2JD70

Crystal structure of the fe-soaked ferritin from the hyperthermophilic archaeal anaerobe pyrococcus furiosus
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
167
structure length
167
Chain Sequence
MLSERMLKALNDQLNRELYSAYLYFAMAAYFEDLGLEGFANWMKAQAEEEIGHALRFYNYIYDRNGRVELDEIPKPPKEWESPLKAFEAAYEHEKFISKSIYELAALAEEEKDYSTRAFLEWFINEQVEEEASVKKILDKLKFAKDSPQILFMLDKELSARAPKLPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords FERRITIN HOMOLOG
publication title Crystal Structure of the Ferritin from the Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 75
structure length 167
sequence length 167
chains with identical sequence 1, 2, 3, 4, 5, 6, 7, 8, 9, A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z
ec nomenclature
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
0 PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2jd7000
3KWOA 4CYBA 3QZ3A 2OH3A 1R03A 2ZA7A 2JD80 5J8WA 5JKMG 4ZL5A 2C41A 3PW1B 4DE6A 5FFAA 1JYBA 1S2ZA 1KRQA 4TOAA 1QYBA 4II4A 2YW7A 3PVRA 2V2NA 2FG8A 4TOFA 5K52A 5ERKA 3ES3A 2ZG8X 5GN8B 1JKVA 5GU3X 3IQ1A 5C6FA 1YUXA 3PZAA 2HR5A 4DI0A 1H96A 3SIDA 1XZ3A 1IESA 2V2OA 3KX9A 2BKCA 4XKUA 1TKPA 3PVRB 3E2CA 5J93A 3Q4RA 1JREA 3F38A 3E1JA 4CY9A 3AF8X 3BVEA 2FG4A 3R2KA 2CIHA 2HTNA 4CVPA 2Z5PA 3BVLA 1L8IA 5GOUA 2Z5RA 3PWQC 3RD0A 4MUDA 1UMNA 3EGMA 1Z6OM 1RCDA 3HL1A 3AK8A 1J30A 2G4HA 3BVFA 1SQ3A 1JIGA 3F37A 3F36A 4Y08A 3FSEA 4KVQA 2XJMA 1O9IA 1TK6A 4LYUA 5E2DA 1JTSA 4RC6B 1N1QA 5IX6A 1NNQA 4M33A 4R42A 3VNXA 3UNOA 3E1OA 2BK6A 3PW8C 3MPSA 3GHQA 2ZG9X 3Q4OA 4ISPA 4PGKA 4M32A 2FKZA 4DYXA 3Q4QA 3O7RA 3E1LA 3RAVA 3UOFA 3ERZA 4LPMA 3WVVA 2CN6A 2XJNA 1F33A 3A9QA 4MY7A 3HIUA 5CMQA 3H7GA 2V15A 4DASA 4DZ0A 1UVHA 2YJKA 2JD70 5FFBA 3IS8A 2W0OA 2GYQA 4XKTA 3R2HA 4IWKA 3R2LA 3SH6A 3SHXA 4U3GA 2V2PA 4ITTA 5ERJA 3BKNA 1Z4AA 2V2SA 1O9RA 1S30A 4PGIA 5FFDA 2C2UA 4M35A 4CVRA 2QQYA 1BG7A 1B71A 4ZKXA 4TOEA 4CVSA 1MOJA 1ZS3A 4REUA 3RBCA 3E1PA 1JGCA 2Z90A 4ITWA 4YKHA 5HJHA 2V2IA 2RBDA 5D8QA 2VZBA 1RCEA 2C2JA 2CLBA 3IS7A 3R2MA 4LQJA 1Z6OA 2BW1A 2YJJA 3QD8A 4CMYV 2GS4A 1S3QA 4ETRA 4EVCA 4KVSA 4II4B 4KVRA 3AF7X 3PVTA 1RCCA 2C2FA 1F30A 3F34A 5LG2A 3OJ5A 1BFRA 5FEJA 2V2RA 4CVTA 1JI4A 5D8YA 3PWQA 2CEIA 3SE1A 3ISEA 4AM2A 3GVYA 1VELA 5FFCA 1QGHA 2ZA8A 3BT5A 4ZLWA 2UX1A 2WTLA 1MFRA 2FHAA 1VJXA 5K53A 4DYYA 2V2JA 2IY4A 3EZUA 3E1QA 4ZKHA 4DYZA 1RCGA 4TODA 1JKUA 3ISFA 5LS9A 3NP0X 3NP2X 3PVTB 3BVIA 2IU2A 3PVYA 4IXKA 4EVDA 1GWGA 2JD60 4LPNA 5LBHA 5CMRA 2PYBA 1EUMA 3KXUA 3QHCA 4TOHA 5J8SA 4ZMCA 1JI5A 4ZTTA 4Z3BA 4XGSA 3T9JA 1RCIA 2CHPA 4E6KA 2IB0A 5D8PA 3WVWA 5JKLG 2CLUA 3R2OA 4AM5A 1NF6A 5J9VA 1RYTA 5D8OA 5HJFA 4LYXA 4LPJA 5LG8A 2VXIA 1AEWA 1L8HA 3F33A 2GYDA 3UOIA 4CMYA 1XZ1A 3RE7A 2V2LA 1NF4A 4TW3A 3KA9A 3E6RA 3E1NA 2BJYA 5I4JA 3F35A 1DATA 2FZFA 2Z6MA 4TOCA 3KA3A 3U90A 5JKMA 3GE4A 3AJQA 4AM4A 3OGHA 4LQNA 1FHAA 2XGWA 3QB9A 2Z5QA 4MN9A 4ERUA 1VLGA 5D8SA 3KA4A 1VEIA 