1JREA

Dna protection and binding by e. coli dps protein
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
157
structure length
157
Chain Sequence
ATNLLYTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALICHLATMAERAVQLGGVALGTTQVINSKTPLKSYPLDIHNVQDHLKELADRYAIVANDVRKAIGEAKDDDTADILTAASRDLDKFLWFIESNIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords DNA PROTECTION DURING STARVATION PROTEIN
publication title DNA Protection and Binding by E. Coli Dps Protein
rcsb
source organism Escherichia coli
total genus 63
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2001-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1jreA00
2PYBA 2FKZA 1RCGA 4DASA 3NP0X 3PWQC 3MPSA 5IX6A 2YW7A 5FFEA 1F33A 4LQVA 3E1LA 4TOHA 4DYYA 1JYBA 2HR5A 1DPSA 5D8XA 2GS4A 2ZURX 4P18A 2UX1A 4PG1A 3WVWA 4EVCA 3F36A 3PVTA 1VJXA 2CLBA 4PGIA 4ZKHA 3R2OA 1JI4A 5CZUA 4LPJA 4RC6A 4TODA 4OYNA 2ZG7X 3ERZA 3E1MA 3RBCA 2V2NA 4TOAA 2D5KA 5HJFA 2ZG9X 3QZ3A 3WVVA 3R2KA 5LG2A 1O9RA 2X170 3BVFA 2WLAA 3R2SA 1UVHA 2CIHA 3TA8A 5J8SA 5CMRA 1VEIA 1JIGA 3PVRB 5FEJA 4LQHA 4U3GA 4ZJKA 4CMYV 4ISPA 4A25A 3F35A 2V2MA 5JKMG 3ISFA 4ETRA 1JKUA 2C2UA 1NF6A 2V2LA 1MOJA 1XZ3A 2JD80 3E1NA 1SQ3A 1UMNA 4DI0A 2V2PA 3F37A 4KVQA 2CHPA 1VEQA 3E6RA 3PVYB 4ITTA 5D8OA 4CYBA 5E1UA 5J9VA 3PVRA 4LPNA 2Z5RA 2ZA8A 3Q4OA 2C41A 3F32A 2WLUA 3Q4RA 1DATA 4TOBA 5JKLA 1TK6A 3T9JA 2FG8A 5D8YA 3R2LA 1LKOA 4ZMCA 3KX9A 2QQYA 1BFRA 3OGHA 3AK9A 4TW3A 5JACA 3AJPA 3KA6A 2C2JA 3RAVA 3RGDA 1Z6OM 3NP2X 2C6RA 3FSEA 5D8PA 5K52A 1DVBA 3BT5A 1JI5A 4DYXA 5FFDA 3QD8A 3NOZX 2Z90A 3E2CA 3HL1A 2JD60 2F7NA 3FI6A 4MKUA 1S2ZA 3AF8X 3GHQA 4XKUA 3PVYA 4II4B 2BW1A 2V2JA 4RC7B 4XKSA 4QUWA 3GE4A 2V15A 4ERUA 2FJCA 4DYZA 1O9IA 1R03A 4E6KA 4R42A 3SE1A 1FHAA 5AXSA 2ZA6A 2FFXJ 4ISMA 3F39A 1S30A 4ITWA 2Z5QA 1VLGA 2IY4A 4LYUA 1H96A 4TOEA 3PW1B 5GN8B 1LKMA 3Q4QA 1EUMA 2YJKA 2XJMA 1BG7A 3BVKA 3F38A 4CVTA 1JKVA 5CMQA 3WVUA 5GU0X 3KA3A 3O7SA 4ZKXA 4II4A 3KXUA 5GU2X 2XGWA 4RC7A 2V2RA 2C2FA 4EVDA 3QB9A 3F34A 2V2IA 4ZL6A 5FFCA 2FG4A 1KRQA 4AM5A 4IWJA 4M34A 4MY7A 2BK6A 4REUA 2OC5A 5FFAA 3EGMA 3ISEA 1RCIA 3PWQA 1GWGA 2XKQA 