2JD70

Crystal structure of the fe-soaked ferritin from the hyperthermophilic archaeal anaerobe pyrococcus furiosus
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
167
structure length
167
Chain Sequence
MLSERMLKALNDQLNRELYSAYLYFAMAAYFEDLGLEGFANWMKAQAEEEIGHALRFYNYIYDRNGRVELDEIPKPPKEWESPLKAFEAAYEHEKFISKSIYELAALAEEEKDYSTRAFLEWFINEQVEEEASVKKILDKLKFAKDSPQILFMLDKELSARAPKLPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERRITIN HOMOLOG
publication title Crystal Structure of the Ferritin from the Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Metal transport
total genus 75
structure length 167
sequence length 167
chains with identical sequence 1, 2, 3, 4, 5, 6, 7, 8, 9, A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z
ec nomenclature
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
0 PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2jd7000
3T9JA 3A9QA 3F32A 1O9IA 4LPJA 3GVYA 4ETRA 3PW8C 2CEIA 5K53A 1VEIA 4ZJKA 2VXXA 3UOFA 5E2DA 3QZ3A 2GYDA 4MY7A 2RBDA 4EVEA 1VEQA 5JKLA 3NOZX 1R03A 3KA6A 3Q4OA 4QUWA 5FEJA 2CHPA 5FFCA 1SOFA 4ZKXA 2BW1A 3AK8A 3NP0X 2GYQA 2IU2A 3AF7X 1F30A 4TOHA 3E1OA 1Z6OM 1JKVA 2OH3A 2CN7A 4DYUA 1JREA 3F37A 3NP2X 2GS4A 3QHCA 2C2JA 3Q4NA 3BVKA 2V2LA 2BK6A 3UNOA 4ITWA 1JI5A 1VLGA 4CYBA 1BCFA 2CHIA 4ZTTA 3F39A 1LKMA 1GWGA 4LQHA 1RCIA 2V2NA 2V2PA 3BVLA 3WVWA 3QVDA 4EVDA 4TOFA 4RC5B 2IB0A 3WVUA 2FG8A 1FHAA 1RYTA 1Z6OA 4R42A 3FI6A 3ES3A 3KXUA 4CVRA 1QYBA 5D8XA 4DI0A 2FHAA 1KRQA 1S30A 1HRSA 2Z5RA 3MPSA 2QQYA 5D8SA 5IX6A 4LQJA 5C6FA 1IESA 3R2MA 4KVQA 5JKMG 2V2IA 1BFRA 2Z5PA 3PW1A 2CF7A 4RC6B 4PG1A 3FVBA 2XJMA 3AJQA 1J30A 3E1QA 1NF4A 4ZKWA 5HJFA 1F33A 2Z5QA 1L8HA 2V2RA 3IQ1A 2ZG7X 5CMRA 2V2OA 2CN6A 5J8SA 4KVSA 2UX1A 3WNWA 2V2SA 4P18A 4ZKHA 3BVEA 1YUZA 4TO9A 4ZL5A 4RC7A 4LYXA 1JKUA 4CY9A 1B71A 3E1LA 4LYUA 3FSEA 3AF8X 3E1NA 1VJXA 3SE1A 5HJHA 1JI4A 4MJYA 3F34A 2ZURX 1Z4AA 5D8PA 2Y3QA 4AM4A 4II4B 3SH6A 3WVVA 1NNQA 3F35A 3TA8A 3EZ0A 4AM5A 3SHXA 5D8YA 2V15A 5LS9A 4XKUA 1L8IA 3R2RA 1LKPA 3KX9A 3U90A 3F36A 3KA9A 3O7SA 5ERKA 2BJYA 3RE7A 2YW6A 1JGCA 1YV1A 2ZA8A 4ERUA 1O9RA 4M34A 4U3GA 2XKQA 4YKHA 1JYBA 3E1PA 4TOEA 5GU3X 1DATA 4LPNA 4M33A 3PWQC 3KA4A 3RAVA 5GN8B 3BT5A 5JACA 5ERJA 5K52A 3PW8A 2CIHA 3E2CA 1AEWA 3PVYB 3F33A 4OYNA 2JD80 2JD60 5FFDA 3BKNA 5E1UA 4ZLWA 1LKOA 5GU0X 5LBHA 4ZMCA 2FJCA 2WLUA 1DPSA 3ISFA 1TKOA 4REUA 4Z3BA 4ISMA 2C41A 3PVYA 5HQOA 4XKSA 4TW3A 5JKLG 4RC5A 2ZG8X 2IY4A 2ZG9X 1H96A 3GE4A 1EUMA 1N1QA 2HR5A 4Z5SA 2C6RA 4EVCA 4TOCA 1UVHA 3PWFA 1RCEA 2FFXJ 4MKUA 3E1MA 2FL0A 1S2ZA 1MOJA 4IWKA 3KWOA 4RC6A 1NF6A 2VZBA 3AK9A 2V2JA 3IS8A 3EZUA 5FFBA 5CMQA 1IERA 5LG2A 4CVSA 4DASA 4IXKA 4EVBA 5I4JA 3R2LA 2FZFA 5D8OA 2Z90A 5GOUA 3E6RA 3KA3A 3ISEA 5D8RA 2ITBA 4LQVA 3HL1A 4TOGA 3RGDA 2W0OA 3QB9A 5J93A 4XGSA 3PZAA 4CVPA 3RBCA 2WTLA 2ZA6A 3F38A 3Q4RA 4TOBA 2XJOA 3IS7A 5AXSA 3A68A 4IWJA 4TOAA 3AJOA 3QD8A 4II4A 1YUXA 1OTKA 2Z6MA 