1JREA

Dna protection and binding by e. coli dps protein
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
157
structure length
157
Chain Sequence
ATNLLYTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALICHLATMAERAVQLGGVALGTTQVINSKTPLKSYPLDIHNVQDHLKELADRYAIVANDVRKAIGEAKDDDTADILTAASRDLDKFLWFIESNIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PROTECTION DURING STARVATION PROTEIN
publication title DNA Protection and Binding by E. Coli Dps Protein
rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 63
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2001-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1jreA00
4Y08A 4AM4A 5GU1X 1J30A 1SOFA 1F33A 3ERZA 4MY7A 2VXIA 1ZS3A 3UNOA 3BVLA 5GOUA 2VZBA 5C6FA 1FHAA 4LQVA 1DVBA 3PW8A 3RE7A 3E1PA 3E2CA 4ETRA 5HQOA 4RC5A 4DYXA 2CIHA 4LQHA 3RGDA 4CVRA 2C6RA 4MN9A 4R42A 1LKMA 2YJJA 1RCEA 2V2JA 1LKOA 5GN8B 3EGMA 4CVTA 2GS4A 4AM5A 2CLUA 2Y3QA 4DI0A 2FG4A 4II4B 3GE4A 5CZUA 3OJ5A 4DYYA 3KX9A 2X170 3QB9A 4EVBA 4DE6A 2F7NA 4LPNA 5GU2X 4LQNA 3SH6A 1S3QA 5JKMA 1HRSA 2C2FA 4M34A 1VELA 5CMQA 5D8SA 1O9IA 4CVPA 3RBCA 2V2RA 3R2MA 3F37A 3BVKA 1RCDA 3U90A 5LG8A 3QD8A 4RC6A 1XZ1A 2Z90A 5AXSA 4TOFA 2OC5A 2V2MA 2V2PA 1DATA 2ZG8X 2CN6A 3E6RA 2PYBA 3PVTA 5JKMG 3AF7X 4DYUA 3ES3A 2BK6A 2D5KA 4ZLWA 4ISMA 4LYUA 4ZKXA 4ZL6A 3BT5A 2CHIA 2JD70 5D8YA 4RC5B 5JACA 2BKCA 3EZUA 3IS8A 3E1MA 2XKQA 3O7SA 1QYBA 3QZ3A 2YW7A 4ZKWA 2FKZA 2CEIA 4U3GA 3E1QA 4ZJKA 1JKUA 5JKLA 4IWKA 3R2RA 5IX6A 1BFRA 5LS9A 2C2JA 3FI6A 2XJOA 1L8IA 3O7RA 2CLBA 4ERUA 3KXUA 2UX1A 4RC7A 1IERA 3PW1B 4TODA 5LG2A 4ZMCA 2YJKA 2ZG7X 2IB0A 1OTKA 3R2KA 4XKSA 3KA4A 5ERKA 1JKVA 1Z6OM 5JKLG 1NF4A 3R2LA 5D8QA 2FZFA 3H7GA 3AJOA 5FFCA 3IQ1A 1TKPA 3A9QA 2IY4A 4M35A 4ZL5A 4KVSA 2QQYA 2CF7A 1YUXA 2XJMA 3Q4RA 5CMRA 4TOHA 3VNXA 2Z5PA 1B71A 3QHCA 3E1OA 4ITWA 5HJFA 2GYQA 4KVQA 5D8RA 4E6KA 3BKNA 4PGKA 4QUWA 2ITBA 4TOEA 3MPSA 3QHBA 4IWJA 1MFRA 3PWFA 3WVVA 1VEQA 4ITTA 5J9VA 3A68A 3AJPA 2HTNA 2FJCA 1NFVA 3E6SA 5LBHA 3RD0A 1MOJA 3AJQA 5K52A 4CY9A 1JYBA 1JI4A 4MJYA 4LPMA 3PZAA 3R2OA 5ERJA 3F34A 4DYZA 1YV1A 1TK6A 2C41A 3WVWA 4RC7B 1H96A 1NNQA 4CVSA 2JD80 3PVYA 2FFXJ 2Z5RA 4KVRA 3KA6A 3NP0X 3Q4OA 3IS7A 3R2HA 5FFBA 4CYBA 2JD60 5D8OA 1XZ3A 1RCGA 5GU0X 3KWOA 4TOBA 4CMYA 1TJOA 4PG0A 2WLAA 4IXKA 4MUDA 5D8PA 2V2LA 3HL1A 1RCCA 3F32A 1ZUJA 3F33A 4EVDA 1VEIA 1N1QA 4ML5A 3SE1A 2V2NA 1F30A 3OGHA 2CN7A 1VLGA 3WNWA 3F36A 2CHPA 3AF8X 2IU2A 4REUA 2WTLA 3E1NA 1O9RA 3FSEA 3KA3A 1IESA 4DASA 2RBDA 1JI5A 1AEWA 3FVBA 2FHAA 3KA9A 4TOCA 4Z3BA 4XKUA 3E1LA 3ISFA 2V15A 2V2OA 3SHXA 2W0OA 1QGHA 2QF9A 3GVYA 3ISEA 2V2SA 4XGSA 3AF9X 4M32A 2HR5A 3SIDA 3GHQA 2FG8A 4RC6B 2Z5QA 2C2UA 2VXXA 2ZA8A 4XKTA 1LB3A 1RYTA 2ZG9X 4RC8A 1YUZA 4EVCA 4LPJA 3PVYB 3WVUA 5J8SA 5FFEA 4EVEA 4DZ0A 3PVTB 2OH3A 3PWQC 3R2SA 3F39A 3BVIA 4MKUA 5K53A 3PVRA 2YW6A 1JGCA 1LKPA 1Z6OA 3EZ0A 3QVDA 5HJHA 1SQ3A 1GWGA 