2CLUA 3KWOA 1RCDA 1L8IA 2GYQA 4LYXA 2CN7A 5GU3X 3PW1A 5GOUA 5GN8A 2OH3A 5JKLG 1TKOA 2GYDA 5JKMA 3AF9X 3ES3A 3QHBA 4TOCA 2IU2A 3H7GA 1MFRA 4DE6A 4EVEA 3EZUA 2W0OA 5ERJA 4KVSA 1NNQA 3HIUA 2ITBA 1RCEA 2WTLA 2FZFA 4ZTTA 4TO9A 1RCCA 4LQNA 5FFBA 3AJOA 3UOIA 4CVRA 3IQ1A 1XZ1A 4M35A 5LBHA 5HQOA 4MN9A 3GVYA 4RC8A 3SHXA 3PVTB 4PG0A 1YUXA 3QHCA 4KVRA 4TOGA 3SIDA 5D8QA 1JREA 3BKNA 4IWKA 4XKTA 2Z6MA 3KA8A 5C6FA 1VELA 3FVBA 2QF9A 3Q4NA 4DYUA 1F30A 2VXIA 2FHAA 2CHIA 5D8RA 4M33A 1JGCA 3RD0A 3WNWA 4IXKA 3PZAA 3BVLA 2G4HA 1Z6OA 3R2RA 1YUZA 2VZBA 5E2DA 2Z5PA 2CEIA 1NF4A 1ZUJA 3BVIA 4ZLWA 3R2HA 4ML5A 3UNOA 3QVDA 3PW8C 4XGSA 2HTNA 2V2OA 4LPMA 2ZA7A 2VXXA 1BCFA 5J93A 2XJOA 4Z5SA 3E1PA 3E1QA 4M32A 2ZG8X 1IERA 5GU1X 3IS8A 3IS7A 3BVEA 1JTSA 3PWFA 4CY9A 3E1JA 1TKPA 5K53A 2Y3QA 1LKPA 4RC5B 3RE7A 3AJQA 1QGHA 2XJNA 2BJYA 4CVPA 4AM2A 1HRSA 4MJYA 1QYBA 1S3QA 2FL0A 2V2SA 3UOFA 2CF7A 3R2MA 3A68A 4CVSA 3O7RA 1J30A 4EVBA 4MUDA 3AK8A 3EZ0A 4Y08A 3U90A 3OJ5A 2CN6A 5J8WA 3KA4A 1ZS3A 1RYTA 5HJHA 1B71A 3E1OA 5ERKA 3SH6A 4TOFA 4RC5A 1NFVA 4CYAA 2IB0A 4Z3BA 1N1QA 3VNXA 1Z4AA 4LQJA 3PW8A 1L8HA 4PGKA 2YW6A 1LB3A 1YV1A 3F33A 4ZL5A 3A9QA 2JD70 4AM4A 2YJJA 4CMYA 5LS9A 5LG8A 1SOFA 1OTKA 3AF7X 2BKCA 4DZ0A 4YKHA 1IESA 5I4JA 4RC6B 5D8SA 2RBDA 3KA9A 3E6SA 4ZKWA 1AEWA 1TJOA
chains in the Genus database with same CATH superfamily
2PYBA 2FKZA 1RCGA 4DASA 3NP0X 3PWQC 3MPSA 5IX6A 2YW7A 5FFEA 1F33A 4LQVA 3E1LA 4TOHA 4DYYA 1JYBA 2HR5A 4W4LB 1DPSA 5D8XA 2GS4A 2ZURX 2N02A 2OKCA 4P18A 2UX1A 4PG1A 3WVWA 4EVCA 3F36A 3PVTA 1VJXA 2CLBA 4PGIA 4ZKHA 3C23A 3R2OA 1JI4A 5CZUA 3L0MA 4LPJA 4RC6A 4TODA 4OYNA 2ZG7X 3ERZA 3E1MA 3RBCA 2V2NA 4TOAA 2D5KA 5HJFA 2ZG9X 3QZ3A 3WVVA 3R2KA 5LG2A 1O9RA 2X170 3BVFA 3C21A 2WLAA 3R2SA 1UVHA 2WWXB 4YXMA 2CIHA 3TA8A 5J8SA 5CMRA 1VEIA 1JIGA 3PVRB 5FEJA 4LQHA 4U3GA 4ZJKA 4CMYV 4ISPA 4A25A 3F35A 2V2MA 5JKMG 3ISFA 4ETRA 5JDOA 1JKUA 2C2UA 2V8TA 1NF6A 2V2LA 1MOJA 1XZ3A 2JD80 3E1NA 1SQ3A 1UMNA 4DI0A 2V2PA 3F37A 4KVQA 3N6OA 2CHPA 1VEQA 3E6RA 3PVYB 2V8UA 4ITTA 5D8OA 4CYBA 5E1UA 5J9VA 3PVRA 4LPNA 2Z5RA 2ZA8A 3Q4OA 2C41A 3F32A 2WLUA 3Q4RA 1DATA 4TOBA 5JKLA 1TK6A 