4EVBA 2YW6A 1LKPA 2ZURX 2C6RA 4LQHA 4ZL6A 2D5KA 2ITBA 4A25A 2FFXJ 3R2SA 2XKQA 5GU0X 4RC7A 5D8RA 4OYNA 1TKOA 5GU2X 4ZJKA 4RC8A 5CZUA 1OTKA 2Y3QA 3WNWA 2VXXA 3AF9X 3FVBA 5E1UA 1TJOA 3R2RA 4ZKWA 2FJCA 3QVDA 3EZ0A 2WLAA 1HRSA 4QUWA 2CHIA 4EVEA 4Z5SA 5FFEA 4RC6A 5GU1X 3A68A 2XJOA 2CN7A 3AK9A 4RC7B 4PG0A 1ZUJA 4RC5A 3TA8A 1SOFA 3AJOA 3PW8A 4LQVA 2ZA6A 4TOGA 2CF7A 2X170 3QHBA 3F32A 3E6SA 5HQOA 3O7SA 3E1MA 1LKMA 2V2MA 2FL0A 5JACA 3RGDA 3BVKA 1DVBA 3KA6A 5JKLA 4IWJA 4TOBA 2ZG7X 1YV1A 2QF9A 4RC5B 3PVYB 2F7NA 4MJYA 1LB3A 1VEQA 3FI6A 3NOZX 4M34A 3F39A 4PG1A 4P18A 4CYAA 1NFVA 2OC5A 3PW1A 1IERA 1BCFA 3Q4NA 1DPSA 4MKUA 5D8XA 2WLUA 3AJPA 3PWFA 3KA8A 1YUZA 4ML5A 3WVUA 5AXSA 4DYUA 4TO9A 4ISMA 1LKOA 5GN8A 4XKSA
chains in the Genus database with same CATH superfamily
3GGYA 3KWOA 4CYBA 3QZ3A 2OH3A 1R03A 2ZA7A 2JD80 5J8WA 5JKMG 3C1YA 4ZL5A 2C41A 3PW1B 4DE6A 5FFAA 1JYBA 1S2ZA 1KRQA 4TOAA 1QYBA 4II4A 2YW7A 3PVRA 2V2NA 2FG8A 4TOFA 5K52A 5ERKA 3ES3A 2ZG8X 5GN8B 1JKVA 5GU3X 3IQ1A 5C6FA 1YUXA 3PZAA 2HR5A 3C21A 4DI0A 1H96A 2V8UA 3SIDA 3N6OA 1XZ3A 1IESA 2V2OA 3KX9A 2BKCA 4XKUA 1TKPA 3PVRB 3E2CA 5J93A 3Q4RA 1JREA 3F38A 3E1JA 4CY9A 3AF8X 3BVEA 2FG4A 3R2KA 2CIHA 2HTNA 4CVPA 2Z5PA 3BVLA 1L8IA 5GOUA 2Z5RA 3PWQC 4W4KB 3RD0A 4MUDA 1UMNA 3EGMA 1Z6OM 1RCDA 3M6JA 3HL1A 3AK8A 1J30A 2G4HA 3BVFA 1SQ3A 5JDOA 2WWXB 1JIGA 3F37A 3F36A 4Y08A 3FSEA 4KVQA 2XJMA 1O9IA 1TK6A 4LYUA 5E2DA 1JTSA 4RC6B 1N1QA 5IX6A 1NNQA 4M33A 4R42A 3VNXA 3UNOA 3E1OA 2AR0A 2BK6A 3PW8C 3MPSA 3GGZA 3VVAA 3GHQA 2ZG9X 3Q4OA 4ISPA 4PGKA 4M32A 2FKZA 4DYXA 3Q4QA 3O7RA 3E1LA 3RAVA 3UOFA 3ERZA 4LPMA 3WVVA 2CN6A 2XJNA 1F33A 3A9QA 4MY7A 3HIUA 5CMQA 3H7GA 2V15A 4DASA 4DZ0A 3JZAB 1UVHA 2YJKA 2JD70 5FFBA 3IS8A 2W0OA 2GYQA 4XKTA 3R2HA 4IWKA 3R2LA 3SH6A 3SHXA 4U3GA 2V2PA 4ITTA 4W4LB 5ERJA 3BKNA 1Z4AA 2V2SA 1O9RA 1S30A 4PGIA 4KXRB 5FFDA 2C2UA 4M35A 4CVRA 2QQYA 1BG7A 1B71A 4ZKXA 4TOEA 4CVSA 1MOJA 1ZS3A 3JZ9A 4REUA 3RBCA 4WJG4 3E1PA 1JGCA 2Z90A 4ITWA 4YKHA 4X0JA 5HJHA 2V2IA 2RBDA 5D8QA 2N02A 3KHKA 2VZBA 1RCEA 2C2JA 2CLBA 3IS7A 3R2MA 4LQJA 1Z6OA 2BW1A 2YJJA 3QD8A 4CMYV 2GS4A 1S3QA 4ETRA 4EVCA 4KVSA 4II4B 4KVRA 3AF7X 3PVTA 1RCCA 2C2FA 1F30A 3F34A 5LG2A 3OJ5A 1BFRA 5FEJA 2V2RA 4CVTA 1JI4A 5D8YA 3PWQA 2CEIA 3SE1A 3ISEA 4AM2A 3GVYA 1VELA 5FFCA 1QGHA 2ZA8A 3FRRA 3VV9A 3BT5A 4ZLWA 2UX1A 2WTLA 1MFRA 2V8TA 2FHAA 1VJXA 2OKCA 5K53A 3D19A 4DYYA 2V2JA 2IY4A 3EZUA 3E1QA 4ZKHA 4DYZA 1RCGA 4TODA 1JKUA 3ISFA 5LS9A 3NP0X 3NP2X 3PVTB 3BVIA 2IU2A 3PVYA 4IXKA 4EVDA 1GWGA 2JD60 4LPNA 5LBHA 5CMRA 3C23A 2PYBA 1EUMA 3KXUA 3QHCA 4YXMA 4TOHA 5J8SA 4ZMCA 1JI5A 4ZTTA 3DBYA 4Z3BA 4XGSA 3T9JA 1RCIA 2CHPA 2CWLA 4E6KA 2IB0A 5D8PA 3WVWA 5JKLG 5HU6D 2CLUA 3R2OA 3UFBA 4AM5A 1NF6A 5J9VA 1RYTA 5D8OA 5JDOB 5HJFA 4LYXA 4LPJA 5LG8A 2VXIA 1AEWA 1L8HA 3F33A 2GYDA 3UOIA 4CMYA 4E40A 1XZ1A 3RE7A 2V2LA 1NF4A 4TW3A 3KA9A 3E6RA 3E1NA 2BJYA 5I4JA 3F35A 1DATA 2FZFA 2Z6MA 4TOCA 3KA3A 