2JD70

Crystal structure of the fe-soaked ferritin from the hyperthermophilic archaeal anaerobe pyrococcus furiosus
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
167
structure length
167
Chain Sequence
MLSERMLKALNDQLNRELYSAYLYFAMAAYFEDLGLEGFANWMKAQAEEEIGHALRFYNYIYDRNGRVELDEIPKPPKEWESPLKAFEAAYEHEKFISKSIYELAALAEEEKDYSTRAFLEWFINEQVEEEASVKKILDKLKFAKDSPQILFMLDKELSARAPKLPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERRITIN HOMOLOG
publication title Crystal Structure of the Ferritin from the Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Metal transport
total genus 75
structure length 167
sequence length 167
chains with identical sequence 1, 2, 3, 4, 5, 6, 7, 8, 9, A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z
ec nomenclature
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
0 PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2jd7000
4DE6A 4XKSA 3F34A 3KA3A 2CHIA 4P18A 4ISMA 5FEJA 3Q4RA 3BVEA 4RC6A 4LPNA 1UMNA 4TW3A 4II4B 1NF4A 1IESA 3R2LA 2XJNA 3IQ1A 4ERUA 2GYDA 2Z6MA 2ZA7A 1SQ3A 3BKNA 4KVRA 5I4JA 1J30A 3R2MA 4CVPA 1MOJA 4ISPA 1VJXA 5ERKA 5FFEA 3RGDA 4XKTA 4ITWA 2C2UA 4Y08A 4LQVA 3GE4A 3NOZX 2VXIA 3E6SA 4RC7A 4TOGA 4ZKWA 2Z5PA 2BK6A 3ES3A 4Z5SA 3R2SA 1JTSA 4AM4A 3FVBA 2FG4A 1JI4A 2C2JA 4LPJA 4ITTA 1TJOA 3NP2X 2V2LA 2VXXA 1XZ3A 3AK9A 5JKMA 3ISFA 3QZ3A 4IWKA 1OTKA 3WNWA 5D8XA 1JREA 1QYBA 1RYTA 2ZURX 3Q4OA 4DYYA 2CF7A 2XJMA 2FG8A 4OYNA 2JD80 2IU2A 1YV1A 3AF9X 3AJQA 1Z6OA 2YW6A 2CN7A 2V2MA 3E2CA 2WLAA 3F37A 3VNXA 5JACA 5J93A 3PW1B 4CY9A 5LS9A 4CYAA 1O9IA 4TOBA 2GS4A 3E1OA 3A9QA 3UOIA 2CLUA 2V2JA 5J8SA 1AEWA 1LKMA 3IS7A 4LQHA 4ZJKA 3SHXA 3GHQA 5CMRA 4EVDA 2FHAA 5GU1X 1RCDA 2VZBA 3KXUA 3KWOA 3PWQA 1IERA 3TA8A 2FJCA 3QHCA 4M34A 2XGWA 5HJFA 4PGIA 3F33A 3PW1A 4ZKXA 2V2RA 3E6RA 2C6RA 5ERJA 3R2HA 2FFXJ 5LBHA 4ML5A 4REUA 2IB0A 5FFBA 5D8QA 3FI6A 3E1LA 3KA4A 3R2OA 3RAVA 4A25A 1LB3A 3QD8A 1LKOA 1VEIA 4CVSA 1BCFA 5CZUA 4DYXA 2FZFA 4CVRA 3E1QA 5GU3X 3PZAA 3QB9A 4LYUA 3ISEA 3T9JA 2Y3QA 2HR5A 4LQNA 3AK8A 3A68A 3EZUA 2CHPA 2PYBA 3PW8C 4PGKA 3F36A 1N1QA 5J9VA 3E1JA 5GU0X 4XKUA 4R42A 1VEQA 3AJOA 4TO9A 4ZLWA 3AF8X 2CN6A 4XGSA 4TOFA 4MJYA 2Z5QA 2WTLA 3BVLA 3FSEA 3PVYB 5GOUA 4II4A 1RCCA 2QF9A 1F30A 3EZ0A 1S2ZA 1TK6A 3U90A 1GWGA 2D5KA 5JKLG 2HTNA 4EVBA 2ZG8X 2CEIA 4LPMA 4IXKA 2RBDA 3BVFA 2FKZA 1JYBA 4EVCA 5LG8A 1JGCA 1JKVA 3SIDA 4M32A 1R03A 2X170 2YJKA 3PVYA 4KVQA 3WVWA 5K52A 4ZL6A 3F35A 2BW1A 3RE7A 4TOHA 1TKPA 4TODA 2CLBA 1RCEA 3QVDA 2ZG7X 4EVEA 4PG1A 4LQJA 5E1UA 1EUMA 1YUXA 4ZL5A 1QGHA 1LKPA 3MPSA 1KRQA 5HJHA 5GN8B 3KX9A 2V2NA 5J8WA 4M35A 1S30A 4ZTTA 1SOFA 3F32A 3WVVA 2V2PA 2XKQA 2C41A 1DVBA 2BKCA 2QQYA 4CMYA 1UVHA 1BG7A 5FFDA 2V2IA 3E1PA 5GU2X 3QHBA 2OH3A 2V2SA 3OJ5A 5GN8A 2XJOA 5LG2A 4IWJA 4TOAA 2V2OA 3E1MA 1VLGA 1RCIA 3PWQC 1Z6OM 3ERZA 5FFCA 3PWFA 3KA9A 3SE1A 3NP0X 3PVTB 4CVTA 2IY4A 4Z3BA 3AJPA 2ZG9X 1FHAA 4RC8A 4RC7B 5FFAA 4TOCA 5CMQA 