3T9JA 2FG8A 5D8YA 3LKDA 3R2LA 1LKOA 3GGZA 4ZMCA 3KX9A 2QQYA 1BFRA 3OGHA 3AK9A 4TW3A 5JACA 3AJPA 3KA6A 2C2JA 3RAVA 3RGDA 1Z6OM 3NP2X 2C6RA 3FSEA 5D8PA 5K52A 1DVBA 3BT5A 1JI5A 4DYXA 5FFDA 3QD8A 3NOZX 2Z90A 3E2CA 3HL1A 2MGYA 2JD60 2F7NA 3FI6A 4MKUA 1S2ZA 3AF8X 3GHQA 4XKUA 3PVYA 4II4B 2BW1A 2V2JA 4RC7B 4XKSA 4QUWA 3GE4A 2V15A 4ERUA 2FJCA 4DYZA 1O9IA 4MXPA 1R03A 4E6KA 4R42A 3JZ9A 3SE1A 1FHAA 5AXSA 2ZA6A 2FFXJ 4ISMA 3F39A 1S30A 4ITWA 2Z5QA 1VLGA 2IY4A 4LYUA 1H96A 4TOEA 3PW1B 5GN8B 1LKMA 3Q4QA 1EUMA 2YJKA 3C1ZA 2XJMA 1BG7A 3BVKA 3F38A 4YVZA 4CVTA 1JKVA 5CMQA 3WVUA 5GU0X 3KA3A 4WJG4 3O7SA 4ZKXA 4II4A 3KXUA 5GU2X 2XGWA 4RC7A 2V2RA 2C2FA 4EVDA 3QB9A 3F34A 2V2IA 3GGYA 4ZL6A 5FFCA 2FG4A 1KRQA 4AM5A 3FRSA 4IWJA 4M34A 4MY7A 2BK6A 4REUA 2OC5A 5FFAA 3EGMA 3ISEA 1RCIA 3PWQA 1GWGA 2XKQA 2CLUA 3KWOA 1RCDA 1L8IA 2GYQA 4LYXA 2CN7A 5GU3X 3PW1A 5GOUA 5GN8A 2OH3A 5JKLG 1TKOA 2GYDA 5JKMA 3AF9X 3ES3A 3QHBA 4TOCA 2IU2A 3H7GA 1MFRA 4DE6A 4EVEA 3EZUA 2W0OA 5ERJA 4KVSA 1NNQA 2G38B 3HIUA 2ITBA 1RCEA 4YXJA 2WTLA 2FZFA 4ZTTA 4TO9A 1RCCA 4LQNA 5FFBA 3AJOA 3UOIA 4CVRA 3IQ1A 1XZ1A 4M35A 5LBHA 5HQOA 4MN9A 3GVYA 4RC8A 3SHXA 3PVTB 4PG0A 1YUXA 3QHCA 4KVRA 4TOGA 3SIDA 5D8QA 1JREA 3BKNA 4IWKA 4XKTA 2Z6MA 3KA8A 5C6FA 1VELA 3FVBA 2QF9A 3Q4NA 4DYUA 1F30A 2VXIA 2FHAA 2CHIA 5D8RA 4M33A 3DBYA 1JGCA 3RD0A 3WNWA 4IXKA 3PZAA 3BVLA 3JZAB 2G4HA 1Z6OA 3R2RA 1YUZA 2VZBA 5E2DA 2Z5PA 3W54A 2CEIA 1NF4A 1ZUJA 3BVIA 4ZLWA 3R2HA 4ML5A 3UNOA 3QVDA 3PW8C 4XGSA 2HTNA 2V2OA 4LPMA 4W4KB 2ZA7A 2VXXA 1BCFA 5J93A 5JDOB 2XJOA 4Z5SA 3E1PA 4X0JA 3E1QA 4M32A 2ZG8X 4E40A 1IERA 5GU1X 3M6JA 3UFBA 3IS8A 3IS7A 3BVEA 1JTSA 3PWFA 4CY9A 3E1JA 1TKPA 5K53A 3D19A 2Y3QA 1LKPA 4RC5B 3RE7A 3AJQA 1QGHA 2XJNA 2BJYA 4CVPA 4AM2A 1HRSA 3C1YA 4MJYA 1QYBA 3VV9A 1S3QA 2FL0A 2V2SA 3UOFA 2CF7A 3R2MA 2AR0A 3A68A 4CVSA 3O7RA 1J30A 4EVBA 4MUDA 2CWLA 3AK8A 3EZ0A 4Y08A 4KXRB 3U90A 2Y44A 3OJ5A 2CN6A 5J8WA 3KA4A 1ZS3A 1RYTA 5HJHA 1B71A 3KDQA 3E1OA 5ERKA 3SH6A 4TOFA 4RC5A 1NFVA 3VVAA 4CYAA 2IB0A 3KHKA 4Z3BA 1N1QA 3VNXA 1Z4AA 4LQJA 3PW8A 1L8HA 4PGKA 2YW6A 1LB3A 1YV1A 3F33A 3FRRA 3A9QA 4ZL5A 2JD70 4AM4A 2YJJA 4CMYA 5LS9A 5HU6D 5LG8A 1SOFA 1OTKA 3AF7X 3V3KB 2BKCA 4DZ0A 4YKHA 1IESA 5I4JA 4RC6B 5D8SA 2RBDA 3KA9A 3E6SA 4ZKWA 1AEWA 1TJOA