3LKDA 3U90A 5JKMA 3GE4A 3AJQA 4AM4A 3OGHA 4LQNA 3V3KB 1FHAA 2XGWA 3QB9A 2Z5QA 2MGYA 4MN9A 4ERUA 1VLGA 5D8SA 3FRSA 3KA4A 1VEIA 4EVBA 2YW6A 1LKPA 2ZURX 2C6RA 3W54A 4LQHA 4ZL6A 2D5KA 4YVZA 2ITBA 4MXPA 4A25A 2FFXJ 3R2SA 2XKQA 5GU0X 4RC7A 5D8RA 4OYNA 1TKOA 5GU2X 4ZJKA 4RC8A 5CZUA 1OTKA 2Y3QA 3WNWA 2VXXA 3AF9X 3FVBA 5E1UA 1TJOA 3R2RA 4ZKWA 2FJCA 3QVDA 3EZ0A 2WLAA 1HRSA 4QUWA 3KDQA 2CHIA 4EVEA 4Z5SA 5FFEA 4RC6A 5GU1X 3A68A 2XJOA 2CN7A 3AK9A 4RC7B 4PG0A 1ZUJA 4RC5A 3TA8A 1SOFA 3AJOA 4YXJA 3PW8A 4LQVA 2ZA6A 4TOGA 2CF7A 2X170 3QHBA 3F32A 2G38B 3E6SA 5HQOA 3O7SA 3E1MA 1LKMA 2V2MA 2FL0A 5JACA 3RGDA 3BVKA 1DVBA 3KA6A 5JKLA 4IWJA 4TOBA 2ZG7X 1YV1A 2QF9A 4RC5B 3PVYB 2F7NA 4MJYA 1LB3A 1VEQA 3FI6A 3NOZX 2Y44A 4M34A 3F39A 4PG1A 4P18A 4CYAA 1NFVA 2OC5A 3PW1A 1IERA 3C1ZA 1BCFA 3Q4NA 1DPSA 4MKUA 5D8XA 2WLUA 3AJPA 3PWFA 3KA8A 1YUZA 4ML5A 3WVUA 5AXSA 4DYUA 4TO9A 3L0MA 1LKOA 4ISMA 5GN8A 4XKSA
chains in the Genus database with same CATH topology
3GGYA 3KWOA 4CYBA 3QZ3A 2OH3A 1R03A 2ZA7A 2JD80 5J8WA 5JKMG 3C1YA 4ZL5A 2C41A 3PW1B 4DE6A 5FFAA 1JYBA 1S2ZA 1KRQA 4TOAA 1QYBA 4II4A 2YW7A 3PVRA 2V2NA 2FG8A 4TOFA 5K52A 5ERKA 3ES3A 2ZG8X 5GN8B 1JKVA 5GU3X 3IQ1A 5C6FA 1YUXA 3PZAA 2HR5A 3C21A 4DI0A 1H96A 2V8UA 3SIDA 3N6OA 1XZ3A 1IESA 2V2OA 3KX9A 2BKCA 4XKUA 1TKPA 3PVRB 3E2CA 5J93A 3Q4RA 1JREA 3F38A 3E1JA 4CY9A 3AF8X 3BVEA 2FG4A 3R2KA 2CIHA 2HTNA 4CVPA 2Z5PA 3BVLA 1L8IA 5GOUA 2Z5RA 3PWQC 4W4KB 3RD0A 4MUDA 1UMNA 3EGMA 1Z6OM 1RCDA 3M6JA 3HL1A 3AK8A 1J30A 2G4HA 3BVFA 1SQ3A 5JDOA 2WWXB 1JIGA 3F37A 3F36A 4Y08A 3FSEA 4KVQA 2XJMA 1O9IA 1TK6A 4LYUA 5E2DA 1JTSA 4RC6B 1N1QA 5IX6A 1NNQA 4M33A 4R42A 3VNXA 3UNOA 3E1OA 2AR0A 2BK6A 3PW8C 3MPSA 3GGZA 3VVAA 3GHQA 2ZG9X 3Q4OA 4ISPA 4PGKA 4M32A 2FKZA 4DYXA 3Q4QA 3O7RA 3E1LA 3RAVA 3UOFA 3ERZA 4LPMA 3WVVA 2CN6A 2XJNA 1F33A 3A9QA 4MY7A 3HIUA 5CMQA 3H7GA 2V15A 4DASA 4DZ0A 3JZAB 1UVHA 2YJKA 2JD70 5FFBA 3IS8A 2W0OA 2GYQA 4XKTA 3R2HA 4IWKA 3R2LA 3SH6A 3SHXA 4U3GA 2V2PA 4ITTA 4W4LB 5ERJA 3BKNA 1Z4AA 2V2SA 1O9RA 1S30A 4PGIA 4KXRB 5FFDA 2C2UA 4M35A 4CVRA 2QQYA 1BG7A 1B71A 4ZKXA 4TOEA 4CVSA 1MOJA 1ZS3A 3JZ9A 4REUA 3RBCA 4WJG4 3E1PA 1JGCA 2Z90A 4ITWA 4YKHA 4X0JA 5HJHA 2V2IA 2RBDA 5D8QA 2N02A 3KHKA 2VZBA 1RCEA 2C2JA 2CLBA 3IS7A 3R2MA 4LQJA 1Z6OA 2BW1A 2YJJA 3QD8A 4CMYV 2GS4A 1S3QA 4ETRA 4EVCA 4KVSA 4II4B 4KVRA 3AF7X 3PVTA 1RCCA 2C2FA 1F30A 3F34A 5LG2A 3OJ5A 1BFRA 5FEJA 2V2RA 4CVTA 1JI4A 5D8YA 3PWQA 2CEIA 3SE1A 3ISEA 4AM2A 3GVYA 1VELA 5FFCA 1QGHA 2ZA8A 3FRRA 3VV9A 3BT5A 4ZLWA 2UX1A 2WTLA 1MFRA 2V8TA 2FHAA 1VJXA 2OKCA 5K53A 3D19A 4DYYA 2V2JA 2IY4A 3EZUA 3E1QA 4ZKHA 4DYZA 1RCGA 4TODA 1JKUA 3ISFA 5LS9A 3NP0X 3NP2X 3PVTB 3BVIA 2IU2A 3PVYA 4IXKA 4EVDA 1GWGA 2JD60 4LPNA 5LBHA 5CMRA 3C23A 2PYBA 1EUMA 3KXUA 3QHCA 4YXMA 4TOHA 5J8SA 4ZMCA 1JI5A 4ZTTA 3DBYA 4Z3BA 4XGSA 3T9JA 1RCIA 2CHPA 2CWLA 4E6KA 2IB0A 5D8PA 3WVWA 5JKLG 5HU6D 2CLUA 3R2OA 3UFBA 4AM5A 1NF6A 5J9VA 1RYTA 5D8OA 