3R2KA 1NF6A 1L8IA 3RBCA 1RCGA 3F38A 5JKMG 5K53A 3IS8A 2G4HA 5E2DA 3PVRB 5D8OA 2YW7A 2JD70 3KA6A 2Z5RA 3PVTA 2JD60 4RC5B 1ZUJA 5IX6A 2V15A 1DPSA 4ZMCA 4DYUA 2GYQA 4MN9A 4AM5A 4DI0A 2Z90A 2UX1A 3Q4QA 1B71A 4ZKHA 4MY7A 4TOEA 3HL1A 3KA8A 3WVUA 4KVSA 4M33A 5D8SA 2C2FA 3E1NA 3PVRA 5AXSA 4MUDA 4AM2A 3Q4NA 3UNOA 2WLUA 1S3QA 3RD0A 1NNQA 4RC5A 3BVKA 4MKUA 1ZS3A 4PG0A 5JKLA 1F33A 2ITBA 2ZA6A 3HIUA 5D8RA 2FL0A 3BT5A 5C6FA 4ETRA 4YKHA 1NFVA 1BFRA 1H96A 4E6KA 1Z4AA 3O7SA 4U3GA 3EGMA 3OGHA 4CYBA 3UOFA 1O9RA 2F7NA 3R2RA 3AF7X 2W0OA 4DYZA 2YJJA 2ZA8A 2BJYA 4RC6B 4DZ0A 5HQOA 2OC5A 3O7RA 4CMYV 3H7GA 1JIGA 1YUZA 1TKOA 1DATA 5D8PA 1VELA 2CIHA 3GVYA 1XZ1A 3BVIA 4LYXA 1L8HA 4QUWA 1JI5A 3SH6A 3PW8A 1MFRA 4DASA 1HRSA 1JKUA 3F39A 5D8YA
chains in the Genus database with same CATH superfamily
4DE6A 4XKSA 3N6OA 3F34A 3KA3A 2CHIA 4P18A 4ISMA 5FEJA 3Q4RA 3BVEA 4RC6A 4LPNA 1UMNA 4TW3A 4II4B 1NF4A 1IESA 3R2LA 2XJNA 3IQ1A 4ERUA 2GYDA 2Z6MA 2ZA7A 1SQ3A 3BKNA 4KVRA 5I4JA 1J30A 3R2MA 4CVPA 1MOJA 4ISPA 1VJXA 3C1ZA 5ERKA 5FFEA 3RGDA 4XKTA 4E40A 4ITWA 2C2UA 4Y08A 4LQVA 3GE4A 3NOZX 2VXIA 3E6SA 2WWXB 4RC7A 4TOGA 4ZKWA 2Z5PA 2BK6A 3ES3A 4Z5SA 3R2SA 1JTSA 4AM4A 3FVBA 2FG4A 1JI4A 2C2JA 4LPJA 4ITTA 1TJOA 3NP2X 2V2LA 2VXXA 1XZ3A 3AK9A 5JKMA 3ISFA 3QZ3A 4IWKA 1OTKA 3WNWA 5D8XA 1JREA 1QYBA 1RYTA 2ZURX 3Q4OA 4DYYA 2CF7A 2XJMA 2FG8A 4OYNA 2JD80 2IU2A 1YV1A 3AF9X 3AJQA 1Z6OA 2YW6A 2CN7A 2V2MA 3E2CA 2WLAA 3F37A 3DBYA 3VNXA 5JACA 5J93A 3PW1B 4CY9A 5LS9A 4CYAA 1O9IA 4TOBA 2GS4A 3E1OA 3A9QA 3UOIA 2CLUA 2V2JA 5J8SA 1AEWA 1LKMA 3IS7A 4LQHA 4ZJKA 3SHXA 3GGZA 3GHQA 5CMRA 4EVDA 2FHAA 5GU1X 1RCDA 2VZBA 3KXUA 3KWOA 3PWQA 1IERA 3TA8A 2FJCA 3QHCA 4M34A 4W4LB 2XGWA 5HJFA 4PGIA 3F33A 3PW1A 3KDQA 2OKCA 4ZKXA 2V2RA 3E6RA 5HU6D 2C6RA 5ERJA 3R2HA 2FFXJ 5LBHA 4ML5A 4REUA 2IB0A 5FFBA 5D8QA 3FI6A 3E1LA 3KA4A 3R2OA 3RAVA 4A25A 1LB3A 3QD8A 1LKOA 1VEIA 4WJG4 4CVSA 1BCFA 2N02A 5CZUA 3JZ9A 4DYXA 2FZFA 4CVRA 3E1QA 5GU3X 3PZAA 3QB9A 4LYUA 3ISEA 3T9JA 2Y3QA 2HR5A 4LQNA 3AK8A 3A68A 3EZUA 2CHPA 2PYBA 3PW8C 4PGKA 3F36A 1N1QA 5J9VA 3E1JA 5GU0X 4XKUA 3LKDA 4R42A 1VEQA 3AJOA 4TO9A 4ZLWA 3AF8X 2G38B 2CN6A 3VV9A 4XGSA 4TOFA 4MJYA 2Z5QA 2WTLA 3BVLA 3FSEA 3PVYB 4KXRB 5GOUA 4II4A 1RCCA 2QF9A 1F30A 3EZ0A 1S2ZA 1TK6A 3FRSA 3C1YA 3U90A 1GWGA 2D5KA 5JKLG 2HTNA 4EVBA 2ZG8X 2CEIA 4LPMA 4IXKA 2RBDA 3BVFA 2FKZA 1JYBA 4EVCA 5LG8A 3C21A 1JGCA 1JKVA 3SIDA 4M32A 1R03A 2X170 2YJKA 3PVYA 4KVQA 3WVWA 4MXPA 5K52A 4ZL6A 3F35A 2BW1A 3RE7A 4X0JA 4TOHA 1TKPA 4TODA 2CLBA 1RCEA 3QVDA 2ZG7X 4EVEA 4PG1A 4LQJA 5E1UA 1EUMA 1YUXA 4ZL5A 1QGHA 1LKPA 3GGYA 3MPSA 1KRQA 5HJHA 5GN8B 3KX9A 2V2NA 3JZAB 2CWLA 5J8WA 3W54A 4M35A 1S30A 4ZTTA 1SOFA 3F32A 3WVVA 2V2PA 2XKQA 2C41A 1DVBA 4YXMA 2BKCA 2QQYA 4CMYA 1UVHA 1BG7A 5FFDA 2V2IA 3E1PA 5GU2X 4W4KB 3QHBA 2OH3A 2V2SA 3OJ5A 5GN8A 2XJOA 5LG2A 4IWJA 4TOAA 2V2OA 3E1MA 1VLGA 1RCIA 3PWQC 1Z6OM 3ERZA 5FFCA 3PWFA 3KA9A 3SE1A 3NP0X 3PVTB 