chains in the Genus database with same CATH topology
2PYBA 2FKZA 1RCGA 4DASA 3NP0X 3PWQC 3MPSA 5IX6A 2YW7A 5FFEA 1F33A 4LQVA 3E1LA 4TOHA 4DYYA 1JYBA 2HR5A 4W4LB 1DPSA 5D8XA 2GS4A 2ZURX 2N02A 2OKCA 4P18A 2UX1A 4PG1A 3WVWA 4EVCA 3F36A 3PVTA 1VJXA 2CLBA 4PGIA 4ZKHA 3C23A 3R2OA 1JI4A 5CZUA 3L0MA 4LPJA 4RC6A 4TODA 4OYNA 2ZG7X 3ERZA 3E1MA 3RBCA 2V2NA 4TOAA 2D5KA 5HJFA 2ZG9X 3QZ3A 3WVVA 3R2KA 5LG2A 1O9RA 2X170 3BVFA 3C21A 2WLAA 3R2SA 1UVHA 2WWXB 4YXMA 2CIHA 3TA8A 5J8SA 5CMRA 1VEIA 1JIGA 3PVRB 5FEJA 4LQHA 4U3GA 4ZJKA 4CMYV 4ISPA 4A25A 3F35A 2V2MA 5JKMG 3ISFA 4ETRA 5JDOA 1JKUA 2C2UA 2V8TA 1NF6A 2V2LA 1MOJA 1XZ3A 2JD80 3E1NA 1SQ3A 1UMNA 4DI0A 2V2PA 3F37A 4KVQA 3N6OA 2CHPA 1VEQA 3E6RA 3PVYB 2V8UA 4ITTA 5D8OA 4CYBA 5E1UA 5J9VA 3PVRA 4LPNA 2Z5RA 2ZA8A 3Q4OA 2C41A 3F32A 2WLUA 3Q4RA 1DATA 4TOBA 5JKLA 1TK6A 3T9JA 2FG8A 5D8YA 3LKDA 3R2LA 1LKOA 3GGZA 4ZMCA 3KX9A 2QQYA 1BFRA 3OGHA 3AK9A 4TW3A 5JACA 3AJPA 3KA6A 2C2JA 3RAVA 3RGDA 1Z6OM 3NP2X 2C6RA 3FSEA 5D8PA 5K52A 1DVBA 3BT5A 1JI5A 4DYXA 5FFDA 3QD8A 3NOZX 2Z90A 3E2CA 3HL1A 2MGYA 2JD60 2F7NA 3FI6A 4MKUA 1S2ZA 3AF8X 3GHQA 4XKUA 3PVYA 4II4B 2BW1A 2V2JA 4RC7B 4XKSA 4QUWA 3GE4A 2V15A 4ERUA 2FJCA 4DYZA 1O9IA 4MXPA 1R03A 4E6KA 4R42A 3JZ9A 3SE1A 1FHAA 5AXSA 2ZA6A 2FFXJ 4ISMA 3F39A 1S30A 4ITWA 2Z5QA 1VLGA 2IY4A 4LYUA 1H96A 4TOEA 3PW1B 5GN8B 1LKMA 3Q4QA 1EUMA 2YJKA 3C1ZA 2XJMA 1BG7A 3BVKA 3F38A 4YVZA 4CVTA 1JKVA 5CMQA 3WVUA 5GU0X 3KA3A 4WJG4 3O7SA 4ZKXA 4II4A 3KXUA 5GU2X 2XGWA 4RC7A 2V2RA 2C2FA 4EVDA 3QB9A 3F34A 2V2IA 3GGYA 4ZL6A 5FFCA 2FG4A 1KRQA 4AM5A 3FRSA 4IWJA 4M34A 4MY7A 2BK6A 4REUA 2OC5A 5FFAA 3EGMA 3ISEA 1RCIA 3PWQA 1GWGA 2XKQA 2CLUA 3KWOA 1RCDA 1L8IA 2GYQA 4LYXA 2CN7A 5GU3X 3PW1A 5GOUA 5GN8A 2OH3A 5JKLG 1TKOA 2GYDA 5JKMA 3AF9X 3ES3A 3QHBA 4TOCA 2IU2A 3H7GA 1MFRA 4DE6A 4EVEA 3EZUA 2W0OA 5ERJA 4KVSA 1NNQA 2G38B 3HIUA 2ITBA 1RCEA 4YXJA 2WTLA 2FZFA 4ZTTA 4TO9A 1RCCA 4LQNA 5FFBA 3AJOA 3UOIA 4CVRA 3IQ1A 1XZ1A 4M35A 5LBHA 5HQOA 4MN9A 3GVYA 4RC8A 3SHXA 3PVTB 4PG0A 1YUXA 