5JDOB 5HJFA 4LYXA 4LPJA 5LG8A 2VXIA 1AEWA 1L8HA 3F33A 2GYDA 3UOIA 4CMYA 4E40A 1XZ1A 3RE7A 2V2LA 1NF4A 4TW3A 3KA9A 3E6RA 3E1NA 2BJYA 5I4JA 3F35A 1DATA 2FZFA 2Z6MA 4TOCA 3KA3A 3LKDA 3U90A 5JKMA 3GE4A 3AJQA 4AM4A 3OGHA 4LQNA 3V3KB 1FHAA 2XGWA 3QB9A 2Z5QA 2MGYA 4MN9A 4ERUA 1VLGA 5D8SA 3FRSA 3KA4A 1VEIA 4EVBA 2YW6A 1LKPA 2ZURX 2C6RA 3W54A 4LQHA 4ZL6A 2D5KA 4YVZA 2ITBA 4MXPA 4A25A 2FFXJ 3R2SA 2XKQA 5GU0X 4RC7A 5D8RA 4OYNA 1TKOA 5GU2X 4ZJKA 4RC8A 5CZUA 1OTKA 2Y3QA 3WNWA 2VXXA 3AF9X 3FVBA 5E1UA 1TJOA 3R2RA 4ZKWA 2FJCA 3QVDA 3EZ0A 2WLAA 1HRSA 4QUWA 3KDQA 2CHIA 4EVEA 4Z5SA 5FFEA 4RC6A 5GU1X 3A68A 2XJOA 2CN7A 3AK9A 4RC7B 4PG0A 1ZUJA 4RC5A 3TA8A 1SOFA 3AJOA 4YXJA 3PW8A 4LQVA 2ZA6A 4TOGA 2CF7A 2X170 3QHBA 3F32A 2G38B 3E6SA 5HQOA 3O7SA 3E1MA 1LKMA 2V2MA 2FL0A 5JACA 3RGDA 3BVKA 1DVBA 3KA6A 5JKLA 4IWJA 4TOBA 2ZG7X 1YV1A 2QF9A 4RC5B 3PVYB 2F7NA 4MJYA 1LB3A 1VEQA 3FI6A 3NOZX 2Y44A 4M34A 3F39A 4PG1A 4P18A 4CYAA 1NFVA 2OC5A 3PW1A 1IERA 3C1ZA 1BCFA 3Q4NA 1DPSA 4MKUA 5D8XA 2WLUA 3AJPA 3PWFA 3KA8A 1YUZA 4ML5A 3WVUA 5AXSA 4DYUA 4TO9A 3L0MA 1LKOA 4ISMA 5GN8A 4XKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KWO A;  4CYB A;  3QZ3 A;  2OH3 A;  1R03 A;  2ZA7 A;  2JD8 0;  5J8W A;  5JKM G;  4ZL5 A;  2C41 A;  3PW1 B;  4DE6 A;  5FFA A;  1JYB A;  1S2Z A;  1KRQ A;  4TOA A;  1QYB A;  4II4 A;  2YW7 A;  3PVR A;  2V2N A;  2FG8 A;  4TOF A;  5K52 A;  5ERK A;  3ES3 A;  2ZG8 X;  5GN8 B;  1JKV A;  5GU3 X;  3IQ1 A;  5C6F A;  1YUX A;  3PZA A;  2HR5 A;  4DI0 A;  1H96 A;  3SID A;  1XZ3 A;  1IES A;  2V2O A;  3KX9 A;  2BKC A;  4XKU A;  1TKP A;  3PVR B;  3E2C A;  5J93 A;  3Q4R A;  1JRE A;  3F38 A;  3E1J A;  4CY9 A;  3AF8 X;  3BVE A;  2FG4 A;  3R2K A;  2CIH A;  2HTN A;  4CVP A;  2Z5P A;  3BVL A;  1L8I A;  5GOU A;  2Z5R A;  3PWQ C;  3RD0 A;  4MUD A;  1UMN A;  3EGM A;  1Z6O M;  1RCD A;  3HL1 A;  3AK8 A;  1J30 A;  2G4H A;  3BVF A;  1SQ3 A;  1JIG A;  3F37 A;  3F36 A;  4Y08 A;  3FSE A;  4KVQ A;  2XJM A;  1O9I A;  1TK6 A;  4LYU A;  5E2D A;  1JTS A;  4RC6 B;  1N1Q A;  5IX6 A;  1NNQ A;  4M33 A;  4R42 A;  3VNX A;  3UNO A;  3E1O A;  2BK6 A;  3PW8 C;  3MPS A;  3GHQ A;  2ZG9 X;  3Q4O A;  4ISP A;  4PGK A;  4M32 A;  2FKZ A;  4DYX A;  3Q4Q A;  3O7R A;  3E1L A;  3RAV A;  3UOF A;  3ERZ A;  4LPM A;  3WVV A;  2CN6 A;  2XJN A;  1F33 A;  3A9Q A;  4MY7 A;  3HIU A;  5CMQ A;  3H7G A;  2V15 A;  4DAS A;  4DZ0 A;  1UVH A;  2YJK A;  2JD7 0;  5FFB A;  3IS8 A;  2W0O A;  2GYQ A;  4XKT A;  3R2H A;  4IWK A;  3R2L A;  3SH6 A;  3SHX A;  4U3G A;  2V2P A;  4ITT A;  5ERJ A;  3BKN A;  1Z4A A;  2V2S A;  1O9R A;  1S30 A;  4PGI A;  5FFD A;  2C2U A;  4M35 A;  4CVR A;  2QQY A;  1BG7 A;  1B71 A;  4ZKX A;  4TOE A;  4CVS A;  1MOJ A;  1ZS3 A;  4REU A;  3RBC A;  3E1P A;  1JGC A;  2Z90 A;  4ITW A;  4YKH A;  5HJH A;  2V2I A;  2RBD A;  5D8Q A;  2VZB A;  1RCE A;  2C2J A;  2CLB A;  3IS7 A;  3R2M A;  4LQJ A;  1Z6O A;  2BW1 A;  2YJJ A;  3QD8 A;  