5JKMA 2YJJA 1TKPA 3BVFA 4M32A 2FKZA 1RCCA 2YJKA 2X170 4DYZA 4DYXA 1SQ3A 4AM2A 3Q4QA 3R2SA 4CVTA 1JIGA 3PVTB 2CLBA 1JTSA 4Y08A 2OC5A 5LG8A 5D8QA 4DYYA 2XGWA 3OJ5A 3R2HA 3KA8A 1VELA 2JD70 1S3QA 1RCDA 4DZ0A 1QGHA 4LQNA 3EGMA 4CMYV 2XJNA 2CLUA 3PVTA 4KVRA 5GN8A 3E1JA 4ITTA 5CZUA 1TJOA 5GU2X 4LPMA 4PGIA 5GU1X 3AF9X 4A25A 1DVBA 4XKTA 4E6KA 3UOIA 3O7RA 3SIDA 1UMNA 4ML5A 3HIUA 5FFEA 1XZ3A 1XZ1A 2D5KA 3AJPA 3BVIA 3H7GA 3PW1B 4ZL6A 3R2KA 3ERZA 2PYBA 2ZA7A 1ZS3A 4RC8A 4CMYA 2QF9A 4TODA 3RD0A 4CYAA 3PWQA 5FFAA 1TK6A 2FG4A 1ZUJA 2C2FA 2C2UA 3PVRB 2VXIA 1NFVA 1BG7A 2BKCA 4PGKA 2WLAA 4M35A 3VNXA 3GHQA 3E6SA 4ISPA 4RC7B 4PG0A 2YW7A 4MN9A 3R2OA 3PVRA 3OGHA 5J9VA 2F7NA 4DE6A 4MUDA 1RCGA 1MFRA 5J8WA 3QHBA 2HTNA 2G4HA 1LB3A 2V2MA
chains in the Genus database with same CATH superfamily
3T9JA 3A9QA 3F32A 1O9IA 4LPJA 3GVYA 4ETRA 3PW8C 2CEIA 5K53A 1VEIA 3KDQA 4ZJKA 2VXXA 3UOFA 5E2DA 3V3KB 3QZ3A 2GYDA 4MY7A 2RBDA 4EVEA 1VEQA 5JKLA 3NOZX 1R03A 3L0MA 3KA6A 3Q4OA 4QUWA 4W4KB 5FEJA 2CHPA 5FFCA 1SOFA 4ZKXA 2BW1A 3AK8A 3NP0X 2GYQA 2IU2A 3AF7X 1F30A 4TOHA 3E1OA 1Z6OM 1JKVA 2OH3A 2CN7A 4DYUA 1JREA 3F37A 3NP2X 2GS4A 3QHCA 2C2JA 3Q4NA 4YXMA 3BVKA 2V2LA 2BK6A 3UNOA 4ITWA 1JI5A 1VLGA 4CYBA 1BCFA 2CHIA 4YVZA 3GGZA 4ZTTA 3F39A 1LKMA 1GWGA 4LQHA 1RCIA 2V2NA 2V2PA 3BVLA 3WVWA 3QVDA 4EVDA 4TOFA 4RC5B 2IB0A 3WVUA 2FG8A 1FHAA 1RYTA 1Z6OA 4R42A 3FI6A 3ES3A 3KXUA 4CVRA 3UFBA 1QYBA 5D8XA 4DI0A 2FHAA 1KRQA 1S30A 1HRSA 2Z5RA 3MPSA 2QQYA 5D8SA 5IX6A 4LQJA 5C6FA 1IESA 3R2MA 4KVQA 5JKMG 2V2IA 1BFRA 2Z5PA 3PW1A 3C1ZA 2CF7A 4RC6B 4PG1A 3FVBA 2XJMA 3VV9A 3AJQA 1J30A 3E1QA 1NF4A 4ZKWA 5HJFA 1F33A 2V8UA 2Z5QA 5JDOA 1L8HA 2V2RA 2N02A 3IQ1A 2ZG7X 5CMRA 3LKDA 2V2OA 2CN6A 5J8SA 4KVSA 2UX1A 3WNWA 2V2SA 4P18A 4ZKHA 3BVEA 1YUZA 4TO9A 4ZL5A 4RC7A 4LYXA 1JKUA 4CY9A 3D19A 4WJG4 4KXRB 1B71A 3E1LA 4LYUA 3FSEA 3AF8X 3E1NA 1VJXA 3SE1A 5HJHA 1JI4A 4MJYA 3F34A 2ZURX 1Z4AA 5D8PA 2Y3QA 4AM4A 4II4B 3SH6A 3WVVA 1NNQA 2CWLA 3F35A 3TA8A 3EZ0A 4AM5A 1LB3A 5D8YA 2V15A 3SHXA 5LS9A 4XKUA 1L8IA 4E40A 3R2RA 1LKPA 3KX9A 3W54A 3U90A 3F36A 3KA9A 3O7SA 5ERKA 2BJYA 3RE7A 2YW6A 3N6OA 1JGCA 1YV1A 2ZA8A 3C21A 4ERUA 1O9RA 4M34A 4U3GA 2XKQA 4YKHA 1JYBA 3E1PA 4TOEA 5GU3X 1DATA 4LPNA 4M33A 3PWQC 3FRSA 3KA4A 3RAVA 5GN8B 3BT5A 5JACA 5ERJA 5K52A 3PW8A 2CIHA 3C1YA 3E2CA 1AEWA 3PVYB 3F33A 4OYNA 2JD80 2JD60 5FFDA 3BKNA 5E1UA 4ZLWA 3M6JA 2MGYA 1LKOA 5GU0X 5LBHA 4ZMCA 2FJCA 2WLUA 1DPSA 3ISFA 1TKOA 4REUA 4Z3BA 4ISMA 2C41A 3PVYA 5HQOA 4XKSA 2OKCA 4TW3A 5JKLG 4RC5A 2ZG8X 2IY4A 3GGYA 2ZG9X 1H96A 3GE4A 1EUMA 1N1QA 2HR5A 4W4LB 4Z5SA 2C6RA 4MXPA 4EVCA 4TOCA 1UVHA 3JZ9A 3PWFA 1RCEA 2FFXJ 4MKUA 3E1MA 2FL0A 1S2ZA 5HU6D 1MOJA 4IWKA 3KWOA 4RC6A 1NF6A 2VZBA 3AK9A 2V2JA 3IS8A 3EZUA 5FFBA 5CMQA 1IERA 5LG2A 4CVSA 4DASA 4IXKA 4EVBA 5I4JA 3R2LA 2FZFA 5D8OA 2Z90A 5GOUA 3E6RA 3KA3A 3ISEA 5D8RA 3DBYA 2ITBA 4LQVA 3HL1A 4TOGA 3RGDA 2W0OA 3QB9A 5J93A 4XGSA 3PZAA 4CVPA 3RBCA 