3QHCA 4KVRA 4TOGA 3SIDA 5D8QA 1JREA 3BKNA 4IWKA 4XKTA 2Z6MA 3KA8A 5C6FA 1VELA 3FVBA 2QF9A 3Q4NA 4DYUA 1F30A 2VXIA 2FHAA 2CHIA 5D8RA 4M33A 3DBYA 1JGCA 3RD0A 3WNWA 4IXKA 3PZAA 3BVLA 3JZAB 2G4HA 1Z6OA 3R2RA 1YUZA 2VZBA 5E2DA 2Z5PA 3W54A 2CEIA 1NF4A 1ZUJA 3BVIA 4ZLWA 3R2HA 4ML5A 3UNOA 3QVDA 3PW8C 4XGSA 2HTNA 2V2OA 4LPMA 4W4KB 2ZA7A 2VXXA 1BCFA 5J93A 5JDOB 2XJOA 4Z5SA 3E1PA 4X0JA 3E1QA 4M32A 2ZG8X 4E40A 1IERA 5GU1X 3M6JA 3UFBA 3IS8A 3IS7A 3BVEA 1JTSA 3PWFA 4CY9A 3E1JA 1TKPA 5K53A 3D19A 2Y3QA 1LKPA 4RC5B 3RE7A 3AJQA 1QGHA 2XJNA 2BJYA 4CVPA 4AM2A 1HRSA 3C1YA 4MJYA 1QYBA 3VV9A 1S3QA 2FL0A 2V2SA 3UOFA 2CF7A 3R2MA 2AR0A 3A68A 4CVSA 3O7RA 1J30A 4EVBA 4MUDA 2CWLA 3AK8A 3EZ0A 4Y08A 4KXRB 3U90A 2Y44A 3OJ5A 2CN6A 5J8WA 3KA4A 1ZS3A 1RYTA 5HJHA 1B71A 3KDQA 3E1OA 5ERKA 3SH6A 4TOFA 4RC5A 1NFVA 3VVAA 4CYAA 2IB0A 3KHKA 4Z3BA 1N1QA 3VNXA 1Z4AA 4LQJA 3PW8A 1L8HA 4PGKA 2YW6A 1LB3A 1YV1A 3F33A 3FRRA 3A9QA 4ZL5A 2JD70 4AM4A 2YJJA 4CMYA 5LS9A 5HU6D 5LG8A 1SOFA 1OTKA 3AF7X 3V3KB 2BKCA 4DZ0A 4YKHA 1IESA 5I4JA 4RC6B 5D8SA 2RBDA 3KA9A 3E6SA 4ZKWA 1AEWA 1TJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PYB A;  2FKZ A;  1RCG A;  4DAS A;  3NP0 X;  3PWQ C;  3MPS A;  5IX6 A;  2YW7 A;  5FFE A;  1F33 A;  4LQV A;  3E1L A;  4TOH A;  4DYY A;  1JYB A;  2HR5 A;  1DPS A;  5D8X A;  2GS4 A;  2ZUR X;  4P18 A;  2UX1 A;  4PG1 A;  3WVW A;  4EVC A;  3F36 A;  3PVT A;  1VJX A;  2CLB A;  4PGI A;  4ZKH A;  3R2O A;  1JI4 A;  5CZU A;  4LPJ A;  4RC6 A;  4TOD A;  4OYN A;  2ZG7 X;  3ERZ A;  3E1M A;  3RBC A;  2V2N A;  4TOA A;  2D5K A;  5HJF A;  2ZG9 X;  3QZ3 A;  3WVV A;  3R2K A;  5LG2 A;  1O9R A;  2X17 0;  3BVF A;  2WLA A;  3R2S A;  1UVH A;  2CIH A;  3TA8 A;  5J8S A;  5CMR A;  1VEI A;  1JIG A;  3PVR B;  5FEJ A;  4LQH A;  4U3G A;  4ZJK A;  4CMY V;  4ISP A;  4A25 A;  3F35 A;  2V2M A;  5JKM G;  3ISF A;  4ETR A;  1JKU A;  2C2U A;  1NF6 A;  2V2L A;  1MOJ A;  1XZ3 A;  2JD8 0;  3E1N A;  1SQ3 A;  1UMN A;  4DI0 A;  2V2P A;  3F37 A;  4KVQ A;  2CHP A;  1VEQ A;  3E6R A;  3PVY B;  4ITT A;  5D8O A;  4CYB A;  5E1U A;  5J9V A;  3PVR A;  4LPN A;  2Z5R A;  2ZA8 A;  3Q4O A;  2C41 A;  