4CMY V;  2GS4 A;  1S3Q A;  4ETR A;  4EVC A;  4KVS A;  4II4 B;  4KVR A;  3AF7 X;  3PVT A;  1RCC A;  2C2F A;  1F30 A;  3F34 A;  5LG2 A;  3OJ5 A;  1BFR A;  5FEJ A;  2V2R A;  4CVT A;  1JI4 A;  5D8Y A;  3PWQ A;  2CEI A;  3SE1 A;  3ISE A;  4AM2 A;  3GVY A;  1VEL A;  5FFC A;  1QGH A;  2ZA8 A;  3BT5 A;  4ZLW A;  2UX1 A;  2WTL A;  1MFR A;  2FHA A;  1VJX A;  5K53 A;  4DYY A;  2V2J A;  2IY4 A;  3EZU A;  3E1Q A;  4ZKH A;  4DYZ A;  1RCG A;  4TOD A;  1JKU A;  3ISF A;  5LS9 A;  3NP0 X;  3NP2 X;  3PVT B;  3BVI A;  2IU2 A;  3PVY A;  4IXK A;  4EVD A;  1GWG A;  2JD6 0;  4LPN A;  5LBH A;  5CMR A;  2PYB A;  1EUM A;  3KXU A;  3QHC A;  4TOH A;  5J8S A;  4ZMC A;  1JI5 A;  4ZTT A;  4Z3B A;  4XGS A;  3T9J A;  1RCI A;  2CHP A;  4E6K A;  2IB0 A;  5D8P A;  3WVW A;  5JKL G;  2CLU A;  3R2O A;  4AM5 A;  1NF6 A;  5J9V A;  1RYT A;  5D8O A;  5HJF A;  4LYX A;  4LPJ A;  5LG8 A;  2VXI A;  1AEW A;  1L8H A;  3F33 A;  2GYD A;  3UOI A;  4CMY A;  1XZ1 A;  3RE7 A;  2V2L A;  1NF4 A;  4TW3 A;  3KA9 A;  3E6R A;  3E1N A;  2BJY A;  5I4J A;  3F35 A;  1DAT A;  2FZF A;  2Z6M A;  4TOC A;  3KA3 A;  3U90 A;  5JKM A;  3GE4 A;  3AJQ A;  4AM4 A;  3OGH A;  4LQN A;  1FHA A;  2XGW A;  3QB9 A;  2Z5Q A;  4MN9 A;  4ERU A;  1VLG A;  5D8S A;  3KA4 A;  1VEI A;  4EVB A;  2YW6 A;  1LKP A;  2ZUR X;  2C6R A;  4LQH A;  4ZL6 A;  2D5K A;  2ITB A;  4A25 A;  2FFX J;  3R2S A;  2XKQ A;  5GU0 X;  4RC7 A;  5D8R A;  4OYN A;  1TKO A;  5GU2 X;  4ZJK A;  4RC8 A;  5CZU A;  1OTK A;  2Y3Q A;  3WNW A;  2VXX A;  3AF9 X;  3FVB A;  5E1U A;  1TJO A;  3R2R A;  4ZKW A;  2FJC A;  3QVD A;  3EZ0 A;  2WLA A;  1HRS A;  4QUW A;  2CHI A;  4EVE A;  4Z5S A;  5FFE A;  4RC6 A;  5GU1 X;  3A68 A;  2XJO A;  2CN7 A;  3AK9 A;  4RC7 B;  4PG0 A;  1ZUJ A;  4RC5 A;  3TA8 A;  1SOF A;  3AJO A;  3PW8 A;  4LQV A;  2ZA6 A;  4TOG A;  2CF7 A;  2X17 0;  3QHB A;  3F32 A;  3E6S A;  5HQO A;  3O7S A;  3E1M A;  1LKM A;  2V2M A;  2FL0 A;  5JAC A;  3RGD A;  3BVK A;  1DVB A;  3KA6 A;  5JKL A;  4IWJ A;  4TOB A;  2ZG7 X;  1YV1 A;  2QF9 A;  4RC5 B;  3PVY B;  2F7N A;  4MJY A;  1LB3 A;  1VEQ A;  3FI6 A;  3NOZ X;  4M34 A;  3F39 A;  4PG1 A;  4P18 A;  4CYA A;  1NFV A;  2OC5 A;  3PW1 A;  1IER A;  1BCF A;  3Q4N A;  1DPS A;  4MKU A;  5D8X A;  2WLU A;  3AJP A;  3PWF A;  3KA8 A;  1YUZ A;  4ML5 A;  3WVU A;  5AXS A;  4DYU A;  4TO9 A;  4ISM A;  1LKO A;  5GN8 A;  4XKS A; 
#chains in the Genus database with same CATH topology
 3GGY A;  3KWO A;  4CYB A;  3QZ3 A;  2OH3 A;  1R03 A;  2ZA7 A;  2JD8 0;  5J8W A;  5JKM G;  3C1Y A;  4ZL5 A;  2C41 A;  3PW1 B;  4DE6 A;  5FFA A;  1JYB A;  1S2Z A;  1KRQ A;  4TOA A;  1QYB A;  4II4 A;  2YW7 A;  3PVR A;  2V2N A;  2FG8 A;  4TOF A;  5K52 A;  5ERK A;  3ES3 A;  2ZG8 X;  5GN8 B;  1JKV A;  5GU3 X;  3IQ1 A;  5C6F A;  1YUX A;  3PZA A;  2HR5 A;  3C21 A;  4DI0 A;  1H96 A;  2V8U A;  3SID A;  3N6O A;  1XZ3 A;  1IES A;  2V2O A;  3KX9 A;  2BKC A;  4XKU A;  1TKP A;  