA 1JIGA 1J30A 5HQOA 1DPSA 2PYBA 3NOZX 2GS4A 2BW1A 4ZKXA 5D8PA 1GWGA 2C2FA 3KWOA 4ML5A 3E1LA 5HU6D 4ERUA 5AXSA 1LKPA 2WTLA 3DBYA 4TOEA 4RC7A 5FEJA 2BK6A 4IWKA 5CMQA 1RCDA 2Z5PA 3FRSA 3V3KB 2XJOA 2UX1A 2JD80
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R2H A;  3NP0 X;  3SH6 A;  3AJQ A;  4RC5 A;  3PVY A;  4XKS A;  3GHQ A;  4XKT A;  1S2Z A;  2ZUR X;  4RC6 A;  3SE1 A;  4ZMC A;  3KA8 A;  2D5K A;  1JRE A;  1RCE A;  5FFE A;  1VEQ A;  4TOF A;  3FI6 A;  2V2N A;  3HL1 A;  3R2L A;  3PWQ C;  1TK6 A;  2F7N A;  3R2S A;  5JKL A;  5FFB A;  2JD7 0;  1L8H A;  3SHX A;  3A9Q A;  2YW6 A;  3PWF A;  1Z6O M;  3KX9 A;  3BT5 A;  4LPN A;  4LQN A;  4U3G A;  4ISP A;  1HRS A;  3F36 A;  2YJK A;  3NP2 X;  3TA8 A;  3QB9 A;  4TO9 A;  1QGH A;  2WLA A;  2V2O A;  4Z3B A;  1IES A;  5CZU A;  3F34 A;  3BVL A;  2FHA A;  4EVD A;  3E1Q A;  1S30 A;  5I4J A;  4DAS A;  1JI5 A;  4PGI A;  3F35 A;  3UOI A;  3H7G A;  3PVT B;  5D8O A;  2XJN A;  3Q4O A;  1JTS A;  2ZA6 A;  1RYT A;  4CYA A;  1Z6O A;  4KVQ A;  2Z5Q A;  1F30 A;  4CVS A;  1H96 A;  5E2D A;  4PGK A;  5FFD A;  2C2U A;  3AK8 A;  2HTN A;  1NF6 A;  2FG8 A;  4MUD A;  5HJF A;  4DYU A;  1VLG A;  2BJY A;  5JKM A;  1TJO A;  3OGH A;  4TW3 A;  5JAC A;  2RBD A;  1RCG A;  1AEW A;  1MFR A;  3E6R A;  1FHA A;  3RE7 A;  2V15 A;  3O7R A;  3OJ5 A;  3Q4Q A;  3U90 A;  3F32 A;  1BFR A;  4LQV A;  2IY4 A;  4ITT A;  1N1Q A;  2C41 A;  3E1P A;  3AF9 X;  1SQ3 A;  1L8I A;  3F39 A;  4M35 A;  4TOD A;  3UNO A;  4DI0 A;  4E6K A;  4IXK A;  3PVT A;  2V2R A;  5J8S A;  4ZJK A;  1O9I A;  2V2S A;  1VEI A;  1RCI A;  3PZA A;  3PW8 C;  3VNX A;  4REU A;  3KA9 A;  4M32 A;  5JKL G;  1LKO A;  2GYQ A;  1XZ3 A;  3WVW A;  5D8X A;  2FJC A;  2V2I A;  3QD8 A;  4CVT A;  1LKM A;  1R03 A;  1JYB A;  2IB0 A;  4ZLW A;  2Z90 A;  3UOF A;  4AM2 A;  3BKN A;  5HJH A;  4MJY A;  2X17 0;  3F37 A;  3PW1 B;  1EUM A;  1QYB A;  3FSE A;  4DYX A;  2CLU A;  2CF7 A;  1YV1 A;  3WVU A;  3GVY A;  3E2C A;  4YKH A;  2FL0 A;  3BVF A;  1IER A;  4CYB A;  5D8S A;  4CVP A;  5GN8 B;  4EVC A;  5LS9 A;  5J9V A;  3QVD A;  1DVB A;  1TKP A;  2V2P A;  2V2M A;  4ETR A;  4LQH A;  4IWJ A;  5D8Y A;  1YUX A;  4ZL6 A;  3IS8 A;  5IX6 A;  3PWQ A;  3WVV A;  2VZB A;  3AJO A;  3QHB A;  5LG2 A;  3SID A;  3HIU A;  4MN9 A;  4ITW A;  3WNW