2WTLA 2ZA6A 3F38A 3Q4RA 4TOBA 3VVAA 2XJOA 3IS7A 5AXSA 3A68A 4IWJA 2AR0A 4TOAA 3AJOA 3QD8A 4II4A 1YUXA 1OTKA 2Z6MA 5JKMA 2YJJA 1TKPA 3BVFA 4M32A 2FKZA 1RCCA 2YJKA 2X170 4DYZA 4DYXA 1SQ3A 4AM2A 3Q4QA 3R2SA 4CVTA 1JIGA 3PVTB 2CLBA 1JTSA 4Y08A 2OC5A 5LG8A 5D8QA 4DYYA 2XGWA 3OJ5A 3R2HA 3KA8A 1VELA 2JD70 1S3QA 1RCDA 4DZ0A 1QGHA 4LQNA 3EGMA 4CMYV 2XJNA 2CLUA 3PVTA 2V8TA 4KVRA 5GN8A 3E1JA 4ITTA 5CZUA 1TJOA 5GU2X 4LPMA 4PGIA 5GU1X 3AF9X 4X0JA 4A25A 1DVBA 4XKTA 4E6KA 3FRRA 3UOIA 3O7RA 2Y44A 3SIDA 3C23A 1UMNA 4ML5A 3HIUA 5FFEA 1XZ3A 1XZ1A 2D5KA 3AJPA 3BVIA 4YXJA 3JZAB 3H7GA 3PW1B 4ZL6A 3R2KA 3ERZA 2PYBA 2WWXB 2ZA7A 1ZS3A 4RC8A 4CMYA 2QF9A 4TODA 3RD0A 4CYAA 3PWQA 5FFAA 1TK6A 2FG4A 5JDOB 1ZUJA 2C2FA 2C2UA 3PVRB 3KHKA 2VXIA 1NFVA 1BG7A 2BKCA 4PGKA 2WLAA 4M35A 3VNXA 3GHQA 3E6SA 4ISPA 4RC7B 4PG0A 2YW7A 4MN9A 3R2OA 3PVRA 3OGHA 5J9VA 2F7NA 4DE6A 4MUDA 1RCGA 1MFRA 5J8WA 3QHBA 2HTNA 2G4HA 2G38B 2V2MA
chains in the Genus database with same CATH topology
3T9JA 3A9QA 3F32A 1O9IA 4LPJA 3GVYA 4ETRA 3PW8C 2CEIA 5K53A 1VEIA 3KDQA 4ZJKA 2VXXA 3UOFA 5E2DA 3V3KB 3QZ3A 2GYDA 4MY7A 2RBDA 4EVEA 1VEQA 5JKLA 3NOZX 1R03A 3L0MA 3KA6A 3Q4OA 4QUWA 4W4KB 5FEJA 2CHPA 5FFCA 1SOFA 4ZKXA 2BW1A 3AK8A 3NP0X 2GYQA 2IU2A 3AF7X 1F30A 4TOHA 3E1OA 1Z6OM 1JKVA 2OH3A 2CN7A 4DYUA 1JREA 3F37A 3NP2X 2GS4A 3QHCA 2C2JA 3Q4NA 4YXMA 3BVKA 2V2LA 2BK6A 3UNOA 4ITWA 1JI5A 1VLGA 4CYBA 1BCFA 2CHIA 4YVZA 3GGZA 4ZTTA 3F39A 1LKMA 1GWGA 4LQHA 1RCIA 2V2NA 2V2PA 3BVLA 3WVWA 3QVDA 4EVDA 4TOFA 4RC5B 2IB0A 3WVUA 2FG8A 1FHAA 1RYTA 1Z6OA 4R42A 3FI6A 3ES3A 3KXUA 4CVRA 3UFBA 1QYBA 5D8XA 4DI0A 2FHAA 1KRQA 1S30A 1HRSA 2Z5RA 3MPSA 2QQYA 5D8SA 5IX6A 4LQJA 5C6FA 1IESA 3R2MA 4KVQA 5JKMG 2V2IA 1BFRA 2Z5PA 3PW1A 3C1ZA 2CF7A 4RC6B 4PG1A 3FVBA 2XJMA 3VV9A 3AJQA 1J30A 3E1QA 1NF4A 4ZKWA 5HJFA 1F33A 2V8UA 2Z5QA 5JDOA 1L8HA 2V2RA 2N02A 3IQ1A 2ZG7X 5CMRA 3LKDA 2V2OA 2CN6A 5J8SA 4KVSA 2UX1A 3WNWA 2V2SA 4P18A 4ZKHA 3BVEA 1YUZA 4TO9A 4ZL5A 4RC7A 4LYXA 1JKUA 4CY9A 3D19A 4WJG4 4KXRB 1B71A 3E1LA 4LYUA 3FSEA 3AF8X 3E1NA 1VJXA 3SE1A 5HJHA 1JI4A 4MJYA 3F34A 2ZURX 1Z4AA 5D8PA 2Y3QA 4AM4A 4II4B 3SH6A 3WVVA 1NNQA 2CWLA 3F35A 3TA8A 3EZ0A 4AM5A 1LB3A 5D8YA 2V15A 3SHXA 5LS9A 4XKUA 1L8IA 4E40A 3R2RA 1LKPA 3KX9A 3W54A 3U90A 3F36A 3KA9A 3O7SA 5ERKA 2BJYA 3RE7A 2YW6A 3N6OA 1JGCA 1YV1A 2ZA8A 3C21A 4ERUA 1O9RA 4M34A 4U3GA 2XKQA 4YKHA 1JYBA 3E1PA 4TOEA 5GU3X 1DATA 4LPNA 4M33A 3PWQC 3FRSA 3KA4A 3RAVA 5GN8B 3BT5A 5JACA 5ERJA 5K52A 3PW8A 2CIHA 3C1YA 3E2CA 1AEWA 3PVYB 3F33A 4OYNA 2JD80 2JD60 5FFDA 3BKNA 5E1UA 4ZLWA 3M6JA 2MGYA 1LKOA 5GU0X 5LBHA 4ZMCA 2FJCA 2WLUA 1DPSA 3ISFA 1TKOA 4REUA 4Z3BA 4ISMA 2C41A 3PVYA 5HQOA 4XKSA 2OKCA 4TW3A 5JKLG 4RC5A 2ZG8X 2IY4A 3GGYA 2ZG9X 1H96A 3GE4A 1EUMA 1N1QA 2HR5A 4W4LB 4Z5SA 2C6RA 4MXPA 4EVCA 4TOCA 1UVHA 3JZ9A 3PWFA 1RCEA 2FFXJ 4MKUA 3E1MA 2FL0A 1S2ZA 5HU6D 1MOJA 4IWKA 3KWOA 4RC6A 1NF6A 2VZBA 3AK9A 2V2JA 3IS8A 3EZUA 5FFBA 5CMQA 