3F35A 4PGIA 3T9JA 3BVEA 2XGWA 1S30A 5J93A 2G4HA 1JIGA 3Q4NA 2FL0A 2WLUA 3PW1A 1L8HA 4TOAA 2Z6MA 4ZKHA 3NOZX 5J8WA 3NP2X 1DPSA 3PW8C 1S2ZA 4CYAA 4TO9A 5GU3X 4CMYV 4OYNA 4Z5SA 3KA8A 2ZA7A 1KRQA 1JREA 3RAVA 1RCIA 4TOGA 4ZTTA 5I4JA 5FFDA 3TA8A 4LQJA 1Z4AA 4TW3A 3Q4QA 5GN8A 1JTSA 3HIUA 2GYDA 5FEJA 4AM2A 5D8XA 1BCFA 3F38A 2BJYA 2V2IA 3UOIA 4A25A 2ZURX 1UVHA 4II4A 3UOFA 1BG7A 2ZA6A 1EUMA 3E1JA 1UMNA 4YKHA 3PWQA 5E2DA 3PVRB 1NF6A 4PG1A 1VJXA 3AK8A 4LYXA 1TKOA 2BW1A 5E1UA 1R03A 3BVFA 3AK9A 2XJNA 4ISPA 4P18A 5FFAA 4M33A
chains in the Genus database with same CATH superfamily
4Y08A 4AM4A 5GU1X 1J30A 1SOFA 1F33A 3ERZA 4MY7A 2VXIA 4MXPA 3FRRA 1ZS3A 3UNOA 3BVLA 5GOUA 2VZBA 2Y44A 5C6FA 1FHAA 4LQVA 1DVBA 3PW8A 3RE7A 3E1PA 3E2CA 4ETRA 5HQOA 4RC5A 4DYXA 2CIHA 4LQHA 3RGDA 4CVRA 2C6RA 4MN9A 4R42A 1LKMA 2YJJA 1RCEA 2V2JA 1LKOA 5GN8B 3EGMA 3C23A 4CVTA 2GS4A 4AM5A 2CLUA 2Y3QA 4DI0A 2FG4A 4II4B 3GE4A 5CZUA 4W4LB 3OJ5A 4DYYA 3KX9A 2X170 3QB9A 4EVBA 4DE6A 2F7NA 4LPNA 5GU2X 4LQNA 3SH6A 3C1ZA 1S3QA 5JKMA 1HRSA 2C2FA 4M34A 1VELA 5CMQA 5D8SA 1O9IA 4CVPA 3RBCA 2V2RA 3R2MA 3F37A 3BVKA 1RCDA 3U90A 5LG8A 3QD8A 4RC6A 1XZ1A 2Z90A 4KXRB 5AXSA 4TOFA 2OC5A 2V2MA 2V2PA 1DATA 2ZG8X 2CN6A 3E6RA 2PYBA 3PVTA 5JKMG 3AF7X 4DYUA 3ES3A 2BK6A 2D5KA 4ZLWA 4ISMA 4LYUA 4ZKXA 4ZL6A 3BT5A 2CHIA 2JD70 5D8YA 4RC5B 5JACA 2BKCA 3EZUA 3IS8A 3E1MA 2XKQA 3O7SA 1QYBA 3QZ3A 2YW7A 4ZKWA 2FKZA 3DBYA 2CEIA 4U3GA 3E1QA 4ZJKA 1JKUA 5JKLA 2MGYA 4IWKA 3R2RA 5IX6A 1BFRA 5LS9A 2C2JA 3FI6A 2XJOA 1L8IA 3O7RA 2CLBA 4ERUA 3KXUA 2UX1A 4RC7A 1IERA 3PW1B 4TODA 5LG2A 4ZMCA 2YJKA 2ZG7X 3N6OA 2IB0A 1OTKA 2WWXB 3R2KA 4XKSA 3KA4A 5ERKA 1JKVA 1Z6OM 5JKLG 2N02A 1NF4A 3R2LA 5D8QA 2FZFA 3H7GA 3AJOA 5FFCA 3IQ1A 1TKPA 3A9QA 4YXMA 2IY4A 4M35A 4ZL5A 4KVSA 2QQYA 2CF7A 1YUXA 2XJMA 3Q4RA 5CMRA 4TOHA 3VNXA 2Z5PA 1B71A 3KDQA 3QHCA 3E1OA 4ITWA 5HJFA 2GYQA 4KVQA 5D8RA 4E6KA 3BKNA 4PGKA 4QUWA 2ITBA 3VVAA 4TOEA 3UFBA 3MPSA 2CWLA 3QHBA 4IWJA 1MFRA 3PWFA 3WVVA 2AR0A 1VEQA 4ITTA 5J9VA 3A68A 3AJPA 2HTNA 2FJCA 1NFVA 3E6SA 5LBHA 3RD0A 1MOJA 3AJQA 5K52A 4CY9A 1JYBA 1JI4A 4MJYA 4LPMA 3PZAA 3R2OA 5ERJA 3F34A 4DYZA 1YV1A 1TK6A 2C41A 3WVWA 4RC7B 1H96A 1NNQA 4CVSA 2JD80 3PVYA 2FFXJ 2Z5RA 4KVRA 3VV9A 3KA6A 3NP0X 3Q4OA 3IS7A 3R2HA 5FFBA 4CYBA 2JD60 5D8OA 1XZ3A 1RCGA 5GU0X 3V3KB 3KWOA 4TOBA 4CMYA 1TJOA 4PG0A 2WLAA 4IXKA 4MUDA 5D8PA 2V2LA 3HL1A 1RCCA 3D19A 3F32A 1ZUJA 3F33A 4EVDA 1VEIA 1N1QA 4ML5A 3SE1A 2V2NA 1F30A 3OGHA 2CN7A 1VLGA 3WNWA 3F36A 2CHPA 3AF8X 2IU2A 4REUA 4WJG4 2WTLA 3E1NA 1O9RA 3FSEA 3KA3A 1IESA 4DASA 2RBDA 1JI5A 1AEWA 3FVBA 2FHAA 4YVZA 3KA9A 4TOCA 4Z3BA 4XKUA 3E1LA 3ISFA 2V15A 3GGYA 3LKDA 2V2OA 4W4KB 3SHXA 2W0OA 1QGHA 2QF9A 3GVYA 3M6JA 3ISEA 2V2SA 4YXJA 4XGSA 3AF9X 4M32A 2HR5A 3SIDA 3GHQA 2FG8A 4RC6B 2Z5QA 2C2UA 2VXXA 2ZA8A 4XKTA 1LB3A 1RYTA 2ZG9X 4RC8A 1YUZA 4EVCA 4LPJA 3PVYB 3WVUA 5J8SA 5FFEA 3JZ9A 4EVEA 4DZ0A 3L0MA 