4CVTA 2IY4A 4Z3BA 3AJPA 2ZG9X 1FHAA 4RC8A 4RC7B 5FFAA 5JDOB 4TOCA 5CMQA 3R2KA 1NF6A 1L8IA 3RBCA 1RCGA 3F38A 3C23A 5JKMG 3FRRA 5K53A 3IS8A 2G4HA 5E2DA 3PVRB 5D8OA 2YW7A 2JD70 3KA6A 2Z5RA 3PVTA 3UFBA 2JD60 4RC5B 1ZUJA 5IX6A 2V15A 1DPSA 4ZMCA 4DYUA 2GYQA 4MN9A 4AM5A 4DI0A 5JDOA 2Z90A 2UX1A 3Q4QA 1B71A 4ZKHA 2V8TA 4MY7A 4TOEA 3HL1A 3KA8A 3WVUA 4KVSA 4M33A 5D8SA 2C2FA 3E1NA 3PVRA 5AXSA 4MUDA 3VVAA 4AM2A 3Q4NA 3UNOA 2WLUA 2MGYA 1S3QA 3RD0A 1NNQA 4RC5A 3BVKA 4MKUA 1ZS3A 3M6JA 4PG0A 5JKLA 1F33A 2ITBA 2ZA6A 3HIUA 5D8RA 3KHKA 2Y44A 2FL0A 3BT5A 5C6FA 4ETRA 4YKHA 2AR0A 1NFVA 1BFRA 1H96A 4E6KA 1Z4AA 3O7SA 4U3GA 2V8UA 3L0MA 3EGMA 3OGHA 4CYBA 3UOFA 1O9RA 3D19A 2F7NA 4YVZA 3R2RA 3AF7X 2W0OA 4DYZA 2YJJA 2ZA8A 2BJYA 4RC6B 4DZ0A 5HQOA 2OC5A 3O7RA 4CMYV 3H7GA 1JIGA 1YUZA 1TKOA 1DATA 5D8PA 1VELA 2CIHA 3GVYA 3V3KB 1XZ1A 3BVIA 4LYXA 1L8HA 4QUWA 1JI5A 3SH6A 4YXJA 3PW8A 1MFRA 4DASA 1HRSA 1JKUA 3F39A 5D8YA
chains in the Genus database with same CATH topology
4DE6A 4XKSA 3N6OA 3F34A 3KA3A 2CHIA 4P18A 4ISMA 5FEJA 3Q4RA 3BVEA 4RC6A 4LPNA 1UMNA 4TW3A 4II4B 1NF4A 1IESA 3R2LA 2XJNA 3IQ1A 4ERUA 2GYDA 2Z6MA 2ZA7A 1SQ3A 3BKNA 4KVRA 5I4JA 1J30A 3R2MA 4CVPA 1MOJA 4ISPA 1VJXA 3C1ZA 5ERKA 5FFEA 3RGDA 4XKTA 4E40A 4ITWA 2C2UA 4Y08A 4LQVA 3GE4A 3NOZX 2VXIA 3E6SA 2WWXB 4RC7A 4TOGA 4ZKWA 2Z5PA 2BK6A 3ES3A 4Z5SA 3R2SA 1JTSA 4AM4A 3FVBA 2FG4A 1JI4A 2C2JA 4LPJA 4ITTA 1TJOA 3NP2X 2V2LA 2VXXA 1XZ3A 3AK9A 5JKMA 3ISFA 3QZ3A 4IWKA 1OTKA 3WNWA 5D8XA 1JREA 1QYBA 1RYTA 2ZURX 3Q4OA 4DYYA 2CF7A 2XJMA 2FG8A 4OYNA 2JD80 2IU2A 1YV1A 3AF9X 3AJQA 1Z6OA 2YW6A 2CN7A 2V2MA 3E2CA 2WLAA 3F37A 3DBYA 3VNXA 5JACA 5J93A 3PW1B 4CY9A 5LS9A 4CYAA 1O9IA 4TOBA 2GS4A 3E1OA 3A9QA 3UOIA 2CLUA 2V2JA 5J8SA 1AEWA 1LKMA 3IS7A 4LQHA 4ZJKA 3SHXA 3GGZA 3GHQA 5CMRA 4EVDA 2FHAA 5GU1X 1RCDA 2VZBA 3KXUA 3KWOA 3PWQA 1IERA 3TA8A 2FJCA 3QHCA 4M34A 4W4LB 2XGWA 5HJFA 4PGIA 3F33A 3PW1A 3KDQA 2OKCA 4ZKXA 2V2RA 3E6RA 5HU6D 2C6RA 5ERJA 3R2HA 2FFXJ 5LBHA 4ML5A 4REUA 2IB0A 5FFBA 5D8QA 3FI6A 3E1LA 3KA4A 3R2OA 3RAVA 4A25A 1LB3A 3QD8A 1LKOA 1VEIA 4WJG4 4CVSA 1BCFA 2N02A 5CZUA 3JZ9A 4DYXA 2FZFA 4CVRA 3E1QA 5GU3X 3PZAA 3QB9A 4LYUA 3ISEA 3T9JA 2Y3QA 2HR5A 4LQNA 3AK8A 3A68A 3EZUA 2CHPA 2PYBA 3PW8C 4PGKA 3F36A 1N1QA 5J9VA 3E1JA 5GU0X 4XKUA 3LKDA 4R42A 1VEQA 3AJOA 4TO9A 4ZLWA 3AF8X 2G38B 2CN6A 3VV9A 4XGSA 4TOFA 4MJYA 2Z5QA 2WTLA 3BVLA 3FSEA 3PVYB 4KXRB 5GOUA 4II4A 1RCCA 2QF9A 1F30A 3EZ0A 1S2ZA 1TK6A 3FRSA 3C1YA 3U90A 1GWGA 2D5KA 5JKLG 2HTNA 4EVBA 2ZG8X 2CEIA 4LPMA 4IXKA 2RBDA 3BVFA 2FKZA 1JYBA 4EVCA 5LG8A 3C21A 1JGCA 1JKVA 3SIDA 4M32A 1R03A 2X170 2YJKA 3PVYA 4KVQA 3WVWA 4MXPA 5K52A 4ZL6A 3F35A 2BW1A 3RE7A 4X0JA 4TOHA 1TKPA 4TODA 2CLBA 1RCEA 3QVDA 2ZG7X 4EVEA 4PG1A 4LQJA 5E1UA 1EUMA 1YUXA 4ZL5A 1QGHA 1LKPA 3GGYA 3MPSA 1KRQA 5HJHA 5GN8B 3KX9A 2V2NA 3JZAB 2CWLA 5J8WA 3W54A 4M35A 1S30A 4ZTTA 1SOFA 3F32A 3WVVA 2V2PA 2XKQA 2C41A 1DVBA 4YXMA 2BKCA 2QQYA 4CMYA 