1IERA 5LG2A 4CVSA 4DASA 4IXKA 4EVBA 5I4JA 3R2LA 2FZFA 5D8OA 2Z90A 5GOUA 3E6RA 3KA3A 3ISEA 5D8RA 3DBYA 2ITBA 4LQVA 3HL1A 4TOGA 3RGDA 2W0OA 3QB9A 5J93A 4XGSA 3PZAA 4CVPA 3RBCA 2WTLA 2ZA6A 3F38A 3Q4RA 4TOBA 3VVAA 2XJOA 3IS7A 5AXSA 3A68A 4IWJA 2AR0A 4TOAA 3AJOA 3QD8A 4II4A 1YUXA 1OTKA 2Z6MA 5JKMA 2YJJA 1TKPA 3BVFA 4M32A 2FKZA 1RCCA 2YJKA 2X170 4DYZA 4DYXA 1SQ3A 4AM2A 3Q4QA 3R2SA 4CVTA 1JIGA 3PVTB 2CLBA 1JTSA 4Y08A 2OC5A 5LG8A 5D8QA 4DYYA 2XGWA 3OJ5A 3R2HA 3KA8A 1VELA 2JD70 1S3QA 1RCDA 4DZ0A 1QGHA 4LQNA 3EGMA 4CMYV 2XJNA 2CLUA 3PVTA 2V8TA 4KVRA 5GN8A 3E1JA 4ITTA 5CZUA 1TJOA 5GU2X 4LPMA 4PGIA 5GU1X 3AF9X 4X0JA 4A25A 1DVBA 4XKTA 4E6KA 3FRRA 3UOIA 3O7RA 2Y44A 3SIDA 3C23A 1UMNA 4ML5A 3HIUA 5FFEA 1XZ3A 1XZ1A 2D5KA 3AJPA 3BVIA 4YXJA 3JZAB 3H7GA 3PW1B 4ZL6A 3R2KA 3ERZA 2PYBA 2WWXB 2ZA7A 1ZS3A 4RC8A 4CMYA 2QF9A 4TODA 3RD0A 4CYAA 3PWQA 5FFAA 1TK6A 2FG4A 5JDOB 1ZUJA 2C2FA 2C2UA 3PVRB 3KHKA 2VXIA 1NFVA 1BG7A 2BKCA 4PGKA 2WLAA 4M35A 3VNXA 3GHQA 3E6SA 4ISPA 4RC7B 4PG0A 2YW7A 4MN9A 3R2OA 3PVRA 3OGHA 5J9VA 2F7NA 4DE6A 4MUDA 1RCGA 1MFRA 5J8WA 3QHBA 2HTNA 2G4HA 2G38B 2V2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T9J A;  3A9Q A;  3F32 A;  1O9I A;  4LPJ A;  3GVY A;  4ETR A;  3PW8 C;  2CEI A;  5K53 A;  1VEI A;  4ZJK A;  2VXX A;  3UOF A;  5E2D A;  3QZ3 A;  2GYD A;  4MY7 A;  2RBD A;  4EVE A;  1VEQ A;  5JKL A;  3NOZ X;  1R03 A;  3KA6 A;  3Q4O A;  4QUW A;  5FEJ A;  2CHP A;  5FFC A;  1SOF A;  4ZKX A;  2BW1 A;  3AK8 A;  3NP0 X;  2GYQ A;  2IU2 A;  3AF7 X;  1F30 A;  4TOH A;  3E1O A;  1Z6O M;  1JKV A;  2OH3 A;  2CN7 A;  4DYU A;  1JRE A;  3F37 A;  3NP2 X;  2GS4 A;  3QHC A;  2C2J A;  3Q4N A;  3BVK A;  2V2L A;  2BK6 A;  3UNO A;  4ITW A;  1JI5 A;  1VLG A;  4CYB A;  1BCF A;  2CHI A;  4ZTT A;  3F39 A;  1LKM A;  1GWG A;  4LQH A;  1RCI A;  2V2N A;  2V2P A;  3BVL A;  3WVW A;  3QVD A;  4EVD A;  4TOF A;  4RC5 B;  2IB0 A;  3WVU A;  2FG8 A;  1FHA A;  1RYT A;  1Z6O A;  4R42 A;  3FI6 A;  3ES3 A;  3KXU A;  4CVR A;  1QYB A;  5D8X A;  4DI0 A;  2FHA A;  1KRQ A;  1S30 A;  1HRS A;  2Z5R A;  3MPS A;  2QQY A;  5D8S A;  5IX6 A;  4LQJ A;  5C6F A;  1IES A;  3R2M A;  4KVQ A;  5JKM G;  2V2I A;  1BFR A;  2Z5P A;  3PW1 A;  2CF7 A;  4RC6 B;  4PG1 A;  3FVB A;  2XJM A;  3AJQ A;  1J30 A;  3E1Q A;  1NF4 A;  4ZKW A;  5HJF A;  1F33 A;  2Z5Q A;  1L8H A;  2V2R A;  3IQ1 A;  2ZG7 X;  5CMR A;  2V2O A;  2CN6 A;  5J8S A;  4KVS A;  2UX1 A;  3WNW A;  2V2S A;  4P18 A;  4ZKH A;  3BVE A;  1YUZ A;  4TO9 A;  4ZL5 A;  4RC7 A;  4LYX A;  1JKU A;  4CY9 A;  1B71 A;  3E1L A;  4LYU A;  3FSE A;  3AF8 X;  3E1N A;  1VJX A;  3SE1 A;  5HJH A;  1JI4 A;  4MJY A;  3F34 A;  2ZUR X;  1Z4A A;  5D8P A;  2Y3Q A;  4AM4 A;  4II4 B;  3SH6 A;  3WVV A;  1NNQ A;  3F35 A;  3TA8 A;  3EZ0 A;  4AM5 A;  3SHX A;  5D8Y A;  2V15 A;  5LS9 A;  4XKU A;  1L8I A;  3R2R A;  1LKP A;  3KX9 A;  3U90 A;  3F36 A;  3KA9 A;  3O7S A;  5ERK A;  2BJY A;  3RE7 A;  2YW6 