3PVR B;  3E2C A;  5J93 A;  3Q4R A;  1JRE A;  3F38 A;  3E1J A;  4CY9 A;  3AF8 X;  3BVE A;  2FG4 A;  3R2K A;  2CIH A;  2HTN A;  4CVP A;  2Z5P A;  3BVL A;  1L8I A;  5GOU A;  2Z5R A;  3PWQ C;  4W4K B;  3RD0 A;  4MUD A;  1UMN A;  3EGM A;  1Z6O M;  1RCD A;  3M6J A;  3HL1 A;  3AK8 A;  1J30 A;  2G4H A;  3BVF A;  1SQ3 A;  5JDO A;  2WWX B;  1JIG A;  3F37 A;  3F36 A;  4Y08 A;  3FSE A;  4KVQ A;  2XJM A;  1O9I A;  1TK6 A;  4LYU A;  5E2D A;  1JTS A;  4RC6 B;  1N1Q A;  5IX6 A;  1NNQ A;  4M33 A;  4R42 A;  3VNX A;  3UNO A;  3E1O A;  2AR0 A;  2BK6 A;  3PW8 C;  3MPS A;  3GGZ A;  3VVA A;  3GHQ A;  2ZG9 X;  3Q4O A;  4ISP A;  4PGK A;  4M32 A;  2FKZ A;  4DYX A;  3Q4Q A;  3O7R A;  3E1L A;  3RAV A;  3UOF A;  3ERZ A;  4LPM A;  3WVV A;  2CN6 A;  2XJN A;  1F33 A;  3A9Q A;  4MY7 A;  3HIU A;  5CMQ A;  3H7G A;  2V15 A;  4DAS A;  4DZ0 A;  3JZA B;  1UVH A;  2YJK A;  2JD7 0;  5FFB A;  3IS8 A;  2W0O A;  2GYQ A;  4XKT A;  3R2H A;  4IWK A;  3R2L A;  3SH6 A;  3SHX A;  4U3G A;  2V2P A;  4ITT A;  4W4L B;  5ERJ A;  3BKN A;  1Z4A A;  2V2S A;  1O9R A;  1S30 A;  4PGI A;  4KXR B;  5FFD A;  2C2U A;  4M35 A;  4CVR A;  2QQY A;  1BG7 A;  1B71 A;  4ZKX A;  4TOE A;  4CVS A;  1MOJ A;  1ZS3 A;  3JZ9 A;  4REU A;  3RBC A;  4WJG 4;  3E1P A;  1JGC A;  2Z90 A;  4ITW A;  4YKH A;  4X0J A;  5HJH A;  2V2I A;  2RBD A;  5D8Q A;  2N02 A;  3KHK A;  2VZB A;  1RCE A;  2C2J A;  2CLB A;  3IS7 A;  3R2M A;  4LQJ A;  1Z6O A;  2BW1 A;  2YJJ A;  3QD8 A;  4CMY V;  2GS4 A;  1S3Q A;  4ETR A;  4EVC A;  4KVS A;  4II4 B;  4KVR A;  3AF7 X;  3PVT A;  1RCC A;  2C2F A;  1F30 A;  3F34 A;  5LG2 A;  3OJ5 A;  1BFR A;  5FEJ A;  2V2R A;  4CVT A;  1JI4 A;  5D8Y A;  3PWQ A;  2CEI A;  3SE1 A;  3ISE A;  4AM2 A;  3GVY A;  1VEL A;  5FFC A;  1QGH A;  2ZA8 A;  3FRR A;  3VV9 A;  3BT5 A;  4ZLW A;  2UX1 A;  2WTL A;  1MFR A;  2V8T A;  2FHA A;  1VJX A;  2OKC A;  5K53 A;  3D19 A;  4DYY A;  2V2J A;  2IY4 A;  3EZU A;  3E1Q A;  4ZKH A;  4DYZ A;  1RCG A;  4TOD A;  1JKU A;  3ISF A;  5LS9 A;  3NP0 X;  3NP2 X;  3PVT B;  3BVI A;  2IU2 A;  3PVY A;  4IXK A;  4EVD A;  1GWG A;  2JD6 0;  4LPN A;  5LBH A;  5CMR A;  3C23 A;  2PYB A;  1EUM A;  3KXU A;  3QHC A;  4YXM A;  4TOH A;  5J8S A;  4ZMC A;  1JI5 A;  4ZTT A;  3DBY A;  4Z3B A;  4XGS A;  3T9J A;  1RCI A;  2CHP A;  2CWL A;  4E6K A;  2IB0 A;  5D8P A;  3WVW A;  5JKL G;  5HU6 D;  2CLU A;  3R2O A;  3UFB A;  4AM5 A;  1NF6 A;  5J9V A;  1RYT A;  5D8O A;  5JDO B;  5HJF A;  4LYX A;  4LPJ A;  5LG8 A;  2VXI A;  1AEW A;  1L8H A;  3F33 A;  2GYD A;  3UOI A;  4CMY A;  4E40 A;  1XZ1 A;  3RE7 A;  2V2L A;  1NF4 A;  4TW3 A;  3KA9 A;  3E6R A;  3E1N A;  2BJY A;  5I4J A;  3F35 A;  1DAT A;  2FZF A;  2Z6M A;  4TOC A;  3KA3 A;  3LKD A;  3U90 A;  5JKM A;  3GE4 A;  3AJQ A;  4AM4 A;  3OGH A;  4LQN A;  3V3K B;  1FHA A;  2XGW A;  3QB9 A;  2Z5Q A;  2MGY A;  4MN9 A;  4ERU A;  1VLG A;  5D8S A;  3FRS A;  3KA4 A;  1VEI A;  4EVB A;  2YW6 A;  1LKP