3F32 A;  2WLU A;  3Q4R A;  1DAT A;  4TOB A;  5JKL A;  1TK6 A;  3T9J A;  2FG8 A;  5D8Y A;  3R2L A;  1LKO A;  4ZMC A;  3KX9 A;  2QQY A;  1BFR A;  3OGH A;  3AK9 A;  4TW3 A;  5JAC A;  3AJP A;  3KA6 A;  2C2J A;  3RAV A;  3RGD A;  1Z6O M;  3NP2 X;  2C6R A;  3FSE A;  5D8P A;  5K52 A;  1DVB A;  3BT5 A;  1JI5 A;  4DYX A;  5FFD A;  3QD8 A;  3NOZ X;  2Z90 A;  3E2C A;  3HL1 A;  2JD6 0;  2F7N A;  3FI6 A;  4MKU A;  1S2Z A;  3AF8 X;  3GHQ A;  4XKU A;  3PVY A;  4II4 B;  2BW1 A;  2V2J A;  4RC7 B;  4XKS A;  4QUW A;  3GE4 A;  2V15 A;  4ERU A;  2FJC A;  4DYZ A;  1O9I A;  1R03 A;  4E6K A;  4R42 A;  3SE1 A;  1FHA A;  5AXS A;  2ZA6 A;  2FFX J;  4ISM A;  3F39 A;  1S30 A;  4ITW A;  2Z5Q A;  1VLG A;  2IY4 A;  4LYU A;  1H96 A;  4TOE A;  3PW1 B;  5GN8 B;  1LKM A;  3Q4Q A;  1EUM A;  2YJK A;  2XJM A;  1BG7 A;  3BVK A;  3F38 A;  4CVT A;  1JKV A;  5CMQ A;  3WVU A;  5GU0 X;  3KA3 A;  3O7S A;  4ZKX A;  4II4 A;  3KXU A;  5GU2 X;  2XGW A;  4RC7 A;  2V2R A;  2C2F A;  4EVD A;  3QB9 A;  3F34 A;  2V2I A;  4ZL6 A;  5FFC A;  2FG4 A;  1KRQ A;  4AM5 A;  4IWJ A;  4M34 A;  4MY7 A;  2BK6 A;  4REU A;  2OC5 A;  5FFA A;  3EGM A;  3ISE A;  1RCI A;  3PWQ A;  1GWG A;  2XKQ A;  2CLU A;  3KWO A;  1RCD A;  1L8I A;  2GYQ A;  4LYX A;  2CN7 A;  5GU3 X;  3PW1 A;  5GOU A;  5GN8 A;  2OH3 A;  5JKL G;  1TKO A;  2GYD A;  5JKM A;  3AF9 X;  3ES3 A;  3QHB A;  4TOC A;  2IU2 A;  3H7G A;  1MFR A;  4DE6 A;  4EVE A;  3EZU A;  2W0O A;  5ERJ A;  4KVS A;  1NNQ A;  3HIU A;  2ITB A;  1RCE A;  2WTL A;  2FZF A;  4ZTT A;  4TO9 A;  1RCC A;  4LQN A;  5FFB A;  3AJO A;  3UOI A;  4CVR A;  3IQ1 A;  1XZ1 A;  4M35 A;  5LBH A;  5HQO A;  4MN9 A;  3GVY A;  4RC8 A;  3SHX A;  3PVT B;  4PG0 A;  1YUX A;  3QHC A;  4KVR A;  4TOG A;  3SID A;  5D8Q A;  1JRE A;  3BKN A;  4IWK A;  4XKT A;  2Z6M A;  3KA8 A;  5C6F A;  1VEL A;  3FVB A;  2QF9 A;  3Q4N A;  4DYU A;  1F30 A;  2VXI A;  2FHA A;  2CHI A;  5D8R A;  4M33 A;  1JGC A;  3RD0 A;  3WNW A;  4IXK A;  3PZA A;  3BVL A;  2G4H A;  1Z6O A;  3R2R A;  1YUZ A;  2VZB A;  5E2D A;  2Z5P A;  2CEI A;  1NF4 A;  1ZUJ A;  3BVI A;  4ZLW A;  3R2H A;  4ML5 A;  3UNO A;  3QVD A;  