1UVHA 1BG7A 5FFDA 2V2IA 3E1PA 5GU2X 4W4KB 3QHBA 2OH3A 2V2SA 3OJ5A 5GN8A 2XJOA 5LG2A 4IWJA 4TOAA 2V2OA 3E1MA 1VLGA 1RCIA 3PWQC 1Z6OM 3ERZA 5FFCA 3PWFA 3KA9A 3SE1A 3NP0X 3PVTB 4CVTA 2IY4A 4Z3BA 3AJPA 2ZG9X 1FHAA 4RC8A 4RC7B 5FFAA 5JDOB 4TOCA 5CMQA 3R2KA 1NF6A 1L8IA 3RBCA 1RCGA 3F38A 3C23A 5JKMG 3FRRA 5K53A 3IS8A 2G4HA 5E2DA 3PVRB 5D8OA 2YW7A 2JD70 3KA6A 2Z5RA 3PVTA 3UFBA 2JD60 4RC5B 1ZUJA 5IX6A 2V15A 1DPSA 4ZMCA 4DYUA 2GYQA 4MN9A 4AM5A 4DI0A 5JDOA 2Z90A 2UX1A 3Q4QA 1B71A 4ZKHA 2V8TA 4MY7A 4TOEA 3HL1A 3KA8A 3WVUA 4KVSA 4M33A 5D8SA 2C2FA 3E1NA 3PVRA 5AXSA 4MUDA 3VVAA 4AM2A 3Q4NA 3UNOA 2WLUA 2MGYA 1S3QA 3RD0A 1NNQA 4RC5A 3BVKA 4MKUA 1ZS3A 3M6JA 4PG0A 5JKLA 1F33A 2ITBA 2ZA6A 3HIUA 5D8RA 3KHKA 2Y44A 2FL0A 3BT5A 5C6FA 4ETRA 4YKHA 2AR0A 1NFVA 1BFRA 1H96A 4E6KA 1Z4AA 3O7SA 4U3GA 2V8UA 3L0MA 3EGMA 3OGHA 4CYBA 3UOFA 1O9RA 3D19A 2F7NA 4YVZA 3R2RA 3AF7X 2W0OA 4DYZA 2YJJA 2ZA8A 2BJYA 4RC6B 4DZ0A 5HQOA 2OC5A 3O7RA 4CMYV 3H7GA 1JIGA 1YUZA 1TKOA 1DATA 5D8PA 1VELA 2CIHA 3GVYA 3V3KB 1XZ1A 3BVIA 4LYXA 1L8HA 4QUWA 1JI5A 3SH6A 4YXJA 3PW8A 1MFRA 4DASA 1HRSA 1JKUA 3F39A 5D8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DE6 A;  4XKS A;  3F34 A;  3KA3 A;  2CHI A;  4P18 A;  4ISM A;  5FEJ A;  3Q4R A;  3BVE A;  4RC6 A;  4LPN A;  1UMN A;  4TW3 A;  4II4 B;  1NF4 A;  1IES A;  3R2L A;  2XJN A;  3IQ1 A;  4ERU A;  2GYD A;  2Z6M A;  2ZA7 A;  1SQ3 A;  3BKN A;  4KVR A;  5I4J A;  1J30 A;  3R2M A;  4CVP A;  1MOJ A;  4ISP A;  1VJX A;  5ERK A;  5FFE A;  3RGD A;  4XKT A;  4ITW A;  2C2U A;  4Y08 A;  4LQV A;  3GE4 A;  3NOZ X;  2VXI A;  3E6S A;  4RC7 A;  4TOG A;  4ZKW A;  2Z5P A;  2BK6 A;  3ES3 A;  4Z5S A;  3R2S A;  1JTS A;  4AM4 A;  3FVB A;  2FG4 A;  1JI4 A;  2C2J A;  4LPJ A;  4ITT A;  1TJO A;  3NP2 X;  2V2L A;  2VXX A;  1XZ3 A;  3AK9 A;  5JKM A;  3ISF A;  3QZ3 A;  4IWK A;  1OTK A;  3WNW A;  5D8X A;  1JRE A;  1QYB A;  1RYT A;  2ZUR X;  3Q4O A;  4DYY A;  2CF7 A;  2XJM A;  2FG8 A;  4OYN A;  2JD8 0;  2IU2 A;  1YV1 A;  3AF9 X;  3AJQ A;  1Z6O A;  2YW6 A;  2CN7 A;  2V2M A;  3E2C A;  2WLA A;  3F37 A;  3VNX A;  5JAC A;  5J93 A;  3PW1 B;  4CY9 A;  5LS9 A;  4CYA A;  1O9I A;  4TOB A;  2GS4 A;  3E1O A;  3A9Q A;  3UOI A;  2CLU A;  2V2J A;  5J8S A;  1AEW A;  1LKM A;  3IS7 A;  4LQH A;  4ZJK A;  3SHX A;  3GHQ A;  5CMR A;  4EVD A;  2FHA A;  5GU1 X;  1RCD A;  2VZB A;  3KXU A;  3KWO A;  3PWQ A;  1IER A;  3TA8 A;  2FJC A;  3QHC A;  4M34 A;  2XGW A;  5HJF A;  4PGI A;  3F33 A;  3PW1 A;  4ZKX A;  2V2R A;  3E6R A;  2C6R A;  5ERJ A;  3R2H A;  2FFX J;  5LBH A;  4ML5 A;  4REU A;  2IB0 A;  5FFB A;  5D8Q A;  3FI6 A;  3E1L A;  3KA4 A;  3R2O A;  3RAV A;  4A25 A;  1LB3 A;  3QD8 A;  1LKO A;  1VEI A;  4CVS A;  1BCF A;  5CZU A;  4DYX A;  2FZF A;  4CVR A;  3E1Q A;  5GU3 X;  3PZA A;  3QB9 A;  4LYU A;  3ISE A;  3T9J A;  2Y3Q A;  2HR5 A;  4LQN A;  3AK8 A;  3A68 A;  3EZU A;  2CHP A;  2PYB A;  3PW8 C;  4PGK A;  3F36 A;  1N1Q