A;  5JKM G;  3IQ1 A;  4XGS A;  4CVR A;  5D8R A;  3T9J A;  1NNQ A;  1XZ1 A;  4DZ0 A;  3IS7 A;  5ERJ A;  3E1N A;  2ZG7 X;  5GU0 X;  2VXX A;  3E1O A;  4Y08 A;  1DAT A;  2JD6 0;  1NF4 A;  4DYZ A;  2XKQ A;  4RC7 B;  2OH3 A;  2QF9 A;  1BCF A;  5CMR A;  1OTK A;  5GU3 X;  4RC8 A;  2ZA7 A;  2C6R A;  2V2L A;  2FZF A;  4XKU A;  4RC5 B;  3PVY B;  4EVE A;  1VJX A;  2CLB A;  4A25 A;  2CIH A;  4EVB A;  4ISM A;  1ZS3 A;  4LYX A;  4M33 A;  4TOH A;  4CMY A;  4PG1 A;  5GOU A;  3KA6 A;  4Z5S A;  1JI4 A;  4OYN A;  5D8Q A;  4R42 A;  5K52 A;  3RBC A;  1UMN A;  3EZ0 A;  1SOF A;  3Q4N A;  4KVR A;  4II4 B;  2ZA8 A;  2CN6 A;  1MOJ A;  1YUZ A;  1B71 A;  1JGC A;  2FFX J;  5J8W A;  3E1J A;  4TOC A;  4PG0 A;  1ZUJ A;  2YW7 A;  2IU2 A;  5K53 A;  2FKZ A;  2C2J A;  5LG8 A;  4M34 A;  1S3Q A;  2ZG8 X;  3R2O A;  2YJJ A;  2W0O A;  3RGD A;  3RAV A;  2HR5 A;  2WLU A;  5C6F A;  4TOA A;  3R2M A;  3KA4 A;  1TKO A;  3PW8 A;  3ISE A;  5E1U A;  4LPJ A;  3F38 A;  2Y3Q A;  2ITB A;  3KA3 A;  1O9R A;  2CHP A;  1NFV A;  4QUW A;  3KXU A;  4TOB A;  4ZTT A;  2CEI A;  4LYU A;  1JKV A;  2VXI A;  5FFA A;  1BG7 A;  3RD0 A;  2QQY A;  3EZU A;  3ISF A;  2XGW A;  4II4 A;  3BVK A;  5LBH A;  5GU1 X;  3R2R A;  3E1M A;  3R2K A;  3QZ3 A;  2V2J A;  3ERZ A;  3PVR B;  1LB3 A;  4CY9 A;  1Z4A A;  4MKU A;  2FG4 A;  3ES3 A;  2CN7 A;  2Z5R A;  4LQJ A;  3A68 A;  3Q4R A;  4P18 A;  3AF8 X;  4ZL5 A;  1UVH A;  4TOG A;  1VEL A;  3BVE A;  1JKU A;  3BVI A;  3AK9 A;  3AF7 X;  3PW1 A;  2BKC A;  4ZKH A;  3FVB A;  4AM5 A;  2OC5 A;  4CMY V;  4ZKW A;  3F33 A;  2XJM A;  1KRQ A;  2Z6M A;  4KVS A;  3QHC A;  4LPM A;  3O7S A;  5GN8 A;  3EGM A;  2CHI A;  4MY7 A;  4RC6 B;  3MPS A;  2GYD A;  3GE4 A;  3PVR A;  4DYY A;  5GU2 X;  2G4H A;  5J93 A;  4DE6 A;  5ERK A;  3E6S A;  1F33 A;  5FFC A;  2ZG9 X;  1RCC A;  4AM4 A;  3AJP A;  1JIG A;  1J30 A;  5HQO A;  1DPS A;  2PYB A;  3NOZ X;  2GS4 A;  2BW1 A;  4ZKX A;  5D8P A;  1GWG A;  2C2F A;  3KWO A;  4ML5 A;  3E1L A;  4ERU A;  5AXS A;  1LKP A;  2WTL A;  4TOE A;  4RC7 A;  5FEJ A;  2BK6 A;  4IWK A;  5CMQ A;  1RCD A;  2Z5P A;  2XJO A;  2UX1 A;  2JD8 0; 
#chains in the Genus database with same CATH topology