3PVTB 2OH3A 3PWQC 3R2SA 3F39A 2G38B 3BVIA 3JZAB 4MKUA 5K53A 5JDOA 3PVRA 2YW6A 1JGCA 1LKPA 1Z6OA 3EZ0A 3QVDA 5HJHA 3C21A 1SQ3A 1GWGA 4E40A 3F35A 4PGIA 3T9JA 2V8TA 3BVEA 2XGWA 4X0JA 1S30A 5J93A 2G4HA 1JIGA 3Q4NA 2FL0A 2WLUA 3PW1A 1L8HA 4TOAA 2Z6MA 4ZKHA 3NOZX 5J8WA 3NP2X 1DPSA 3PW8C 1S2ZA 4CYAA 3FRSA 4TO9A 5GU3X 4CMYV 4OYNA 4Z5SA 3KA8A 2ZA7A 1KRQA 1JREA 3RAVA 1RCIA 4TOGA 4ZTTA 5I4JA 5FFDA 3TA8A 4LQJA 1Z4AA 3W54A 4TW3A 3Q4QA 5GN8A 5HU6D 2OKCA 1JTSA 3HIUA 2GYDA 5FEJA 4AM2A 5D8XA 1BCFA 3F38A 3GGZA 2BJYA 2V2IA 3UOIA 4A25A 2ZURX 1UVHA 4II4A 3UOFA 1BG7A 2ZA6A 2V8UA 1EUMA 3E1JA 1UMNA 4YKHA 3C1YA 3PWQA 5E2DA 5JDOB 3PVRB 1NF6A 4PG1A 1VJXA 3AK8A 4LYXA 1TKOA 2BW1A 5E1UA 1R03A 3BVFA 3AK9A 2XJNA 4ISPA 3KHKA 4P18A 5FFAA 4M33A
chains in the Genus database with same CATH topology
4Y08A 4AM4A 5GU1X 1J30A 1SOFA 1F33A 3ERZA 4MY7A 2VXIA 4MXPA 3FRRA 1ZS3A 3UNOA 3BVLA 5GOUA 2VZBA 2Y44A 5C6FA 1FHAA 4LQVA 1DVBA 3PW8A 3RE7A 3E1PA 3E2CA 4ETRA 5HQOA 4RC5A 4DYXA 2CIHA 4LQHA 3RGDA 4CVRA 2C6RA 4MN9A 4R42A 1LKMA 2YJJA 1RCEA 2V2JA 1LKOA 5GN8B 3EGMA 3C23A 4CVTA 2GS4A 4AM5A 2CLUA 2Y3QA 4DI0A 2FG4A 4II4B 3GE4A 5CZUA 4W4LB 3OJ5A 4DYYA 3KX9A 2X170 3QB9A 4EVBA 4DE6A 2F7NA 4LPNA 5GU2X 4LQNA 3SH6A 3C1ZA 1S3QA 5JKMA 1HRSA 2C2FA 4M34A 1VELA 5CMQA 5D8SA 1O9IA 4CVPA 3RBCA 2V2RA 3R2MA 3F37A 3BVKA 1RCDA 3U90A 5LG8A 3QD8A 4RC6A 1XZ1A 2Z90A 4KXRB 5AXSA 4TOFA 2OC5A 2V2MA 2V2PA 1DATA 2ZG8X 2CN6A 3E6RA 2PYBA 3PVTA 5JKMG 3AF7X 4DYUA 3ES3A 2BK6A 2D5KA 4ZLWA 4ISMA 4LYUA 4ZKXA 4ZL6A 3BT5A 2CHIA 2JD70 5D8YA 4RC5B 5JACA 2BKCA 3EZUA 3IS8A 3E1MA 2XKQA 3O7SA 1QYBA 3QZ3A 2YW7A 4ZKWA 2FKZA 3DBYA 2CEIA 4U3GA 3E1QA 4ZJKA 1JKUA 5JKLA 2MGYA 4IWKA 3R2RA 5IX6A 1BFRA 5LS9A 2C2JA 3FI6A 2XJOA 1L8IA 3O7RA 2CLBA 4ERUA 3KXUA 2UX1A 4RC7A 1IERA 3PW1B 4TODA 5LG2A 4ZMCA 2YJKA 2ZG7X 3N6OA 2IB0A 1OTKA 2WWXB 3R2KA 4XKSA 3KA4A 5ERKA 1JKVA 1Z6OM 5JKLG 2N02A 1NF4A 3R2LA 5D8QA 2FZFA 3H7GA 3AJOA 5FFCA 3IQ1A 1TKPA 3A9QA 4YXMA 2IY4A 4M35A 4ZL5A 4KVSA 2QQYA 2CF7A 1YUXA 2XJMA 3Q4RA 5CMRA 4TOHA 3VNXA 2Z5PA 1B71A 3KDQA 3QHCA 3E1OA 4ITWA 5HJFA 2GYQA 4KVQA 5D8RA 4E6KA 3BKNA 4PGKA 4QUWA 2ITBA 3VVAA 4TOEA 3UFBA 3MPSA 2CWLA 3QHBA 4IWJA 1MFRA 3PWFA 3WVVA 2AR0A 1VEQA 4ITTA 5J9VA 3A68A 3AJPA 2HTNA 2FJCA 1NFVA 3E6SA 5LBHA 3RD0A 1MOJA 3AJQA 5K52A 4CY9A 1JYBA 1JI4A 4MJYA 4LPMA 3PZAA 3R2OA 5ERJA 3F34A 4DYZA 1YV1A 1TK6A 2C41A 3WVWA 4RC7B 1H96A 1NNQA 4CVSA 2JD80 3PVYA 2FFXJ 2Z5RA 4KVRA 3VV9A 3KA6A 3NP0X 3Q4OA 3IS7A 3R2HA 5FFBA 4CYBA 2JD60 5D8OA 1XZ3A 1RCGA 5GU0X 3V3KB 3KWOA 4TOBA 4CMYA 1TJOA 4PG0A 2WLAA 4IXKA 4MUDA 5D8PA 2V2LA 3HL1A 1RCCA 3D19A 3F32A 1ZUJA 3F33A 4EVDA 1VEIA 1N1QA 4ML5A 3SE1A 2V2NA 1F30A 3OGHA 2CN7A 1VLGA 3WNWA 3F36A 2CHPA 3AF8X 2IU2A 4REUA 4WJG4 2WTLA 3E1NA 1O9RA 3FSEA 3KA3A 1IESA 4DASA 2RBDA 1JI5A 1AEWA 3FVBA 2FHAA 4YVZA 3KA9A 4TOCA 4Z3BA 4XKUA 3E1LA 3ISFA 2V15A 3GGYA 3LKDA 2V2OA 4W4KB 3SHXA 2W0OA 1QGHA 2QF9A 