A;  1JGC A;  1YV1 A;  2ZA8 A;  4ERU A;  1O9R A;  4M34 A;  4U3G A;  2XKQ A;  4YKH A;  1JYB A;  3E1P A;  4TOE A;  5GU3 X;  1DAT A;  4LPN A;  4M33 A;  3PWQ C;  3KA4 A;  3RAV A;  5GN8 B;  3BT5 A;  5JAC A;  5ERJ A;  5K52 A;  3PW8 A;  2CIH A;  3E2C A;  1AEW A;  3PVY B;  3F33 A;  4OYN A;  2JD8 0;  2JD6 0;  5FFD A;  3BKN A;  5E1U A;  4ZLW A;  1LKO A;  5GU0 X;  5LBH A;  4ZMC A;  2FJC A;  2WLU A;  1DPS A;  3ISF A;  1TKO A;  4REU A;  4Z3B A;  4ISM A;  2C41 A;  3PVY A;  5HQO A;  4XKS A;  4TW3 A;  5JKL G;  4RC5 A;  2ZG8 X;  2IY4 A;  2ZG9 X;  1H96 A;  3GE4 A;  1EUM A;  1N1Q A;  2HR5 A;  4Z5S A;  2C6R A;  4EVC A;  4TOC A;  1UVH A;  3PWF A;  1RCE A;  2FFX J;  4MKU A;  3E1M A;  2FL0 A;  1S2Z A;  1MOJ A;  4IWK A;  3KWO A;  4RC6 A;  1NF6 A;  2VZB A;  3AK9 A;  2V2J A;  3IS8 A;  3EZU A;  5FFB A;  5CMQ A;  1IER A;  5LG2 A;  4CVS A;  4DAS A;  4IXK A;  4EVB A;  5I4J A;  3R2L A;  2FZF A;  5D8O A;  2Z90 A;  5GOU A;  3E6R A;  3KA3 A;  3ISE A;  5D8R A;  2ITB A;  4LQV A;  3HL1 A;  4TOG A;  3RGD A;  2W0O A;  3QB9 A;  5J93 A;  4XGS A;  3PZA A;  4CVP A;  3RBC A;  2WTL A;  2ZA6 A;  3F38 A;  3Q4R A;  4TOB A;  2XJO A;  3IS7 A;  5AXS A;  3A68 A;  4IWJ A;  4TOA A;  3AJO A;  3QD8 A;  4II4 A;  1YUX A;  1OTK A;  2Z6M A;  5JKM A;  2YJJ A;  1TKP A;  3BVF A;  4M32 A;  2FKZ A;  1RCC A;  2YJK A;  2X17 0;  4DYZ A;  4DYX A;  1SQ3 A;  4AM2 A;  3Q4Q A;  3R2S A;  4CVT A;  1JIG A;  3PVT B;  2CLB A;  1JTS A;  4Y08 A;  2OC5 A;  5LG8 A;  5D8Q A;  4DYY A;  2XGW A;  3OJ5 A;  3R2H A;  3KA8 A;  1VEL A;  2JD7 0;  1S3Q A;  1RCD A;  4DZ0 A;  1QGH A;  4LQN A;  3EGM A;  4CMY V;  2XJN A;  2CLU A;  3PVT A;  4KVR A;  5GN8 A;  3E1J A;  4ITT A;  5CZU A;  1TJO A;  5GU2 X;  4LPM A;  4PGI A;  5GU1 X;  3AF9 X;  4A25 A;  1DVB A;  4XKT A;  4E6K A;  3UOI A;  3O7R A;  3SID A;  1UMN A;  4ML5 A;  3HIU A;  5FFE A;  1XZ3 A;  1XZ1 A;  2D5K A;  3AJP A;  3BVI A;  3H7G A;  3PW1 B;  4ZL6 A;  3R2K A;  3ERZ A;  2PYB A;  2ZA7 A;  1ZS3 A;  4RC8 A;  4CMY A;  2QF9 A;  4TOD A;  3RD0 A;  4CYA A;  3PWQ A;  5FFA A;  1TK6 A;  2FG4 A;  1ZUJ A;  2C2F A;  2C2U A;  3PVR B;  2VXI A;  1NFV A;  1BG7 A;  2BKC A;  4PGK A;  2WLA A;  4M35 A;  3VNX A;  3GHQ A;  3E6S A;  4ISP A;  4RC7 B;  4PG0 A;  2YW7 A;  4MN9 A;  3R2O A;  3PVR A;  3OGH A;  5J9V A;  2F7N A;  4DE6 A;  4MUD A;  1RCG A;  1MFR A;  5J8W A;  3QHB A;  2HTN A;  2G4H A;  1LB3 A;  2V2M A; 
#chains in the Genus database with same CATH topology
 3T9J A;  3A9Q A;  3F32 A;  1O9I A;  4LPJ A;  3GVY A;  4ETR A;  3PW8 C;  2CEI A;  5K53 A;  1VEI A;  3KDQ A;  4ZJK A;  2VXX A;  3UOF A;  5E2D A;  3V3K B;  3QZ3 A;  2GYD A;  4MY7 A;  2RBD A;  4EVE A;  1VEQ A;  5JKL A;  3NOZ X;  1R03 A;  3L0M A;  3KA6 A;  3Q4O A;  4QUW A;  4W4K B;  5FEJ A;  2CHP A;  5FFC A;  1SOF A;  4ZKX A;  2BW1 A;  3AK8 A;  3NP0 X;  2GYQ A;  2IU2 A;  3AF7 X;  1F30 A;  4TOH A;  3E1O A;  1Z6O M;  1JKV A;  2OH3 A;  2CN7 A;  4DYU A;  1JRE A;  3F37 