A;  2ZUR X;  2C6R A;  3W54 A;  4LQH A;  4ZL6 A;  2D5K A;  4YVZ A;  2ITB A;  4MXP A;  4A25 A;  2FFX J;  3R2S A;  2XKQ A;  5GU0 X;  4RC7 A;  5D8R A;  4OYN A;  1TKO A;  5GU2 X;  4ZJK A;  4RC8 A;  5CZU A;  1OTK A;  2Y3Q A;  3WNW A;  2VXX A;  3AF9 X;  3FVB A;  5E1U A;  1TJO A;  3R2R A;  4ZKW A;  2FJC A;  3QVD A;  3EZ0 A;  2WLA A;  1HRS A;  4QUW A;  3KDQ A;  2CHI A;  4EVE A;  4Z5S A;  5FFE A;  4RC6 A;  5GU1 X;  3A68 A;  2XJO A;  2CN7 A;  3AK9 A;  4RC7 B;  4PG0 A;  1ZUJ A;  4RC5 A;  3TA8 A;  1SOF A;  3AJO A;  4YXJ A;  3PW8 A;  4LQV A;  2ZA6 A;  4TOG A;  2CF7 A;  2X17 0;  3QHB A;  3F32 A;  2G38 B;  3E6S A;  5HQO A;  3O7S A;  3E1M A;  1LKM A;  2V2M A;  2FL0 A;  5JAC A;  3RGD A;  3BVK A;  1DVB A;  3KA6 A;  5JKL A;  4IWJ A;  4TOB A;  2ZG7 X;  1YV1 A;  2QF9 A;  4RC5 B;  3PVY B;  2F7N A;  4MJY A;  1LB3 A;  1VEQ A;  3FI6 A;  3NOZ X;  2Y44 A;  4M34 A;  3F39 A;  4PG1 A;  4P18 A;  4CYA A;  1NFV A;  2OC5 A;  3PW1 A;  1IER A;  3C1Z A;  1BCF A;  3Q4N A;  1DPS A;  4MKU A;  5D8X A;  2WLU A;  3AJP A;  3PWF A;  3KA8 A;  1YUZ A;  4ML5 A;  3WVU A;  5AXS A;  4DYU A;  4TO9 A;  3L0M A;  1LKO A;  4ISM A;  5GN8 A;  4XKS A; 
#chains in the Genus database with same CATH homology
 3GGY A;  3KWO A;  4CYB A;  3QZ3 A;  2OH3 A;  1R03 A;  2ZA7 A;  2JD8 0;  5J8W A;  5JKM G;  3C1Y A;  4ZL5 A;  2C41 A;  3PW1 B;  4DE6 A;  5FFA A;  1JYB A;  1S2Z A;  1KRQ A;  4TOA A;  1QYB A;  4II4 A;  2YW7 A;  3PVR A;  2V2N A;  2FG8 A;  4TOF A;  5K52 A;  5ERK A;  3ES3 A;  2ZG8 X;  5GN8 B;  1JKV A;  5GU3 X;  3IQ1 A;  5C6F A;  1YUX A;  3PZA A;  2HR5 A;  3C21 A;  4DI0 A;  1H96 A;  2V8U A;  3SID A;  3N6O A;  1XZ3 A;  1IES A;  2V2O A;  3KX9 A;  2BKC A;  4XKU A;  1TKP A;  3PVR B;  3E2C A;  5J93 A;  3Q4R A;  1JRE A;  3F38 A;  3E1J A;  4CY9 A;  3AF8 X;  3BVE A;  2FG4 A;  3R2K A;  2CIH A;  2HTN A;  4CVP A;  2Z5P A;  3BVL A;  1L8I A;  5GOU A;  2Z5R A;  3PWQ C;  4W4K B;  3RD0 A;  4MUD A;  1UMN A;  3EGM A;  1Z6O M;  1RCD A;  3M6J A;  3HL1 A;  3AK8 A;  1J30 A;  2G4H A;  3BVF A;  1SQ3 A;  5JDO A;  2WWX B;  1JIG A;  3F37 A;  3F36 A;  4Y08 A;  3FSE A;  4KVQ A;  2XJM A;  1O9I A;  1TK6 A;  4LYU A;  5E2D A;  1JTS A;  4RC6 B;  1N1Q A;  5IX6 A;  1NNQ A;  4M33 A;  4R42 A;  3VNX A;  3UNO A;  3E1O A;  2AR0 A;  2BK6 A;  3PW8 C;  3MPS A;  3GGZ A;  3VVA A;  3GHQ A;  2ZG9 X;  3Q4O A;  4ISP A;  4PGK A;  4M32 A;  2FKZ A;  4DYX A;  3Q4Q A;  3O7R A;  3E1L A;  3RAV A;  3UOF A;  3ERZ A;  4LPM A;  3WVV A;  2CN6 A;  2XJN A;  1F33 A;  3A9Q A;  4MY7 A;  3HIU A;  5CMQ A;  3H7G A;  2V15 A;  4DAS A;  4DZ0 A;  3JZA B;  1UVH A;  2YJK A;  2JD7 0;  5FFB A;  3IS8 A;  2W0O A;  2GYQ A;  4XKT A;  3R2H A;  4IWK A;  3R2L A;  3SH6 A;  3SHX A;  4U3G A;  2V2P A;  4ITT A;  4W4L B;  5ERJ A;  3BKN A;  1Z4A A;  2V2S A;  1O9R A;  1S30 A;  4PGI A;  4KXR B;  5FFD A;  2C2U A;  4M35 A;  4CVR A;  2QQY A;  1BG7 A;  1B71 A;  4ZKX A;  4TOE A;  4CVS A;  1MOJ A;  1ZS3 A;  