A;  5J9V A;  3E1J A;  5GU0 X;  4XKU A;  4R42 A;  1VEQ A;  3AJO A;  4TO9 A;  4ZLW A;  3AF8 X;  2CN6 A;  4XGS A;  4TOF A;  4MJY A;  2Z5Q A;  2WTL A;  3BVL A;  3FSE A;  3PVY B;  5GOU A;  4II4 A;  1RCC A;  2QF9 A;  1F30 A;  3EZ0 A;  1S2Z A;  1TK6 A;  3U90 A;  1GWG A;  2D5K A;  5JKL G;  2HTN A;  4EVB A;  2ZG8 X;  2CEI A;  4LPM A;  4IXK A;  2RBD A;  3BVF A;  2FKZ A;  1JYB A;  4EVC A;  5LG8 A;  1JGC A;  1JKV A;  3SID A;  4M32 A;  1R03 A;  2X17 0;  2YJK A;  3PVY A;  4KVQ A;  3WVW A;  5K52 A;  4ZL6 A;  3F35 A;  2BW1 A;  3RE7 A;  4TOH A;  1TKP A;  4TOD A;  2CLB A;  1RCE A;  3QVD A;  2ZG7 X;  4EVE A;  4PG1 A;  4LQJ A;  5E1U A;  1EUM A;  1YUX A;  4ZL5 A;  1QGH A;  1LKP A;  3MPS A;  1KRQ A;  5HJH A;  5GN8 B;  3KX9 A;  2V2N A;  5J8W A;  4M35 A;  1S30 A;  4ZTT A;  1SOF A;  3F32 A;  3WVV A;  2V2P A;  2XKQ A;  2C41 A;  1DVB A;  2BKC A;  2QQY A;  4CMY A;  1UVH A;  1BG7 A;  5FFD A;  2V2I A;  3E1P A;  5GU2 X;  3QHB A;  2OH3 A;  2V2S A;  3OJ5 A;  5GN8 A;  2XJO A;  5LG2 A;  4IWJ A;  4TOA A;  2V2O A;  3E1M A;  1VLG A;  1RCI A;  3PWQ C;  1Z6O M;  3ERZ A;  5FFC A;  3PWF A;  3KA9 A;  3SE1 A;  3NP0 X;  3PVT B;  4CVT A;  2IY4 A;  4Z3B A;  3AJP A;  2ZG9 X;  1FHA A;  4RC8 A;  4RC7 B;  5FFA A;  4TOC A;  5CMQ A;  3R2K A;  1NF6 A;  1L8I A;  3RBC A;  1RCG A;  3F38 A;  5JKM G;  5K53 A;  3IS8 A;  2G4H A;  5E2D A;  3PVR B;  5D8O A;  2YW7 A;  2JD7 0;  3KA6 A;  2Z5R A;  3PVT A;  2JD6 0;  4RC5 B;  1ZUJ A;  5IX6 A;  2V15 A;  1DPS A;  4ZMC A;  4DYU A;  2GYQ A;  4MN9 A;  4AM5 A;  4DI0 A;  2Z90 A;  2UX1 A;  3Q4Q A;  1B71 A;  4ZKH A;  4MY7 A;  4TOE A;  3HL1 A;  3KA8 A;  3WVU A;  4KVS A;  4M33 A;  5D8S A;  2C2F A;  3E1N A;  3PVR A;  5AXS A;  4MUD A;  4AM2 A;  3Q4N A;  3UNO A;  2WLU A;  1S3Q A;  3RD0 A;  1NNQ A;  4RC5 A;  3BVK A;  4MKU A;  1ZS3 A;  4PG0 A;  5JKL A;  1F33 A;  2ITB A;  2ZA6 A;  3HIU A;  5D8R A;  2FL0 A;  3BT5 A;  5C6F A;  4ETR A;  4YKH A;  1NFV A;  1BFR A;  1H96 A;  4E6K A;  1Z4A A;  3O7S A;  4U3G A;  3EGM A;  3OGH A;  4CYB A;  3UOF A;  1O9R A;  2F7N A;  3R2R A;  3AF7 X;  2W0O A;  4DYZ A;  2YJJ A;  2ZA8 A;  2BJY A;  4RC6 B;  4DZ0 A;  5HQO A;  2OC5 A;  3O7R A;  4CMY V;  3H7G A;  1JIG A;  1YUZ A;  1TKO A;  1DAT A;  5D8P A;  1VEL A;  2CIH A;  3GVY A;  1XZ1 A;  3BVI A;  4LYX A;  1L8H A;  4QUW A;  1JI5 A;  3SH6 A;  3PW8 A;  1MFR A;  4DAS A;  1HRS A;  1JKU A;  3F39 A;  5D8Y A; 
#chains in the Genus database with same CATH topology
 4DE6 A;  4XKS A;  3N6O A;  3F34 A;  3KA3 A;  2CHI A;  4P18 A;  4ISM A;  5FEJ A;  3Q4R A;  3BVE A;  4RC6 A;  4LPN A;  1UMN A;  4TW3 A;  4II4 B;  1NF4 A;  1IES A;  3R2L A;  2XJN A;  3IQ1 A;  4ERU A;  2GYD A;  2Z6M A;  2ZA7 A;  1SQ3 A;  3BKN A;  4KVR A;  5I4J A;  1J30 A;  3R2M A;  4CVP A;  1MOJ A;  4ISP A;  1VJX A;  3C1Z A;  5ERK A;  5FFE A;  3RGD A;  4XKT A;  4E40 A;  4ITW A;  2C2U A;  4Y08 A;  4LQV A;  3GE4 A;  3NOZ X;  2VXI A;  3E6S A;  2WWX B;  4RC7 A;  4TOG