A;  3NP2 X;  2GS4 A;  3QHC A;  2C2J A;  3Q4N A;  4YXM A;  3BVK A;  2V2L A;  2BK6 A;  3UNO A;  4ITW A;  1JI5 A;  1VLG A;  4CYB A;  1BCF A;  2CHI A;  4YVZ A;  3GGZ A;  4ZTT A;  3F39 A;  1LKM A;  1GWG A;  4LQH A;  1RCI A;  2V2N A;  2V2P A;  3BVL A;  3WVW A;  3QVD A;  4EVD A;  4TOF A;  4RC5 B;  2IB0 A;  3WVU A;  2FG8 A;  1FHA A;  1RYT A;  1Z6O A;  4R42 A;  3FI6 A;  3ES3 A;  3KXU A;  4CVR A;  3UFB A;  1QYB A;  5D8X A;  4DI0 A;  2FHA A;  1KRQ A;  1S30 A;  1HRS A;  2Z5R A;  3MPS A;  2QQY A;  5D8S A;  5IX6 A;  4LQJ A;  5C6F A;  1IES A;  3R2M A;  4KVQ A;  5JKM G;  2V2I A;  1BFR A;  2Z5P A;  3PW1 A;  3C1Z A;  2CF7 A;  4RC6 B;  4PG1 A;  3FVB A;  2XJM A;  3VV9 A;  3AJQ A;  1J30 A;  3E1Q A;  1NF4 A;  4ZKW A;  5HJF A;  1F33 A;  2V8U A;  2Z5Q A;  5JDO A;  1L8H A;  2V2R A;  2N02 A;  3IQ1 A;  2ZG7 X;  5CMR A;  3LKD A;  2V2O A;  2CN6 A;  5J8S A;  4KVS A;  2UX1 A;  3WNW A;  2V2S A;  4P18 A;  4ZKH A;  3BVE A;  1YUZ A;  4TO9 A;  4ZL5 A;  4RC7 A;  4LYX A;  1JKU A;  4CY9 A;  3D19 A;  4WJG 4;  4KXR B;  1B71 A;  3E1L A;  4LYU A;  3FSE A;  3AF8 X;  3E1N A;  1VJX A;  3SE1 A;  5HJH A;  1JI4 A;  4MJY A;  3F34 A;  2ZUR X;  1Z4A A;  5D8P A;  2Y3Q A;  4AM4 A;  4II4 B;  3SH6 A;  3WVV A;  1NNQ A;  2CWL A;  3F35 A;  3TA8 A;  3EZ0 A;  4AM5 A;  1LB3 A;  5D8Y A;  2V15 A;  3SHX A;  5LS9 A;  4XKU A;  1L8I A;  4E40 A;  3R2R A;  1LKP A;  3KX9 A;  3W54 A;  3U90 A;  3F36 A;  3KA9 A;  3O7S A;  5ERK A;  2BJY A;  3RE7 A;  2YW6 A;  3N6O A;  1JGC A;  1YV1 A;  2ZA8 A;  3C21 A;  4ERU A;  1O9R A;  4M34 A;  4U3G A;  2XKQ A;  4YKH A;  1JYB A;  3E1P A;  4TOE A;  5GU3 X;  1DAT A;  4LPN A;  4M33 A;  3PWQ C;  3FRS A;  3KA4 A;  3RAV A;  5GN8 B;  3BT5 A;  5JAC A;  5ERJ A;  5K52 A;  3PW8 A;  2CIH A;  3C1Y A;  3E2C A;  1AEW A;  3PVY B;  3F33 A;  4OYN A;  2JD8 0;  2JD6 0;  5FFD A;  3BKN A;  5E1U A;  4ZLW A;  3M6J A;  2MGY A;  1LKO A;  5GU0 X;  5LBH A;  4ZMC A;  2FJC A;  2WLU A;  1DPS A;  3ISF A;  1TKO A;  4REU A;  4Z3B A;  4ISM A;  2C41 A;  3PVY A;  5HQO A;  4XKS A;  2OKC A;  4TW3 A;  5JKL G;  4RC5 A;  2ZG8 X;  2IY4 A;  3GGY A;  2ZG9 X;  1H96 A;  3GE4 A;  1EUM A;  1N1Q A;  2HR5 A;  4W4L B;  4Z5S A;  2C6R A;  4MXP A;  4EVC A;  4TOC A;  1UVH A;  3JZ9 A;  3PWF A;  1RCE A;  2FFX J;  4MKU A;  3E1M A;  2FL0 A;  1S2Z A;  5HU6 D;  1MOJ A;  4IWK A;  3KWO A;  4RC6 A;  1NF6 A;  2VZB A;  3AK9 A;  2V2J A;  3IS8 A;  3EZU A;  5FFB A;  5CMQ A;  1IER A;  5LG2 A;  4CVS A;  4DAS A;  4IXK A;  4EVB A;  5I4J A;  3R2L A;  2FZF A;  5D8O A;  2Z90 A;  5GOU A;  3E6R A;  3KA3 A;  3ISE A;  5D8R A;  3DBY A;  2ITB A;  4LQV A;  3HL1 A;  4TOG A;  3RGD A;  2W0O A;  3QB9 A;  5J93 A;  4XGS A;  3PZA A;  4CVP A;  3RBC A;  2WTL A;  2ZA6 A;  3F38 A;  3Q4R A;  4TOB A;  3VVA A;  2XJO A;  3IS7 A;  5AXS A;  3A68 A;  4IWJ A;  2AR0 A;  4TOA A;  3AJO A;  3QD8 A;  4II4 A;  1YUX A;  1OTK A;  2Z6M A;  5JKM A;  2YJJ A;  1TKP A;  3BVF A;  4M32 A;  2FKZ A;  