3JZ9 A;  4REU A;  3RBC A;  4WJG 4;  3E1P A;  1JGC A;  2Z90 A;  4ITW A;  4YKH A;  4X0J A;  5HJH A;  2V2I A;  2RBD A;  5D8Q A;  2N02 A;  3KHK A;  2VZB A;  1RCE A;  2C2J A;  2CLB A;  3IS7 A;  3R2M A;  4LQJ A;  1Z6O A;  2BW1 A;  2YJJ A;  3QD8 A;  4CMY V;  2GS4 A;  1S3Q A;  4ETR A;  4EVC A;  4KVS A;  4II4 B;  4KVR A;  3AF7 X;  3PVT A;  1RCC A;  2C2F A;  1F30 A;  3F34 A;  5LG2 A;  3OJ5 A;  1BFR A;  5FEJ A;  2V2R A;  4CVT A;  1JI4 A;  5D8Y A;  3PWQ A;  2CEI A;  3SE1 A;  3ISE A;  4AM2 A;  3GVY A;  1VEL A;  5FFC A;  1QGH A;  2ZA8 A;  3FRR A;  3VV9 A;  3BT5 A;  4ZLW A;  2UX1 A;  2WTL A;  1MFR A;  2V8T A;  2FHA A;  1VJX A;  2OKC A;  5K53 A;  3D19 A;  4DYY A;  2V2J A;  2IY4 A;  3EZU A;  3E1Q A;  4ZKH A;  4DYZ A;  1RCG A;  4TOD A;  1JKU A;  3ISF A;  5LS9 A;  3NP0 X;  3NP2 X;  3PVT B;  3BVI A;  2IU2 A;  3PVY A;  4IXK A;  4EVD A;  1GWG A;  2JD6 0;  4LPN A;  5LBH A;  5CMR A;  3C23 A;  2PYB A;  1EUM A;  3KXU A;  3QHC A;  4YXM A;  4TOH A;  5J8S A;  4ZMC A;  1JI5 A;  4ZTT A;  3DBY A;  4Z3B A;  4XGS A;  3T9J A;  1RCI A;  2CHP A;  2CWL A;  4E6K A;  2IB0 A;  5D8P A;  3WVW A;  5JKL G;  5HU6 D;  2CLU A;  3R2O A;  3UFB A;  4AM5 A;  1NF6 A;  5J9V A;  1RYT A;  5D8O A;  5JDO B;  5HJF A;  4LYX A;  4LPJ A;  5LG8 A;  2VXI A;  1AEW A;  1L8H A;  3F33 A;  2GYD A;  3UOI A;  4CMY A;  4E40 A;  1XZ1 A;  3RE7 A;  2V2L A;  1NF4 A;  4TW3 A;  3KA9 A;  3E6R A;  3E1N A;  2BJY A;  5I4J A;  3F35 A;  1DAT A;  2FZF A;  2Z6M A;  4TOC A;  3KA3 A;  3LKD A;  3U90 A;  5JKM A;  3GE4 A;  3AJQ A;  4AM4 A;  3OGH A;  4LQN A;  3V3K B;  1FHA A;  2XGW A;  3QB9 A;  2Z5Q A;  2MGY A;  4MN9 A;  4ERU A;  1VLG A;  5D8S A;  3FRS A;  3KA4 A;  1VEI A;  4EVB A;  2YW6 A;  1LKP A;  2ZUR X;  2C6R A;  3W54 A;  4LQH A;  4ZL6 A;  2D5K A;  4YVZ A;  2ITB A;  4MXP A;  4A25 A;  2FFX J;  3R2S A;  2XKQ A;  5GU0 X;  4RC7 A;  5D8R A;  4OYN A;  1TKO A;  5GU2 X;  4ZJK A;  4RC8 A;  5CZU A;  1OTK A;  2Y3Q A;  3WNW A;  2VXX A;  3AF9 X;  3FVB A;  5E1U A;  1TJO A;  3R2R A;  4ZKW A;  2FJC A;  3QVD A;  3EZ0 A;  2WLA A;  1HRS A;  4QUW A;  3KDQ A;  2CHI A;  4EVE A;  4Z5S A;  5FFE A;  4RC6 A;  5GU1 X;  3A68 A;  2XJO A;  2CN7 A;  3AK9 A;  4RC7 B;  4PG0 A;  1ZUJ A;  4RC5 A;  3TA8 A;  1SOF A;  3AJO A;  4YXJ A;  3PW8 A;  4LQV A;  2ZA6 A;  4TOG A;  2CF7 A;  2X17 0;  3QHB A;  3F32 A;  2G38 B;  3E6S A;  5HQO A;  3O7S A;  3E1M A;  1LKM A;  2V2M A;  2FL0 A;  5JAC A;  3RGD A;  3BVK A;  1DVB A;  3KA6 A;  5JKL A;  4IWJ A;  4TOB A;  2ZG7 X;  1YV1 A;  2QF9 A;  4RC5 B;  3PVY B;  2F7N A;  4MJY A;  1LB3 A;  1VEQ A;  3FI6 A;  3NOZ X;  2Y44 A;  4M34 A;  3F39 A;  4PG1 A;  4P18 A;  4CYA A;  1NFV A;  2OC5 A;  3PW1 A;  1IER A;  3C1Z A;  1BCF A;  3Q4N A;  1DPS A;  4MKU A;  5D8X A;  2WLU A;  3AJP A;  3PWF A;  3KA8 A;  1YUZ A;  4ML5 A;  3WVU A;  5AXS A;  4DYU A;  4TO9 A;  3L0M A;  1LKO A;  4ISM A;  5GN8 A;  4XKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...