 3R2H A;  3NP0 X;  3SH6 A;  3AJQ A;  4RC5 A;  3PVY A;  4XKS A;  4X0J A;  3GHQ A;  4XKT A;  1S2Z A;  2ZUR X;  4RC6 A;  3SE1 A;  4ZMC A;  3KA8 A;  2D5K A;  1JRE A;  1RCE A;  5FFE A;  1VEQ A;  3W54 A;  4TOF A;  3FI6 A;  2V2N A;  3HL1 A;  3R2L A;  3PWQ C;  1TK6 A;  4WJG 4;  2F7N A;  3R2S A;  5JDO B;  4KXR B;  2G38 B;  5JKL A;  5FFB A;  2JD7 0;  1L8H A;  3SHX A;  3A9Q A;  2YW6 A;  3PWF A;  1Z6O M;  3KX9 A;  3BT5 A;  4LPN A;  4LQN A;  4U3G A;  3KHK A;  4ISP A;  1HRS A;  3F36 A;  2YJK A;  3NP2 X;  2V8U A;  3TA8 A;  3QB9 A;  4TO9 A;  1QGH A;  2WLA A;  2V2O A;  4Z3B A;  2AR0 A;  1IES A;  5CZU A;  3F34 A;  2V8T A;  3BVL A;  2FHA A;  4EVD A;  3E1Q A;  1S30 A;  5I4J A;  4DAS A;  1JI5 A;  4PGI A;  3F35 A;  3UOI A;  3H7G A;  3PVT B;  5D8O A;  3JZA B;  2XJN A;  3Q4O A;  1JTS A;  2ZA6 A;  1RYT A;  4CYA A;  1Z6O A;  4KVQ A;  2Z5Q A;  1F30 A;  5JDO A;  4CVS A;  1H96 A;  3FRR A;  5E2D A;  4PGK A;  5FFD A;  2C2U A;  3AK8 A;  2HTN A;  1NF6 A;  2FG8 A;  4MUD A;  5HJF A;  4DYU A;  1VLG A;  2BJY A;  5JKM A;  1TJO A;  3OGH A;  4TW3 A;  5JAC A;  2RBD A;  1RCG A;  1AEW A;  1MFR A;  3E6R A;  1FHA A;  3RE7 A;  2V15 A;  3O7R A;  3OJ5 A;  3Q4Q A;  3U90 A;  3F32 A;  1BFR A;  4LQV A;  2IY4 A;  4ITT A;  1N1Q A;  2C41 A;  3E1P A;  3AF9 X;  1SQ3 A;  1L8I A;  3F39 A;  4M35 A;  4TOD A;  3UNO A;  4DI0 A;  4E6K A;  4IXK A;  3PVT A;  2V2R A;  5J8S A;  4ZJK A;  1O9I A;  2V2S A;  1VEI A;  1RCI A;  3PZA A;  4E40 A;  3PW8 C;  3VNX A;  4REU A;  3KA9 A;  4M32 A;  5JKL G;  1LKO A;  2GYQ A;  1XZ3 A;  3WVW A;  5D8X A;  2FJC A;  3M6J A;  2V2I A;  3QD8 A;  4CVT A;  1LKM A;  1R03 A;  1JYB A;  2IB0 A;  4ZLW A;  2Z90 A;  3UOF A;  4AM2 A;  4W4L B;  3BKN A;  3C1Y A;  5HJH A;  4MJY A;  2X17 0;  3F37 A;  3PW1 B;  1EUM A;  1QYB A;  3FSE A;  4DYX A;  2CLU A;  2CF7 A;  1YV1 A;  3WVU A;  3GVY A;  3E2C A;  4YKH A;  2FL0 A;  3BVF A;  1IER A;  4CYB A;  5D8S A;  4CVP A;  3GGZ A;  5GN8 B;  4EVC A;  5LS9 A;  3C1Z A;  5J9V A;  4YVZ A;  3QVD A;  1DVB A;  1TKP A;  2V2P A;  2V2M A;  4ETR A;  3JZ9 A;  4LQH A;  4IWJ A;  5D8Y A;  3D19 A;  1YUX A;  4ZL6 A;  3IS8 A;  5IX6 A;  2N02 A;  3PWQ A;  3WVV A;  2VZB A;  3AJO A;  3QHB A;  3LKD A;  5LG2 A;  3SID A;  3HIU A;  4MN9 A;  4ITW A;  3WNW A;  5JKM G;  3IQ1 A;  4XGS A;  4CVR A;  5D8R A;  3T9J A;  1NNQ A;  1XZ1 A;  4DZ0 A;  3IS7 A;  5ERJ A;  3VV9 A;  3E1N A;  2ZG7 X;  5GU0 X;  2VXX