3PW8 C;  4XGS A;  2HTN A;  2V2O A;  4LPM A;  2ZA7 A;  2VXX A;  1BCF A;  5J93 A;  2XJO A;  4Z5S A;  3E1P A;  3E1Q A;  4M32 A;  2ZG8 X;  1IER A;  5GU1 X;  3IS8 A;  3IS7 A;  3BVE A;  1JTS A;  3PWF A;  4CY9 A;  3E1J A;  1TKP A;  5K53 A;  2Y3Q A;  1LKP A;  4RC5 B;  3RE7 A;  3AJQ A;  1QGH A;  2XJN A;  2BJY A;  4CVP A;  4AM2 A;  1HRS A;  4MJY A;  1QYB A;  1S3Q A;  2FL0 A;  2V2S A;  3UOF A;  2CF7 A;  3R2M A;  3A68 A;  4CVS A;  3O7R A;  1J30 A;  4EVB A;  4MUD A;  3AK8 A;  3EZ0 A;  4Y08 A;  3U90 A;  3OJ5 A;  2CN6 A;  5J8W A;  3KA4 A;  1ZS3 A;  1RYT A;  5HJH A;  1B71 A;  3E1O A;  5ERK A;  3SH6 A;  4TOF A;  4RC5 A;  1NFV A;  4CYA A;  2IB0 A;  4Z3B A;  1N1Q A;  3VNX A;  1Z4A A;  4LQJ A;  3PW8 A;  1L8H A;  4PGK A;  2YW6 A;  1LB3 A;  1YV1 A;  3F33 A;  4ZL5 A;  3A9Q A;  2JD7 0;  4AM4 A;  2YJJ A;  4CMY A;  5LS9 A;  5LG8 A;  1SOF A;  1OTK A;  3AF7 X;  2BKC A;  4DZ0 A;  4YKH A;  1IES A;  5I4J A;  4RC6 B;  5D8S A;  2RBD A;  3KA9 A;  3E6S A;  4ZKW A;  1AEW A;  1TJO A; 
#chains in the Genus database with same CATH topology
 2PYB A;  2FKZ A;  1RCG A;  4DAS A;  3NP0 X;  3PWQ C;  3MPS A;  5IX6 A;  2YW7 A;  5FFE A;  1F33 A;  4LQV A;  3E1L A;  4TOH A;  4DYY A;  1JYB A;  2HR5 A;  4W4L B;  1DPS A;  5D8X A;  2GS4 A;  2ZUR X;  2N02 A;  2OKC A;  4P18 A;  2UX1 A;  4PG1 A;  3WVW A;  4EVC A;  3F36 A;  3PVT A;  1VJX A;  2CLB A;  4PGI A;  4ZKH A;  3C23 A;  3R2O A;  1JI4 A;  5CZU A;  3L0M A;  4LPJ A;  4RC6 A;  4TOD A;  4OYN A;  2ZG7 X;  3ERZ A;  3E1M A;  3RBC A;  2V2N A;  4TOA A;  2D5K A;  5HJF A;  2ZG9 X;  3QZ3 A;  3WVV A;  3R2K A;  5LG2 A;  1O9R A;  2X17 0;  3BVF A;  3C21 A;  2WLA A;  3R2S A;  1UVH A;  2WWX B;  4YXM A;  2CIH A;  3TA8 A;  5J8S A;  5CMR A;  1VEI A;  1JIG A;  3PVR B;  5FEJ A;  4LQH A;  4U3G A;  4ZJK A;  4CMY V;  4ISP A;  4A25 A;  3F35 A;  2V2M A;  5JKM G;  3ISF A;  4ETR A;  5JDO A;  1JKU A;  2C2U A;  2V8T A;  1NF6 A;  2V2L A;  1MOJ A;  1XZ3 A;  2JD8 0;  3E1N A;  1SQ3 A;  1UMN A;  4DI0 A;  2V2P A;  3F37 A;  4KVQ A;  3N6O A;  2CHP A;  1VEQ A;  3E6R A;  3PVY B;  2V8U A;  4ITT A;  5D8O A;  4CYB A;  5E1U A;  5J9V A;  3PVR A;  4LPN A;  2Z5R