A;  4ZKW A;  2Z5P A;  2BK6 A;  3ES3 A;  4Z5S A;  3R2S A;  1JTS A;  4AM4 A;  3FVB A;  2FG4 A;  1JI4 A;  2C2J A;  4LPJ A;  4ITT A;  1TJO A;  3NP2 X;  2V2L A;  2VXX A;  1XZ3 A;  3AK9 A;  5JKM A;  3ISF A;  3QZ3 A;  4IWK A;  1OTK A;  3WNW A;  5D8X A;  1JRE A;  1QYB A;  1RYT A;  2ZUR X;  3Q4O A;  4DYY A;  2CF7 A;  2XJM A;  2FG8 A;  4OYN A;  2JD8 0;  2IU2 A;  1YV1 A;  3AF9 X;  3AJQ A;  1Z6O A;  2YW6 A;  2CN7 A;  2V2M A;  3E2C A;  2WLA A;  3F37 A;  3DBY A;  3VNX A;  5JAC A;  5J93 A;  3PW1 B;  4CY9 A;  5LS9 A;  4CYA A;  1O9I A;  4TOB A;  2GS4 A;  3E1O A;  3A9Q A;  3UOI A;  2CLU A;  2V2J A;  5J8S A;  1AEW A;  1LKM A;  3IS7 A;  4LQH A;  4ZJK A;  3SHX A;  3GGZ A;  3GHQ A;  5CMR A;  4EVD A;  2FHA A;  5GU1 X;  1RCD A;  2VZB A;  3KXU A;  3KWO A;  3PWQ A;  1IER A;  3TA8 A;  2FJC A;  3QHC A;  4M34 A;  4W4L B;  2XGW A;  5HJF A;  4PGI A;  3F33 A;  3PW1 A;  3KDQ A;  2OKC A;  4ZKX A;  2V2R A;  3E6R A;  5HU6 D;  2C6R A;  5ERJ A;  3R2H A;  2FFX J;  5LBH A;  4ML5 A;  4REU A;  2IB0 A;  5FFB A;  5D8Q A;  3FI6 A;  3E1L A;  3KA4 A;  3R2O A;  3RAV A;  4A25 A;  1LB3 A;  3QD8 A;  1LKO A;  1VEI A;  4WJG 4;  4CVS A;  1BCF A;  2N02 A;  5CZU A;  3JZ9 A;  4DYX A;  2FZF A;  4CVR A;  3E1Q A;  5GU3 X;  3PZA A;  3QB9 A;  4LYU A;  3ISE A;  3T9J A;  2Y3Q A;  2HR5 A;  4LQN A;  3AK8 A;  3A68 A;  3EZU A;  2CHP A;  2PYB A;  3PW8 C;  4PGK A;  3F36 A;  1N1Q A;  5J9V A;  3E1J A;  5GU0 X;  4XKU A;  3LKD A;  4R42 A;  1VEQ A;  3AJO A;  4TO9 A;  4ZLW A;  3AF8 X;  2G38 B;  2CN6 A;  3VV9 A;  4XGS A;  4TOF A;  4MJY A;  2Z5Q A;  2WTL A;  3BVL A;  3FSE A;  3PVY B;  4KXR B;  5GOU A;  4II4 A;  1RCC A;  2QF9 A;  1F30 A;  3EZ0 A;  1S2Z A;  1TK6 A;  3FRS A;  3C1Y A;  3U90 A;  1GWG A;  2D5K A;  5JKL G;  2HTN A;  4EVB A;  2ZG8 X;  2CEI A;  4LPM A;  4IXK A;  2RBD A;  3BVF A;  2FKZ A;  1JYB A;  4EVC A;  5LG8 A;  3C21 A;  1JGC A;  1JKV A;  3SID A;  4M32 A;  1R03 A;  2X17 0;  2YJK A;  3PVY A;  4KVQ A;  3WVW A;  4MXP A;  5K52 A;  4ZL6 A;  3F35 A;  2BW1 A;  3RE7 A;  4X0J A;  4TOH A;  1TKP A;  4TOD A;  2CLB A;  1RCE A;  3QVD A;  2ZG7 X;  4EVE A;  4PG1 A;  4LQJ A;  5E1U A;  1EUM A;  1YUX A;  4ZL5 A;  1QGH A;  1LKP A;  3GGY A;  3MPS A;  1KRQ A;  5HJH A;  5GN8 B;  3KX9 A;  2V2N A;  3JZA B;  2CWL A;  5J8W A;  3W54 A;  4M35 A;  1S30 A;  4ZTT A;  1SOF A;  3F32 A;  3WVV A;  2V2P A;  2XKQ A;  2C41 A;  1DVB A;  4YXM A;  2BKC A;  2QQY A;  4CMY A;  1UVH A;  1BG7 A;  5FFD A;  2V2I A;  3E1P A;  5GU2 X;  4W4K B;  3QHB A;  2OH3 A;  2V2S A;  3OJ5 A;  5GN8 A;  2XJO A;  5LG2 A;  4IWJ A;  4TOA A;  2V2O A;  3E1M A;  1VLG A;  1RCI A;  3PWQ C;  1Z6O M;  3ERZ A;  5FFC A;  3PWF A;  3KA9 A;  3SE1 A;  3NP0 X;  3PVT B;  4CVT A;  2IY4 A;  4Z3B A;  3AJP A;  2ZG9 X;  1FHA A;  4RC8 A;  4RC7 B;  5FFA A;  5JDO B;  4TOC A;  5CMQ A;  3R2K A;  1NF6 A;  1L8I A;  3RBC A;  1RCG A;  3F38 A;  3C23 A;  5JKM G;  3FRR A;  5K53 A;  3IS8 A;  2G4H A;  5E2D A;  