3GVYA 3M6JA 3ISEA 2V2SA 4YXJA 4XGSA 3AF9X 4M32A 2HR5A 3SIDA 3GHQA 2FG8A 4RC6B 2Z5QA 2C2UA 2VXXA 2ZA8A 4XKTA 1LB3A 1RYTA 2ZG9X 4RC8A 1YUZA 4EVCA 4LPJA 3PVYB 3WVUA 5J8SA 5FFEA 3JZ9A 4EVEA 4DZ0A 3L0MA 3PVTB 2OH3A 3PWQC 3R2SA 3F39A 2G38B 3BVIA 3JZAB 4MKUA 5K53A 5JDOA 3PVRA 2YW6A 1JGCA 1LKPA 1Z6OA 3EZ0A 3QVDA 5HJHA 3C21A 1SQ3A 1GWGA 4E40A 3F35A 4PGIA 3T9JA 2V8TA 3BVEA 2XGWA 4X0JA 1S30A 5J93A 2G4HA 1JIGA 3Q4NA 2FL0A 2WLUA 3PW1A 1L8HA 4TOAA 2Z6MA 4ZKHA 3NOZX 5J8WA 3NP2X 1DPSA 3PW8C 1S2ZA 4CYAA 3FRSA 4TO9A 5GU3X 4CMYV 4OYNA 4Z5SA 3KA8A 2ZA7A 1KRQA 1JREA 3RAVA 1RCIA 4TOGA 4ZTTA 5I4JA 5FFDA 3TA8A 4LQJA 1Z4AA 3W54A 4TW3A 3Q4QA 5GN8A 5HU6D 2OKCA 1JTSA 3HIUA 2GYDA 5FEJA 4AM2A 5D8XA 1BCFA 3F38A 3GGZA 2BJYA 2V2IA 3UOIA 4A25A 2ZURX 1UVHA 4II4A 3UOFA 1BG7A 2ZA6A 2V8UA 1EUMA 3E1JA 1UMNA 4YKHA 3C1YA 3PWQA 5E2DA 5JDOB 3PVRB 1NF6A 4PG1A 1VJXA 3AK8A 4LYXA 1TKOA 2BW1A 5E1UA 1R03A 3BVFA 3AK9A 2XJNA 4ISPA 3KHKA 4P18A 5FFAA 4M33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y08 A;  4AM4 A;  5GU1 X;  1J30 A;  1SOF A;  1F33 A;  3ERZ A;  4MY7 A;  2VXI A;  1ZS3 A;  3UNO A;  3BVL A;  5GOU A;  2VZB A;  5C6F A;  1FHA A;  4LQV A;  1DVB A;  3PW8 A;  3RE7 A;  3E1P A;  3E2C A;  4ETR A;  5HQO A;  4RC5 A;  4DYX A;  2CIH A;  4LQH A;  3RGD A;  4CVR A;  2C6R A;  4MN9 A;  4R42 A;  1LKM A;  2YJJ A;  1RCE A;  2V2J A;  1LKO A;  5GN8 B;  3EGM A;  4CVT A;  2GS4 A;  4AM5 A;  2CLU A;  2Y3Q A;  4DI0 A;  2FG4 A;  4II4 B;  3GE4 A;  5CZU A;  3OJ5 A;  4DYY A;  3KX9 A;  2X17 0;  3QB9 A;  4EVB A;  4DE6 A;  2F7N A;  4LPN A;  5GU2 X;  4LQN A;  3SH6 A;  1S3Q A;  5JKM A;  1HRS A;  2C2F A;  4M34 A;  1VEL A;  5CMQ A;  5D8S A;  1O9I A;  4CVP A;  3RBC A;  2V2R A;  3R2M A;  3F37 A;  3BVK A;  1RCD A;  3U90 A;  5LG8 A;  3QD8 A;  4RC6 A;  1XZ1 A;  2Z90 A;  5AXS A;  4TOF A;  2OC5 A;  2V2M A;  2V2P A;  1DAT A;  2ZG8 X;  2CN6 A;  3E6R A;  2PYB A;  3PVT A;  5JKM G;  3AF7 X;  4DYU A;  3ES3 A;  2BK6 A;  2D5K A;  4ZLW A;  4ISM A;  4LYU A;  4ZKX A;  4ZL6 A;  3BT5 A;  2CHI A;  2JD7 0;  5D8Y A;  4RC5 B;  5JAC A;  2BKC A;  3EZU A;  3IS8 A;  3E1M A;  2XKQ A;  3O7S A;  1QYB A;  3QZ3 A;  2YW7 A;  4ZKW A;  2FKZ A;  2CEI A;  4U3G A;  3E1Q A;  4ZJK A;  1JKU A;  5JKL A;  4IWK A;  3R2R A;  5IX6 A;  1BFR A;  5LS9 A;  2C2J A;  3FI6 A;  2XJO A;  1L8I A;  3O7R A;  2CLB A;  4ERU A;  3KXU A;  2UX1 A;  4RC7 A;  1IER A;  3PW1 B;  4TOD A;  5LG2 A;  4ZMC A;  2YJK A;  2ZG7 X;  2IB0 A;  1OTK A;  3R2K A;  4XKS A;  3KA4 A;  5ERK A;  1JKV A;  1Z6O M;  5JKL G;  1NF4 A;  3R2L A;  5D8Q A;  2FZF A;  3H7G A;  3AJO A;  5FFC A;  3IQ1 A;  1TKP A;  3A9Q A;  2IY4 A;  4M35 A;  4ZL5 A;  4KVS A;  2QQY A;  2CF7 A;  1YUX A;  2XJM A;  3Q4R A;  5CMR A;  4TOH A;  3VNX A;  2Z5P A;  1B71 A;  3QHC A;  3E1O A;  4ITW A;  5HJF A;  2GYQ A;  4KVQ A;  5D8R A;  4E6K A;  3BKN A;  4PGK A;  4QUW A;  2ITB A;  4TOE A;  3MPS A;  3QHB A;  4IWJ A;  