1RCC A;  2YJK A;  2X17 0;  4DYZ A;  4DYX A;  1SQ3 A;  4AM2 A;  3Q4Q A;  3R2S A;  4CVT A;  1JIG A;  3PVT B;  2CLB A;  1JTS A;  4Y08 A;  2OC5 A;  5LG8 A;  5D8Q A;  4DYY A;  2XGW A;  3OJ5 A;  3R2H A;  3KA8 A;  1VEL A;  2JD7 0;  1S3Q A;  1RCD A;  4DZ0 A;  1QGH A;  4LQN A;  3EGM A;  4CMY V;  2XJN A;  2CLU A;  3PVT A;  2V8T A;  4KVR A;  5GN8 A;  3E1J A;  4ITT A;  5CZU A;  1TJO A;  5GU2 X;  4LPM A;  4PGI A;  5GU1 X;  3AF9 X;  4X0J A;  4A25 A;  1DVB A;  4XKT A;  4E6K A;  3FRR A;  3UOI A;  3O7R A;  2Y44 A;  3SID A;  3C23 A;  1UMN A;  4ML5 A;  3HIU A;  5FFE A;  1XZ3 A;  1XZ1 A;  2D5K A;  3AJP A;  3BVI A;  4YXJ A;  3JZA B;  3H7G A;  3PW1 B;  4ZL6 A;  3R2K A;  3ERZ A;  2PYB A;  2WWX B;  2ZA7 A;  1ZS3 A;  4RC8 A;  4CMY A;  2QF9 A;  4TOD A;  3RD0 A;  4CYA A;  3PWQ A;  5FFA A;  1TK6 A;  2FG4 A;  5JDO B;  1ZUJ A;  2C2F A;  2C2U A;  3PVR B;  3KHK A;  2VXI A;  1NFV A;  1BG7 A;  2BKC A;  4PGK A;  2WLA A;  4M35 A;  3VNX A;  3GHQ A;  3E6S A;  4ISP A;  4RC7 B;  4PG0 A;  2YW7 A;  4MN9 A;  3R2O A;  3PVR A;  3OGH A;  5J9V A;  2F7N A;  4DE6 A;  4MUD A;  1RCG A;  1MFR A;  5J8W A;  3QHB A;  2HTN A;  2G4H A;  2G38 B;  2V2M A; 
#chains in the Genus database with same CATH homology
 3T9J A;  3A9Q A;  3F32 A;  1O9I A;  4LPJ A;  3GVY A;  4ETR A;  3PW8 C;  2CEI A;  5K53 A;  1VEI A;  3KDQ A;  4ZJK A;  2VXX A;  3UOF A;  5E2D A;  3V3K B;  3QZ3 A;  2GYD A;  4MY7 A;  2RBD A;  4EVE A;  1VEQ A;  5JKL A;  3NOZ X;  1R03 A;  3L0M A;  3KA6 A;  3Q4O A;  4QUW A;  4W4K B;  5FEJ A;  2CHP A;  5FFC A;  1SOF A;  4ZKX A;  2BW1 A;  3AK8 A;  3NP0 X;  2GYQ A;  2IU2 A;  3AF7 X;  1F30 A;  4TOH A;  3E1O A;  1Z6O M;  1JKV A;  2OH3 A;  2CN7 A;  4DYU A;  1JRE A;  3F37 A;  3NP2 X;  2GS4 A;  3QHC A;  2C2J A;  3Q4N A;  4YXM A;  3BVK A;  2V2L A;  2BK6 A;  3UNO A;  4ITW A;  1JI5 A;  1VLG A;  4CYB A;  1BCF A;  2CHI A;  4YVZ A;  3GGZ A;  4ZTT A;  3F39 A;  1LKM A;  1GWG A;  4LQH A;  1RCI A;  2V2N A;  2V2P A;  3BVL A;  3WVW A;  3QVD A;  4EVD A;  4TOF A;  4RC5 B;  2IB0 A;  3WVU A;  2FG8 A;  1FHA A;  1RYT A;  1Z6O A;  4R42 A;  3FI6 A;  3ES3 A;  3KXU A;  4CVR A;  3UFB A;  1QYB A;  5D8X A;  4DI0 A;  2FHA A;  1KRQ A;  1S30 A;  1HRS A;  2Z5R A;  3MPS A;  2QQY A;  5D8S A;  5IX6 A;  4LQJ A;  5C6F A;  1IES A;  3R2M A;  4KVQ A;  5JKM G;  2V2I A;  1BFR A;  2Z5P A;  3PW1 A;  3C1Z A;  2CF7 A;  4RC6 B;  4PG1 A;  3FVB A;  2XJM A;  3VV9 A;  3AJQ A;  1J30 A;  3E1Q A;  1NF4 A;  4ZKW A;  5HJF A;  1F33 A;  2V8U A;  2Z5Q A;  5JDO A;  1L8H A;  2V2R A;  2N02 A;  3IQ1 A;  2ZG7 X;  5CMR A;  3LKD A;  2V2O A;  2CN6 A;  5J8S A;  4KVS A;  2UX1 A;  3WNW A;  2V2S A;  4P18 A;  4ZKH A;  3BVE A;  1YUZ A;  4TO9 A;  4ZL5 A;  4RC7 A;  4LYX A;  1JKU A;  4CY9 A;  3D19 A;  4WJG 4;  4KXR B;  1B71 A;  3E1L A;  4LYU A;  3FSE A;  3AF8 X;  3E1N A;  1VJX A;  3SE1 A;  5HJH A;  1JI4 A;  4MJY A;  3F34 A;  2ZUR X;  1Z4A A;  5D8P A;  2Y3Q A;  4AM4 A;  4II4 B;  3SH6 