3PVR B;  5D8O A;  2YW7 A;  2JD7 0;  3KA6 A;  2Z5R A;  3PVT A;  3UFB A;  2JD6 0;  4RC5 B;  1ZUJ A;  5IX6 A;  2V15 A;  1DPS A;  4ZMC A;  4DYU A;  2GYQ A;  4MN9 A;  4AM5 A;  4DI0 A;  5JDO A;  2Z90 A;  2UX1 A;  3Q4Q A;  1B71 A;  4ZKH A;  2V8T A;  4MY7 A;  4TOE A;  3HL1 A;  3KA8 A;  3WVU A;  4KVS A;  4M33 A;  5D8S A;  2C2F A;  3E1N A;  3PVR A;  5AXS A;  4MUD A;  3VVA A;  4AM2 A;  3Q4N A;  3UNO A;  2WLU A;  2MGY A;  1S3Q A;  3RD0 A;  1NNQ A;  4RC5 A;  3BVK A;  4MKU A;  1ZS3 A;  3M6J A;  4PG0 A;  5JKL A;  1F33 A;  2ITB A;  2ZA6 A;  3HIU A;  5D8R A;  3KHK A;  2Y44 A;  2FL0 A;  3BT5 A;  5C6F A;  4ETR A;  4YKH A;  2AR0 A;  1NFV A;  1BFR A;  1H96 A;  4E6K A;  1Z4A A;  3O7S A;  4U3G A;  2V8U A;  3L0M A;  3EGM A;  3OGH A;  4CYB A;  3UOF A;  1O9R A;  3D19 A;  2F7N A;  4YVZ A;  3R2R A;  3AF7 X;  2W0O A;  4DYZ A;  2YJJ A;  2ZA8 A;  2BJY A;  4RC6 B;  4DZ0 A;  5HQO A;  2OC5 A;  3O7R A;  4CMY V;  3H7G A;  1JIG A;  1YUZ A;  1TKO A;  1DAT A;  5D8P A;  1VEL A;  2CIH A;  3GVY A;  3V3K B;  1XZ1 A;  3BVI A;  4LYX A;  1L8H A;  4QUW A;  1JI5 A;  3SH6 A;  4YXJ A;  3PW8 A;  1MFR A;  4DAS A;  1HRS A;  1JKU A;  3F39 A;  5D8Y A; 
#chains in the Genus database with same CATH homology
 4DE6 A;  4XKS A;  3N6O A;  3F34 A;  3KA3 A;  2CHI A;  4P18 A;  4ISM A;  5FEJ A;  3Q4R A;  3BVE A;  4RC6 A;  4LPN A;  1UMN A;  4TW3 A;  4II4 B;  1NF4 A;  1IES A;  3R2L A;  2XJN A;  3IQ1 A;  4ERU A;  2GYD A;  2Z6M A;  2ZA7 A;  1SQ3 A;  3BKN A;  4KVR A;  5I4J A;  1J30 A;  3R2M A;  4CVP A;  1MOJ A;  4ISP A;  1VJX A;  3C1Z A;  5ERK A;  5FFE A;  3RGD A;  4XKT A;  4E40 A;  4ITW A;  2C2U A;  4Y08 A;  4LQV A;  3GE4 A;  3NOZ X;  2VXI A;  3E6S A;  2WWX B;  4RC7 A;  4TOG A;  4ZKW A;  2Z5P A;  2BK6 A;  3ES3 A;  4Z5S A;  3R2S A;  1JTS A;  4AM4 A;  3FVB A;  2FG4 A;  1JI4 A;  2C2J A;  4LPJ A;  4ITT A;  1TJO A;  3NP2 X;  2V2L A;  2VXX A;  1XZ3 A;  3AK9 A;  5JKM A;  3ISF A;  3QZ3 A;  4IWK A;  1OTK A;  3WNW A;  5D8X A;  1JRE A;  1QYB A;  1RYT A;  2ZUR X;  3Q4O A;  4DYY A;  2CF7 A;  2XJM A;  2FG8 A;  4OYN A;  2JD8 0;  2IU2 A;  1YV1 A;  3AF9 X;  3AJQ A;  1Z6O A;  2YW6 A;  2CN7 A;  2V2M A;  3E2C A;  2WLA A;  3F37 A;  3DBY A;  3VNX A;  5JAC A;  5J93 A;  3PW1 B;  4CY9 A;  5LS9 A;  4CYA A;  1O9I A;  4TOB A;  2GS4 A;  3E1O A;  3A9Q A;  3UOI A;  2CLU A;  2V2J A;  5J8S A;  1AEW A;  1LKM A;  3IS7 A;  4LQH A;  4ZJK A;  3SHX A;  3GGZ A;  3GHQ A;  5CMR A;  4EVD A;  2FHA A;  5GU1 X;  1RCD A;  2VZB A;  3KXU A;  3KWO A;  3PWQ A;  1IER A;  3TA8 A;  2FJC A;  3QHC A;  4M34 A;  4W4L B;  2XGW A;  5HJF A;  4PGI A;  3F33 A;  3PW1 A;  3KDQ A;  2OKC A;  4ZKX A;  2V2R A;  3E6R A;  5HU6 D;  2C6R A;  5ERJ A;  3R2H A;  2FFX J;  5LBH A;  4ML5 A;  4REU A;  2IB0 A;  5FFB A;  5D8Q A;  3FI6 A;  3E1L A;  3KA4 A;  3R2O A;  3RAV A;  4A25 A;  1LB3 A;  3QD8 A;  1LKO A;  1VEI A;  4WJG 4;  4CVS A;  1BCF A;  2N02 A;  5CZU A;  3JZ9 A;  4DYX A;  2FZF A;  4CVR