1MFR A;  3PWF A;  3WVV A;  1VEQ A;  4ITT A;  5J9V A;  3A68 A;  3AJP A;  2HTN A;  2FJC A;  1NFV A;  3E6S A;  5LBH A;  3RD0 A;  1MOJ A;  3AJQ A;  5K52 A;  4CY9 A;  1JYB A;  1JI4 A;  4MJY A;  4LPM A;  3PZA A;  3R2O A;  5ERJ A;  3F34 A;  4DYZ A;  1YV1 A;  1TK6 A;  2C41 A;  3WVW A;  4RC7 B;  1H96 A;  1NNQ A;  4CVS A;  2JD8 0;  3PVY A;  2FFX J;  2Z5R A;  4KVR A;  3KA6 A;  3NP0 X;  3Q4O A;  3IS7 A;  3R2H A;  5FFB A;  4CYB A;  2JD6 0;  5D8O A;  1XZ3 A;  1RCG A;  5GU0 X;  3KWO A;  4TOB A;  4CMY A;  1TJO A;  4PG0 A;  2WLA A;  4IXK A;  4MUD A;  5D8P A;  2V2L A;  3HL1 A;  1RCC A;  3F32 A;  1ZUJ A;  3F33 A;  4EVD A;  1VEI A;  1N1Q A;  4ML5 A;  3SE1 A;  2V2N A;  1F30 A;  3OGH A;  2CN7 A;  1VLG A;  3WNW A;  3F36 A;  2CHP A;  3AF8 X;  2IU2 A;  4REU A;  2WTL A;  3E1N A;  1O9R A;  3FSE A;  3KA3 A;  1IES A;  4DAS A;  2RBD A;  1JI5 A;  1AEW A;  3FVB A;  2FHA A;  3KA9 A;  4TOC A;  4Z3B A;  4XKU A;  3E1L A;  3ISF A;  2V15 A;  2V2O A;  3SHX A;  2W0O A;  1QGH A;  2QF9 A;  3GVY A;  3ISE A;  2V2S A;  4XGS A;  3AF9 X;  4M32 A;  2HR5 A;  3SID A;  3GHQ A;  2FG8 A;  4RC6 B;  2Z5Q A;  2C2U A;  2VXX A;  2ZA8 A;  4XKT A;  1LB3 A;  1RYT A;  2ZG9 X;  4RC8 A;  1YUZ A;  4EVC A;  4LPJ A;  3PVY B;  3WVU A;  5J8S A;  5FFE A;  4EVE A;  4DZ0 A;  3PVT B;  2OH3 A;  3PWQ C;  3R2S A;  3F39 A;  3BVI A;  4MKU A;  5K53 A;  3PVR A;  2YW6 A;  1JGC A;  1LKP A;  1Z6O A;  3EZ0 A;  3QVD A;  5HJH A;  1SQ3 A;  1GWG A;  3F35 A;  4PGI A;  3T9J A;  3BVE A;  2XGW A;  1S30 A;  5J93 A;  2G4H A;  1JIG A;  3Q4N A;  2FL0 A;  2WLU A;  3PW1 A;  1L8H A;  4TOA A;  2Z6M A;  4ZKH A;  3NOZ X;  5J8W A;  3NP2 X;  1DPS A;  3PW8 C;  1S2Z A;  4CYA A;  4TO9 A;  5GU3 X;  4CMY V;  4OYN A;  4Z5S A;  3KA8 A;  2ZA7 A;  1KRQ A;  1JRE A;  3RAV A;  1RCI A;  4TOG A;  4ZTT A;  5I4J A;  5FFD A;  3TA8 A;  4LQJ A;  1Z4A A;  4TW3 A;  3Q4Q A;  5GN8 A;  1JTS A;  3HIU A;  2GYD A;  5FEJ A;  4AM2 A;  5D8X A;  1BCF A;  3F38 A;  2BJY A;  2V2I A;  3UOI A;  4A25 A;  2ZUR X;  1UVH A;  4II4 A;  3UOF A;  1BG7 A;  2ZA6 A;  1EUM A;  3E1J A;  1UMN A;  4YKH A;  3PWQ A;  5E2D A;  3PVR B;  1NF6 A;  4PG1 A;  1VJX A;  3AK8 A;  4LYX A;  1TKO A;  2BW1 A;  5E1U A;  1R03 A;  3BVF A;  3AK9 A;  2XJN A;  4ISP A;  4P18 A;  5FFA A;  4M33 A; 
#chains in the Genus database with same CATH topology
 4Y08 A;  4AM4 A;  5GU1 X;  1J30 A;  1SOF A;  1F33 A;  3ERZ A;  4MY7 A;  2VXI A;  4MXP A;  3FRR A;  1ZS3 A;  3UNO A;  3BVL A;  5GOU A;  2VZB A;  2Y44 A;  5C6F A;  1FHA A;  4LQV A;  1DVB A;  3PW8 A;  3RE7 A;  3E1P A;  3E2C A;  4ETR A;  5HQO A;  4RC5 A;  4DYX A;  2CIH A;  4LQH A;  3RGD A;  4CVR A;  2C6R A;  4MN9 A;  4R42 A;  1LKM A;  2YJJ A;  1RCE A;  2V2J A;  1LKO A;  5GN8 B;  3EGM A;  3C23 A;  4CVT A;  2GS4 A;  4AM5 A;  2CLU A;  2Y3Q A;  4DI0 A;  2FG4 A;  4II4 B;  3GE4 A;  5CZU A;  4W4L B;  3OJ5 A;  4DYY A;  3KX9 A;  2X17 0;  3QB9 A;  4EVB A;  