A;  3E1O A;  4Y08 A;  1DAT A;  2JD6 0;  1NF4 A;  4DYZ A;  2XKQ A;  4RC7 B;  2OH3 A;  2QF9 A;  1BCF A;  5CMR A;  1OTK A;  5GU3 X;  4RC8 A;  3UFB A;  2ZA7 A;  2C6R A;  2V2L A;  2FZF A;  4XKU A;  4RC5 B;  3PVY B;  4EVE A;  1VJX A;  2CLB A;  2Y44 A;  4A25 A;  2CIH A;  4EVB A;  4ISM A;  1ZS3 A;  4LYX A;  4M33 A;  4TOH A;  4CMY A;  4PG1 A;  5GOU A;  3KA6 A;  4Z5S A;  1JI4 A;  4OYN A;  5D8Q A;  4R42 A;  4YXJ A;  5K52 A;  3RBC A;  1UMN A;  3EZ0 A;  3N6O A;  1SOF A;  3Q4N A;  4KVR A;  4II4 B;  2ZA8 A;  2CN6 A;  1MOJ A;  3L0M A;  1YUZ A;  1B71 A;  1JGC A;  2FFX J;  5J8W A;  2OKC A;  3E1J A;  4TOC A;  4PG0 A;  1ZUJ A;  2YW7 A;  2IU2 A;  3C21 A;  5K53 A;  2FKZ A;  2C2J A;  5LG8 A;  3KDQ A;  4M34 A;  1S3Q A;  2ZG8 X;  3R2O A;  2YJJ A;  2W0O A;  3RGD A;  3RAV A;  3VVA A;  2HR5 A;  2WLU A;  2CWL A;  4W4K B;  5C6F A;  4TOA A;  3R2M A;  3KA4 A;  1TKO A;  3PW8 A;  3ISE A;  5E1U A;  4LPJ A;  3F38 A;  2Y3Q A;  2ITB A;  3KA3 A;  1O9R A;  2CHP A;  1NFV A;  4QUW A;  3KXU A;  4TOB A;  4ZTT A;  2CEI A;  4LYU A;  1JKV A;  2VXI A;  5FFA A;  1BG7 A;  3RD0 A;  2QQY A;  3EZU A;  3ISF A;  2XGW A;  4II4 A;  3BVK A;  5LBH A;  5GU1 X;  3R2R A;  3E1M A;  3R2K A;  3QZ3 A;  2V2J A;  3ERZ A;  3PVR B;  1LB3 A;  4CY9 A;  1Z4A A;  4MKU A;  2FG4 A;  3ES3 A;  2CN7 A;  4YXM A;  2Z5R A;  3GGY A;  4LQJ A;  2MGY A;  3A68 A;  2WWX B;  3Q4R A;  4P18 A;  3AF8 X;  4ZL5 A;  1UVH A;  4TOG A;  1VEL A;  3BVE A;  1JKU A;  3BVI A;  3AK9 A;  3AF7 X;  3PW1 A;  2BKC A;  4ZKH A;  3FVB A;  4AM5 A;  2OC5 A;  4CMY V;  4ZKW A;  3F33 A;  2XJM A;  4MXP A;  1KRQ A;  2Z6M A;  4KVS A;  3QHC A;  4LPM A;  3O7S A;  5GN8 A;  3EGM A;  2CHI A;  4MY7 A;  4RC6 B;  3MPS A;  3C23 A;  2GYD A;  3GE4 A;  3PVR A;  4DYY A;  5GU2 X;  2G4H A;  5J93 A;  4DE6 A;  5ERK A;  3E6S A;  1F33 A;  5FFC A;  2ZG9 X;  1RCC A;  4AM4 A;  3AJP A;  1JIG A;  1J30 A;  5HQO A;  1DPS A;  2PYB A;  3NOZ X;  2GS4 A;  2BW1 A;  4ZKX A;  5D8P A;  1GWG A;  2C2F A;  3KWO A;  4ML5 A;  3E1L A;  5HU6 D;  4ERU A;  5AXS A;  1LKP A;  2WTL A;  3DBY A;  4TOE A;  4RC7 A;  5FEJ A;  2BK6 A;  4IWK A;  5CMQ A;  1RCD A;  2Z5P A;  3FRS A;  3V3K B;  2XJO A;  2UX1 A;  2JD8 0; 
#chains in the Genus database with same CATH homology
 3R2H A;  3NP0 X;  3SH6 A;  3AJQ A;  4RC5 A;  3PVY A;  4XKS A;  4X0J A;  3GHQ A;  4XKT A;  1S2Z A;  2ZUR X;  4RC6 A;  3SE1 A;  4ZMC A;  3KA8 A;  2D5K A;  1JRE A;  1RCE A;  5FFE A;  1VEQ A;  3W54 A;  4TOF A;  3FI6 A;  2V2N A;  3HL1 A;  3R2L A;  3PWQ C;  1TK6 A;  4WJG 4;  2F7N A;  3R2S A;  5JDO B;  4KXR B;  2G38 B;  5JKL A;  5FFB A;  2JD7 0;  1L8H A;  3SHX A;  3A9Q A;  2YW6 A;  3PWF A;  1Z6O M;  3KX9 A;  3BT5 A;  4LPN A;  4LQN A;  4U3G A;  3KHK A;  4ISP A;  1HRS A;  3F36 A;  2YJK A;  3NP2 X;  2V8U A;  3TA8 A;  3QB9 A;  4TO9 A;  1QGH A;  2WLA A;  2V2O A;  4Z3B A;  2AR0 A;  1IES A;  5CZU A;  3F34 A;  2V8T A;  3BVL A;  2FHA A;  4EVD A;  3E1Q A;  1S30 A;  5I4J A;  4DAS A;  1JI5 A;  4PGI A;  3F35 A;  3UOI A;  3H7G A;  3PVT B;  5D8O A;  3JZA B;  2XJN A;  3Q4O A;  1JTS A;  2ZA6 A;  1RYT A;  4CYA A;  1Z6O A;  4KVQ A;  2Z5Q A;  1F30 A;  5JDO A;  4CVS A;  1H96 A;  3FRR A;  5E2D A;  4PGK A;  5FFD A;  2C2U A;  3AK8 A;  2HTN A;  1NF6 A;  2FG8 A;  4MUD A;  5HJF A;  4DYU A;  1VLG A;  2BJY A;  5JKM A;  1TJO A;  3OGH A;  4TW3 A;  5JAC A;  2RBD A;  1RCG A;  1AEW A;  1MFR A;  3E6R A;  1FHA A;  3RE7 A;  2V15 A;  3O7R A;  3OJ5 A;  3Q4Q A;  3U90 A;  3F32 A;  1BFR A;  4LQV A;  2IY4 A;  4ITT A;  1N1Q A;  2C41 A;  3E1P A;  3AF9 X;  1SQ3 A;  1L8I A;  3F39 A;  4M35 A;  4TOD A;  3UNO A;  4DI0 A;  4E6K A;  4IXK A;  3PVT A;  2V2R A;  5J8S A;  4ZJK A;  1O9I A;  2V2S A;  1VEI A;  1RCI A;  3PZA A;  4E40 A;  3PW8 C;  3VNX A;  4REU A;  3KA9 A;  4M32 A;  5JKL G;  1LKO A;  2GYQ A;  1XZ3 A;  3WVW A;  5D8X A;  2FJC A;  3M6J A;  2V2I A;  3QD8 A;  4CVT A;  1LKM A;  1R03 A;  1JYB A;  2IB0 A;  4ZLW A;  2Z90 A;  3UOF A;  4AM2 A;  4W4L B;  3BKN A;  3C1Y A;  5HJH A;  4MJY A;  2X17 0;  3F37 A;  3PW1 B;  1EUM A;  1QYB A;  3FSE A;  4DYX A;  2CLU A;  2CF7 A;  1YV1 A;  3WVU A;  3GVY A;  3E2C A;  4YKH A;  2FL0 A;  3BVF A;  1IER A;  4CYB A;  5D8S A;  4CVP A;  3GGZ A;  5GN8 B;  4EVC A;  5LS9 A;  3C1Z A;  5J9V A;  4YVZ A;  3QVD A;  1DVB A;  1TKP A;  2V2P A;  2V2M A;  4ETR A;  3JZ9 A;  4LQH A;  4IWJ A;  5D8Y A;  3D19 A;  1YUX A;  4ZL6 A;  3IS8 A;  5IX6 A;  2N02 A;  3PWQ A;  3WVV A;  2VZB A;  3AJO A;  3QHB A;  3LKD A;  5LG2 A;  3SID A;  3HIU A;  4MN9 A;  4ITW A;  3WNW A;  5JKM G;  3IQ1 A;  4XGS A;  4CVR A;  5D8R A;  3T9J A;  1NNQ A;  1XZ1 A;  4DZ0 A;  3IS7 A;  