A;  3WVV A;  1NNQ A;  2CWL A;  3F35 A;  3TA8 A;  3EZ0 A;  4AM5 A;  1LB3 A;  5D8Y A;  2V15 A;  3SHX A;  5LS9 A;  4XKU A;  1L8I A;  4E40 A;  3R2R A;  1LKP A;  3KX9 A;  3W54 A;  3U90 A;  3F36 A;  3KA9 A;  3O7S A;  5ERK A;  2BJY A;  3RE7 A;  2YW6 A;  3N6O A;  1JGC A;  1YV1 A;  2ZA8 A;  3C21 A;  4ERU A;  1O9R A;  4M34 A;  4U3G A;  2XKQ A;  4YKH A;  1JYB A;  3E1P A;  4TOE A;  5GU3 X;  1DAT A;  4LPN A;  4M33 A;  3PWQ C;  3FRS A;  3KA4 A;  3RAV A;  5GN8 B;  3BT5 A;  5JAC A;  5ERJ A;  5K52 A;  3PW8 A;  2CIH A;  3C1Y A;  3E2C A;  1AEW A;  3PVY B;  3F33 A;  4OYN A;  2JD8 0;  2JD6 0;  5FFD A;  3BKN A;  5E1U A;  4ZLW A;  3M6J A;  2MGY A;  1LKO A;  5GU0 X;  5LBH A;  4ZMC A;  2FJC A;  2WLU A;  1DPS A;  3ISF A;  1TKO A;  4REU A;  4Z3B A;  4ISM A;  2C41 A;  3PVY A;  5HQO A;  4XKS A;  2OKC A;  4TW3 A;  5JKL G;  4RC5 A;  2ZG8 X;  2IY4 A;  3GGY A;  2ZG9 X;  1H96 A;  3GE4 A;  1EUM A;  1N1Q A;  2HR5 A;  4W4L B;  4Z5S A;  2C6R A;  4MXP A;  4EVC A;  4TOC A;  1UVH A;  3JZ9 A;  3PWF A;  1RCE A;  2FFX J;  4MKU A;  3E1M A;  2FL0 A;  1S2Z A;  5HU6 D;  1MOJ A;  4IWK A;  3KWO A;  4RC6 A;  1NF6 A;  2VZB A;  3AK9 A;  2V2J A;  3IS8 A;  3EZU A;  5FFB A;  5CMQ A;  1IER A;  5LG2 A;  4CVS A;  4DAS A;  4IXK A;  4EVB A;  5I4J A;  3R2L A;  2FZF A;  5D8O A;  2Z90 A;  5GOU A;  3E6R A;  3KA3 A;  3ISE A;  5D8R A;  3DBY A;  2ITB A;  4LQV A;  3HL1 A;  4TOG A;  3RGD A;  2W0O A;  3QB9 A;  5J93 A;  4XGS A;  3PZA A;  4CVP A;  3RBC A;  2WTL A;  2ZA6 A;  3F38 A;  3Q4R A;  4TOB A;  3VVA A;  2XJO A;  3IS7 A;  5AXS A;  3A68 A;  4IWJ A;  2AR0 A;  4TOA A;  3AJO A;  3QD8 A;  4II4 A;  1YUX A;  1OTK A;  2Z6M A;  5JKM A;  2YJJ A;  1TKP A;  3BVF A;  4M32 A;  2FKZ A;  1RCC A;  2YJK A;  2X17 0;  4DYZ A;  4DYX A;  1SQ3 A;  4AM2 A;  3Q4Q A;  3R2S A;  4CVT A;  1JIG A;  3PVT B;  2CLB A;  1JTS A;  4Y08 A;  2OC5 A;  5LG8 A;  5D8Q A;  4DYY A;  2XGW A;  3OJ5 A;  3R2H A;  3KA8 A;  1VEL A;  2JD7 0;  1S3Q A;  1RCD A;  4DZ0 A;  1QGH A;  4LQN A;  3EGM A;  4CMY V;  2XJN A;  2CLU A;  3PVT A;  2V8T A;  4KVR A;  5GN8 A;  3E1J A;  4ITT A;  5CZU A;  1TJO A;  5GU2 X;  4LPM A;  4PGI A;  5GU1 X;  3AF9 X;  4X0J A;  4A25 A;  1DVB A;  4XKT A;  4E6K A;  3FRR A;  3UOI A;  3O7R A;  2Y44 A;  3SID A;  3C23 A;  1UMN A;  4ML5 A;  3HIU A;  5FFE A;  1XZ3 A;  1XZ1 A;  2D5K A;  3AJP A;  3BVI A;  4YXJ A;  3JZA B;  3H7G A;  3PW1 B;  4ZL6 A;  3R2K A;  3ERZ A;  2PYB A;  2WWX B;  2ZA7 A;  1ZS3 A;  4RC8 A;  4CMY A;  2QF9 A;  4TOD A;  3RD0 A;  4CYA A;  3PWQ A;  5FFA A;  1TK6 A;  2FG4 A;  5JDO B;  1ZUJ A;  2C2F A;  2C2U A;  3PVR B;  3KHK A;  2VXI A;  1NFV A;  1BG7 A;  2BKC A;  4PGK A;  2WLA A;  4M35 A;  3VNX A;  3GHQ A;  3E6S A;  4ISP A;  4RC7 B;  4PG0 A;  2YW7 A;  4MN9 A;  3R2O A;  3PVR A;  3OGH A;  5J9V A;  2F7N A;  4DE6 A;  4MUD A;  1RCG A;  1MFR A;  5J8W A;  3QHB A;  2HTN A;  2G4H A;  2G38 B;  2V2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...