4DE6 A;  2F7N A;  4LPN A;  5GU2 X;  4LQN A;  3SH6 A;  3C1Z A;  1S3Q A;  5JKM A;  1HRS A;  2C2F A;  4M34 A;  1VEL A;  5CMQ A;  5D8S A;  1O9I A;  4CVP A;  3RBC A;  2V2R A;  3R2M A;  3F37 A;  3BVK A;  1RCD A;  3U90 A;  5LG8 A;  3QD8 A;  4RC6 A;  1XZ1 A;  2Z90 A;  4KXR B;  5AXS A;  4TOF A;  2OC5 A;  2V2M A;  2V2P A;  1DAT A;  2ZG8 X;  2CN6 A;  3E6R A;  2PYB A;  3PVT A;  5JKM G;  3AF7 X;  4DYU A;  3ES3 A;  2BK6 A;  2D5K A;  4ZLW A;  4ISM A;  4LYU A;  4ZKX A;  4ZL6 A;  3BT5 A;  2CHI A;  2JD7 0;  5D8Y A;  4RC5 B;  5JAC A;  2BKC A;  3EZU A;  3IS8 A;  3E1M A;  2XKQ A;  3O7S A;  1QYB A;  3QZ3 A;  2YW7 A;  4ZKW A;  2FKZ A;  3DBY A;  2CEI A;  4U3G A;  3E1Q A;  4ZJK A;  1JKU A;  5JKL A;  2MGY A;  4IWK A;  3R2R A;  5IX6 A;  1BFR A;  5LS9 A;  2C2J A;  3FI6 A;  2XJO A;  1L8I A;  3O7R A;  2CLB A;  4ERU A;  3KXU A;  2UX1 A;  4RC7 A;  1IER A;  3PW1 B;  4TOD A;  5LG2 A;  4ZMC A;  2YJK A;  2ZG7 X;  3N6O A;  2IB0 A;  1OTK A;  2WWX B;  3R2K A;  4XKS A;  3KA4 A;  5ERK A;  1JKV A;  1Z6O M;  5JKL G;  2N02 A;  1NF4 A;  3R2L A;  5D8Q A;  2FZF A;  3H7G A;  3AJO A;  5FFC A;  3IQ1 A;  1TKP A;  3A9Q A;  4YXM A;  2IY4 A;  4M35 A;  4ZL5 A;  4KVS A;  2QQY A;  2CF7 A;  1YUX A;  2XJM A;  3Q4R A;  5CMR A;  4TOH A;  3VNX A;  2Z5P A;  1B71 A;  3KDQ A;  3QHC A;  3E1O A;  4ITW A;  5HJF A;  2GYQ A;  4KVQ A;  5D8R A;  4E6K A;  3BKN A;  4PGK A;  4QUW A;  2ITB A;  3VVA A;  4TOE A;  3UFB A;  3MPS A;  2CWL A;  3QHB A;  4IWJ A;  1MFR A;  3PWF A;  3WVV A;  2AR0 A;  1VEQ A;  4ITT A;  5J9V A;  3A68 A;  3AJP A;  2HTN A;  2FJC A;  1NFV A;  3E6S A;  5LBH A;  3RD0 A;  1MOJ A;  3AJQ A;  5K52 A;  4CY9 A;  1JYB A;  1JI4 A;  4MJY A;  4LPM A;  3PZA A;  3R2O A;  5ERJ A;  3F34 A;  4DYZ A;  1YV1 A;  1TK6 A;  2C41 A;  3WVW A;  4RC7 B;  1H96 A;  1NNQ A;  4CVS A;  2JD8 0;  3PVY A;  2FFX J;  2Z5R A;  4KVR A;  3VV9 A;  3KA6 A;  3NP0 X;  3Q4O A;  3IS7 A;  3R2H A;  5FFB A;  4CYB A;  2JD6 0;  5D8O A;  1XZ3 A;  1RCG A;  5GU0 X;  3V3K B;  3KWO A;  4TOB A;  4CMY A;  1TJO A;  4PG0 A;  2WLA A;  4IXK A;  4MUD A;  5D8P A;  2V2L A;  3HL1 A;  1RCC A;  3D19 A;  3F32 A;  1ZUJ A;  3F33 A;  4EVD A;  1VEI A;  1N1Q A;  4ML5 A;  3SE1 A;  2V2N A;  1F30 A;  3OGH A;  2CN7 A;  1VLG A;  3WNW A;  3F36 A;  2CHP A;  3AF8 X;  2IU2 A;  4REU A;  4WJG 4;  2WTL A;  3E1N A;  1O9R A;  3FSE A;  3KA3 A;  1IES A;  4DAS A;  2RBD A;  1JI5 A;  1AEW A;  3FVB A;  2FHA A;  4YVZ A;  3KA9 A;  4TOC A;  4Z3B A;  4XKU A;  3E1L A;  3ISF A;  2V15 A;  3GGY A;  3LKD A;  2V2O A;  4W4K B;  3SHX A;  2W0O A;  1QGH A;  2QF9 A;  3GVY A;  3M6J A;  3ISE A;  2V2S A;  4YXJ A;  4XGS A;  3AF9 X;  4M32 A;  2HR5 A;  3SID A;  3GHQ A;  2FG8 A;  4RC6 B;  2Z5Q A;  2C2U A;  2VXX A;  2ZA8 A;  4XKT A;  1LB3 A;  1RYT A;  2ZG9 X;  4RC8 A;  1YUZ A;  4EVC A;  4LPJ A;  3PVY B;  3WVU A;  5J8S A;  5FFE A;  3JZ9 A;  4EVE A;  4DZ0 A;  3L0M A;  3PVT B;  2OH3 A;  3PWQ C;  3R2S A;  3F39 A;  2G38 B;  3BVI A;  3JZA B;  4MKU A;  5K53 A;  5JDO A;  3PVR A;  2YW6 A;  1JGC A;  1LKP A;  1Z6O A;  3EZ0 A;  3QVD A;  5HJH A;  3C21 A;  1SQ3 A;  1GWG A;  4E40 A;  3F35 A;  4PGI A;  3T9J A;  2V8T A;  3BVE A;  2XGW A;  4X0J A;  1S30 A;  5J93 A;  2G4H A;  1JIG A;  3Q4N A;  2FL0 A;  2WLU A;  3PW1 A;  1L8H A;  4TOA A;  2Z6M A;  4ZKH A;  3NOZ X;  5J8W A;  3NP2 X;  1DPS A;  3PW8 C;  1S2Z A;  4CYA A;  3FRS A;  4TO9 A;  5GU3 X;  4CMY V;  4OYN A;  4Z5S A;  3KA8 A;  2ZA7 A;  1KRQ A;  1JRE A;  3RAV A;  1RCI A;  4TOG A;  4ZTT A;  5I4J A;  5FFD A;  3TA8 A;  4LQJ A;  1Z4A A;  3W54 A;  4TW3 A;  3Q4Q A;  5GN8 A;  5HU6 D;  2OKC A;  1JTS A;  3HIU A;  2GYD A;  5FEJ A;  4AM2 A;  5D8X A;  1BCF A;  3F38 A;  3GGZ A;  2BJY A;  2V2I A;  3UOI A;  4A25 A;  2ZUR X;  1UVH A;  4II4 A;  3UOF A;  1BG7 A;  2ZA6 A;  2V8U A;  1EUM A;  3E1J A;  1UMN A;  4YKH A;  3C1Y A;  3PWQ A;  5E2D A;  5JDO B;  3PVR B;  1NF6 A;  4PG1 A;  1VJX A;  3AK8 A;  4LYX A;  1TKO A;  2BW1 A;  5E1U A;  1R03 A;  3BVF A;  3AK9 A;  2XJN A;  4ISP A;  3KHK A;  4P18 A;  5FFA A;  4M33 A; 
#chains in the Genus database with same CATH homology
 4Y08 A;  4AM4 A;  5GU1 X;  1J30 A;  1SOF A;  1F33 A;  3ERZ A;  4MY7 A;  2VXI A;  4MXP A;  3FRR A;  1ZS3 A;  3UNO A;  3BVL A;  5GOU A;  2VZB A;  2Y44 A;  5C6F A;  1FHA A;  4LQV A;  1DVB A;  3PW8 A;  3RE7 A;  3E1P A;  3E2C A;  4ETR A;  5HQO A;  4RC5 A;  4DYX A;  2CIH A;  4LQH A;  3RGD A;  4CVR A;  2C6R A;  4MN9 A;  4R42 A;  1LKM A;  2YJJ A;  1RCE A;  2V2J A;  1LKO A;  5GN8 B;  3EGM A;  3C23 A;  4CVT A;  2GS4 A;  4AM5 A;  2CLU A;  2Y3Q A;  4DI0 A;  2FG4 A;  4II4 B;  3GE4 A;  5CZU A;  4W4L B;  3OJ5 A;  4DYY A;  3KX9 A;  2X17 0;  3QB9 A;  4EVB A;  4DE6 A;  2F7N A;  4LPN A;  5GU2 X;  4LQN A;  3SH6 A;  3C1Z A;  1S3Q A;  5JKM A;  1HRS A;  2C2F A;  4M34 A;  1VEL A;  5CMQ A;  5D8S A;  1O9I A;  4CVP A;  3RBC A;  2V2R A;  3R2M A;  3F37 A;  3BVK A;  1RCD A;  3U90 A;  5LG8 A;  3QD8 A;  4RC6 A;  1XZ1 A;  2Z90 A;  4KXR B;  5AXS A;  4TOF A;  2OC5 A;  2V2M A;  2V2P A;  1DAT A;  2ZG8 X;  2CN6 A;  3E6R A;  2PYB A;  3PVT A;  5JKM G;  3AF7 X;  4DYU A;  3ES3 A;  2BK6 A;  2D5K A;  4ZLW A;  4ISM A;  4LYU A;  4ZKX A;  4ZL6 A;  3BT5 A;  2CHI A;  2JD7 0;  5D8Y A;  4RC5 B;  5JAC A;  2BKC A;  3EZU A;  3IS8 A;  3E1M A;  2XKQ A;  3O7S A;  1QYB A;  3QZ3 A;  2YW7 A;  4ZKW A;  2FKZ A;  3DBY A;  2CEI A;  4U3G A;  3E1Q A;  4ZJK A;  1JKU A;  5JKL A;  2MGY A;  4IWK A;  3R2R A;  5IX6 A;  1BFR A;  5LS9 A;  2C2J A;  3FI6 A;  2XJO A;  1L8I A;  3O7R A;  2CLB A;  4ERU A;  3KXU A;  2UX1 A;  4RC7 A;  1IER A;  3PW1 B;  4TOD A;  5LG2 A;  4ZMC A;  2YJK A;  2ZG7 X;  3N6O A;  2IB0 A;  1OTK A;  2WWX B;  3R2K A;  4XKS A;  3KA4 A;  5ERK A;  1JKV A;  1Z6O M;  5JKL G;  2N02 A;  1NF4 A;  3R2L A;  5D8Q A;  2FZF A;  3H7G A;  3AJO A;  5FFC A;  3IQ1 A;  1TKP A;  3A9Q A;  4YXM A;  2IY4 A;  