5ERJ A;  3VV9 A;  3E1N A;  2ZG7 X;  5GU0 X;  2VXX A;  3E1O A;  4Y08 A;  1DAT A;  2JD6 0;  1NF4 A;  4DYZ A;  2XKQ A;  4RC7 B;  2OH3 A;  2QF9 A;  1BCF A;  5CMR A;  1OTK A;  5GU3 X;  4RC8 A;  3UFB A;  2ZA7 A;  2C6R A;  2V2L A;  2FZF A;  4XKU A;  4RC5 B;  3PVY B;  4EVE A;  1VJX A;  2CLB A;  2Y44 A;  4A25 A;  2CIH A;  4EVB A;  4ISM A;  1ZS3 A;  4LYX A;  4M33 A;  4TOH A;  4CMY A;  4PG1 A;  5GOU A;  3KA6 A;  4Z5S A;  1JI4 A;  4OYN A;  5D8Q A;  4R42 A;  4YXJ A;  5K52 A;  3RBC A;  1UMN A;  3EZ0 A;  3N6O A;  1SOF A;  3Q4N A;  4KVR A;  4II4 B;  2ZA8 A;  2CN6 A;  1MOJ A;  3L0M A;  1YUZ A;  1B71 A;  1JGC A;  2FFX J;  5J8W A;  2OKC A;  3E1J A;  4TOC A;  4PG0 A;  1ZUJ A;  2YW7 A;  2IU2 A;  3C21 A;  5K53 A;  2FKZ A;  2C2J A;  5LG8 A;  3KDQ A;  4M34 A;  1S3Q A;  2ZG8 X;  3R2O A;  2YJJ A;  2W0O A;  3RGD A;  3RAV A;  3VVA A;  2HR5 A;  2WLU A;  2CWL A;  4W4K B;  5C6F A;  4TOA A;  3R2M A;  3KA4 A;  1TKO A;  3PW8 A;  3ISE A;  5E1U A;  4LPJ A;  3F38 A;  2Y3Q A;  2ITB A;  3KA3 A;  1O9R A;  2CHP A;  1NFV A;  4QUW A;  3KXU A;  4TOB A;  4ZTT A;  2CEI A;  4LYU A;  1JKV A;  2VXI A;  5FFA A;  1BG7 A;  3RD0 A;  2QQY A;  3EZU A;  3ISF A;  2XGW A;  4II4 A;  3BVK A;  5LBH A;  5GU1 X;  3R2R A;  3E1M A;  3R2K A;  3QZ3 A;  2V2J A;  3ERZ A;  3PVR B;  1LB3 A;  4CY9 A;  1Z4A A;  4MKU A;  2FG4 A;  3ES3 A;  2CN7 A;  4YXM A;  2Z5R A;  3GGY A;  4LQJ A;  2MGY A;  3A68 A;  2WWX B;  3Q4R A;  4P18 A;  3AF8 X;  4ZL5 A;  1UVH A;  4TOG A;  1VEL A;  3BVE A;  1JKU A;  3BVI A;  3AK9 A;  3AF7 X;  3PW1 A;  2BKC A;  4ZKH A;  3FVB A;  4AM5 A;  2OC5 A;  4CMY V;  4ZKW A;  3F33 A;  2XJM A;  4MXP A;  1KRQ A;  2Z6M A;  4KVS A;  3QHC A;  4LPM A;  3O7S A;  5GN8 A;  3EGM A;  2CHI A;  4MY7 A;  4RC6 B;  3MPS A;  3C23 A;  2GYD A;  3GE4 A;  3PVR A;  4DYY A;  5GU2 X;  2G4H A;  5J93 A;  4DE6 A;  5ERK A;  3E6S A;  1F33 A;  5FFC A;  2ZG9 X;  1RCC A;  4AM4 A;  3AJP A;  1JIG A;  1J30 A;  5HQO A;  1DPS A;  2PYB A;  3NOZ X;  2GS4 A;  2BW1 A;  4ZKX A;  5D8P A;  1GWG A;  2C2F A;  3KWO A;  4ML5 A;  3E1L A;  5HU6 D;  4ERU A;  5AXS A;  1LKP A;  2WTL A;  3DBY A;  4TOE A;  4RC7 A;  5FEJ A;  2BK6 A;  4IWK A;  5CMQ A;  1RCD A;  2Z5P A;  3FRS A;  3V3K B;  2XJO A;  2UX1 A;  2JD8 0; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...