A;  3E1Q A;  5GU3 X;  3PZA A;  3QB9 A;  4LYU A;  3ISE A;  3T9J A;  2Y3Q A;  2HR5 A;  4LQN A;  3AK8 A;  3A68 A;  3EZU A;  2CHP A;  2PYB A;  3PW8 C;  4PGK A;  3F36 A;  1N1Q A;  5J9V A;  3E1J A;  5GU0 X;  4XKU A;  3LKD A;  4R42 A;  1VEQ A;  3AJO A;  4TO9 A;  4ZLW A;  3AF8 X;  2G38 B;  2CN6 A;  3VV9 A;  4XGS A;  4TOF A;  4MJY A;  2Z5Q A;  2WTL A;  3BVL A;  3FSE A;  3PVY B;  4KXR B;  5GOU A;  4II4 A;  1RCC A;  2QF9 A;  1F30 A;  3EZ0 A;  1S2Z A;  1TK6 A;  3FRS A;  3C1Y A;  3U90 A;  1GWG A;  2D5K A;  5JKL G;  2HTN A;  4EVB A;  2ZG8 X;  2CEI A;  4LPM A;  4IXK A;  2RBD A;  3BVF A;  2FKZ A;  1JYB A;  4EVC A;  5LG8 A;  3C21 A;  1JGC A;  1JKV A;  3SID A;  4M32 A;  1R03 A;  2X17 0;  2YJK A;  3PVY A;  4KVQ A;  3WVW A;  4MXP A;  5K52 A;  4ZL6 A;  3F35 A;  2BW1 A;  3RE7 A;  4X0J A;  4TOH A;  1TKP A;  4TOD A;  2CLB A;  1RCE A;  3QVD A;  2ZG7 X;  4EVE A;  4PG1 A;  4LQJ A;  5E1U A;  1EUM A;  1YUX A;  4ZL5 A;  1QGH A;  1LKP A;  3GGY A;  3MPS A;  1KRQ A;  5HJH A;  5GN8 B;  3KX9 A;  2V2N A;  3JZA B;  2CWL A;  5J8W A;  3W54 A;  4M35 A;  1S30 A;  4ZTT A;  1SOF A;  3F32 A;  3WVV A;  2V2P A;  2XKQ A;  2C41 A;  1DVB A;  4YXM A;  2BKC A;  2QQY A;  4CMY A;  1UVH A;  1BG7 A;  5FFD A;  2V2I A;  3E1P A;  5GU2 X;  4W4K B;  3QHB A;  2OH3 A;  2V2S A;  3OJ5 A;  5GN8 A;  2XJO A;  5LG2 A;  4IWJ A;  4TOA A;  2V2O A;  3E1M A;  1VLG A;  1RCI A;  3PWQ C;  1Z6O M;  3ERZ A;  5FFC A;  3PWF A;  3KA9 A;  3SE1 A;  3NP0 X;  3PVT B;  4CVT A;  2IY4 A;  4Z3B A;  3AJP A;  2ZG9 X;  1FHA A;  4RC8 A;  4RC7 B;  5FFA A;  5JDO B;  4TOC A;  5CMQ A;  3R2K A;  1NF6 A;  1L8I A;  3RBC A;  1RCG A;  3F38 A;  3C23 A;  5JKM G;  3FRR A;  5K53 A;  3IS8 A;  2G4H A;  5E2D A;  3PVR B;  5D8O A;  2YW7 A;  2JD7 0;  3KA6 A;  2Z5R A;  3PVT A;  3UFB A;  2JD6 0;  4RC5 B;  1ZUJ A;  5IX6 A;  2V15 A;  1DPS A;  4ZMC A;  4DYU A;  2GYQ A;  4MN9 A;  4AM5 A;  4DI0 A;  5JDO A;  2Z90 A;  2UX1 A;  3Q4Q A;  1B71 A;  4ZKH A;  2V8T A;  4MY7 A;  4TOE A;  3HL1 A;  3KA8 A;  3WVU A;  4KVS A;  4M33 A;  5D8S A;  2C2F A;  3E1N A;  3PVR A;  5AXS A;  4MUD A;  3VVA A;  4AM2 A;  3Q4N A;  3UNO A;  2WLU A;  2MGY A;  1S3Q A;  3RD0 A;  1NNQ A;  4RC5 A;  3BVK A;  4MKU A;  1ZS3 A;  3M6J A;  4PG0 A;  5JKL A;  1F33 A;  2ITB A;  2ZA6 A;  3HIU A;  5D8R A;  3KHK A;  2Y44 A;  2FL0 A;  3BT5 A;  5C6F A;  4ETR A;  4YKH A;  2AR0 A;  1NFV A;  1BFR A;  1H96 A;  4E6K A;  1Z4A A;  3O7S A;  4U3G A;  2V8U A;  3L0M A;  3EGM A;  3OGH A;  4CYB A;  3UOF A;  1O9R A;  3D19 A;  2F7N A;  4YVZ A;  3R2R A;  3AF7 X;  2W0O A;  4DYZ A;  2YJJ A;  2ZA8 A;  2BJY A;  4RC6 B;  4DZ0 A;  5HQO A;  2OC5 A;  3O7R A;  4CMY V;  3H7G A;  1JIG A;  1YUZ A;  1TKO A;  1DAT A;  5D8P A;  1VEL A;  2CIH A;  3GVY A;  3V3K B;  1XZ1 A;  3BVI A;  4LYX A;  1L8H A;  4QUW A;  1JI5 A;  3SH6 A;  4YXJ A;  3PW8 A;  1MFR A;  4DAS A;  1HRS A;  1JKU A;  3F39 A;  5D8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...