4M35 A;  4ZL5 A;  4KVS A;  2QQY A;  2CF7 A;  1YUX A;  2XJM A;  3Q4R A;  5CMR A;  4TOH A;  3VNX A;  2Z5P A;  1B71 A;  3KDQ A;  3QHC A;  3E1O A;  4ITW A;  5HJF A;  2GYQ A;  4KVQ A;  5D8R A;  4E6K A;  3BKN A;  4PGK A;  4QUW A;  2ITB A;  3VVA A;  4TOE A;  3UFB A;  3MPS A;  2CWL A;  3QHB A;  4IWJ A;  1MFR A;  3PWF A;  3WVV A;  2AR0 A;  1VEQ A;  4ITT A;  5J9V A;  3A68 A;  3AJP A;  2HTN A;  2FJC A;  1NFV A;  3E6S A;  5LBH A;  3RD0 A;  1MOJ A;  3AJQ A;  5K52 A;  4CY9 A;  1JYB A;  1JI4 A;  4MJY A;  4LPM A;  3PZA A;  3R2O A;  5ERJ A;  3F34 A;  4DYZ A;  1YV1 A;  1TK6 A;  2C41 A;  3WVW A;  4RC7 B;  1H96 A;  1NNQ A;  4CVS A;  2JD8 0;  3PVY A;  2FFX J;  2Z5R A;  4KVR A;  3VV9 A;  3KA6 A;  3NP0 X;  3Q4O A;  3IS7 A;  3R2H A;  5FFB A;  4CYB A;  2JD6 0;  5D8O A;  1XZ3 A;  1RCG A;  5GU0 X;  3V3K B;  3KWO A;  4TOB A;  4CMY A;  1TJO A;  4PG0 A;  2WLA A;  4IXK A;  4MUD A;  5D8P A;  2V2L A;  3HL1 A;  1RCC A;  3D19 A;  3F32 A;  1ZUJ A;  3F33 A;  4EVD A;  1VEI A;  1N1Q A;  4ML5 A;  3SE1 A;  2V2N A;  1F30 A;  3OGH A;  2CN7 A;  1VLG A;  3WNW A;  3F36 A;  2CHP A;  3AF8 X;  2IU2 A;  4REU A;  4WJG 4;  2WTL A;  3E1N A;  1O9R A;  3FSE A;  3KA3 A;  1IES A;  4DAS A;  2RBD A;  1JI5 A;  1AEW A;  3FVB A;  2FHA A;  4YVZ A;  3KA9 A;  4TOC A;  4Z3B A;  4XKU A;  3E1L A;  3ISF A;  2V15 A;  3GGY A;  3LKD A;  2V2O A;  4W4K B;  3SHX A;  2W0O A;  1QGH A;  2QF9 A;  3GVY A;  3M6J A;  3ISE A;  2V2S A;  4YXJ A;  4XGS A;  3AF9 X;  4M32 A;  2HR5 A;  3SID A;  3GHQ A;  2FG8 A;  4RC6 B;  2Z5Q A;  2C2U A;  2VXX A;  2ZA8 A;  4XKT A;  1LB3 A;  1RYT A;  2ZG9 X;  4RC8 A;  1YUZ A;  4EVC A;  4LPJ A;  3PVY B;  3WVU A;  5J8S A;  5FFE A;  3JZ9 A;  4EVE A;  4DZ0 A;  3L0M A;  3PVT B;  2OH3 A;  3PWQ C;  3R2S A;  3F39 A;  2G38 B;  3BVI A;  3JZA B;  4MKU A;  5K53 A;  5JDO A;  3PVR A;  2YW6 A;  1JGC A;  1LKP A;  1Z6O A;  3EZ0 A;  3QVD A;  5HJH A;  3C21 A;  1SQ3 A;  1GWG A;  4E40 A;  3F35 A;  4PGI A;  3T9J A;  2V8T A;  3BVE A;  2XGW A;  4X0J A;  1S30 A;  5J93 A;  2G4H A;  1JIG A;  3Q4N A;  2FL0 A;  2WLU A;  3PW1 A;  1L8H A;  4TOA A;  2Z6M A;  4ZKH A;  3NOZ X;  5J8W A;  3NP2 X;  1DPS A;  3PW8 C;  1S2Z A;  4CYA A;  3FRS A;  4TO9 A;  5GU3 X;  4CMY V;  4OYN A;  4Z5S A;  3KA8 A;  2ZA7 A;  1KRQ A;  1JRE A;  3RAV A;  1RCI A;  4TOG A;  4ZTT A;  5I4J A;  5FFD A;  3TA8 A;  4LQJ A;  1Z4A A;  3W54 A;  4TW3 A;  3Q4Q A;  5GN8 A;  5HU6 D;  2OKC A;  1JTS A;  3HIU A;  2GYD A;  5FEJ A;  4AM2 A;  5D8X A;  1BCF A;  3F38 A;  3GGZ A;  2BJY A;  2V2I A;  3UOI A;  4A25 A;  2ZUR X;  1UVH A;  4II4 A;  3UOF A;  1BG7 A;  2ZA6 A;  2V8U A;  1EUM A;  3E1J A;  1UMN A;  4YKH A;  3C1Y A;  3PWQ A;  5E2D A;  5JDO B;  3PVR B;  1NF6 A;  4PG1 A;  1VJX A;  3AK8 A;  4LYX A;  1TKO A;  2BW1 A;  5E1U A;  1R03 A;  3BVF A;  3AK9 A;  2XJN A;  4ISP A;  3KHK A;  4P18 A;  5FFA A;  4M33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...