A;  2ZA8 A;  3Q4O A;  2C41 A;  3F32 A;  2WLU A;  3Q4R A;  1DAT A;  4TOB A;  5JKL A;  1TK6 A;  3T9J A;  2FG8 A;  5D8Y A;  3LKD A;  3R2L A;  1LKO A;  3GGZ A;  4ZMC A;  3KX9 A;  2QQY A;  1BFR A;  3OGH A;  3AK9 A;  4TW3 A;  5JAC A;  3AJP A;  3KA6 A;  2C2J A;  3RAV A;  3RGD A;  1Z6O M;  3NP2 X;  2C6R A;  3FSE A;  5D8P A;  5K52 A;  1DVB A;  3BT5 A;  1JI5 A;  4DYX A;  5FFD A;  3QD8 A;  3NOZ X;  2Z90 A;  3E2C A;  3HL1 A;  2MGY A;  2JD6 0;  2F7N A;  3FI6 A;  4MKU A;  1S2Z A;  3AF8 X;  3GHQ A;  4XKU A;  3PVY A;  4II4 B;  2BW1 A;  2V2J A;  4RC7 B;  4XKS A;  4QUW A;  3GE4 A;  2V15 A;  4ERU A;  2FJC A;  4DYZ A;  1O9I A;  4MXP A;  1R03 A;  4E6K A;  4R42 A;  3JZ9 A;  3SE1 A;  1FHA A;  5AXS A;  2ZA6 A;  2FFX J;  4ISM A;  3F39 A;  1S30 A;  4ITW A;  2Z5Q A;  1VLG A;  2IY4 A;  4LYU A;  1H96 A;  4TOE A;  3PW1 B;  5GN8 B;  1LKM A;  3Q4Q A;  1EUM A;  2YJK A;  3C1Z A;  2XJM A;  1BG7 A;  3BVK A;  3F38 A;  4YVZ A;  4CVT A;  1JKV A;  5CMQ A;  3WVU A;  5GU0 X;  3KA3 A;  4WJG 4;  3O7S A;  4ZKX A;  4II4 A;  3KXU A;  5GU2 X;  2XGW A;  4RC7 A;  2V2R A;  2C2F A;  4EVD A;  3QB9 A;  3F34 A;  2V2I A;  3GGY A;  4ZL6 A;  5FFC A;  2FG4 A;  1KRQ A;  4AM5 A;  3FRS A;  4IWJ A;  4M34 A;  4MY7 A;  2BK6 A;  4REU A;  2OC5 A;  5FFA A;  3EGM A;  3ISE A;  1RCI A;  3PWQ A;  1GWG A;  2XKQ A;  2CLU A;  3KWO A;  1RCD A;  1L8I A;  2GYQ A;  4LYX A;  2CN7 A;  5GU3 X;  3PW1 A;  5GOU A;  5GN8 A;  2OH3 A;  5JKL G;  1TKO A;  2GYD A;  5JKM A;  3AF9 X;  3ES3 A;  3QHB A;  4TOC A;  2IU2 A;  3H7G A;  1MFR A;  4DE6 A;  4EVE A;  3EZU A;  2W0O A;  5ERJ A;  4KVS A;  1NNQ A;  2G38 B;  3HIU A;  2ITB A;  1RCE A;  4YXJ A;  2WTL A;  2FZF A;  4ZTT A;  4TO9 A;  1RCC A;  4LQN A;  5FFB A;  3AJO A;  3UOI A;  4CVR A;  3IQ1 A;  1XZ1 A;  4M35 A;  5LBH A;  5HQO A;  4MN9 A;  3GVY A;  4RC8 A;  3SHX A;  3PVT B;  4PG0 A;  1YUX A;  3QHC A;  4KVR A;  4TOG A;  3SID A;  5D8Q A;  1JRE A;  3BKN A;  4IWK A;  4XKT A;  2Z6M A;  3KA8 A;  5C6F A;  1VEL A;  3FVB A;  2QF9 A;  3Q4N A;  4DYU A;  1F30 A;  2VXI A;  2FHA A;  2CHI A;  5D8R A;  4M33 A;  3DBY A;  1JGC A;  3RD0 A;  3WNW A;  4IXK A;  3PZA A;  3BVL A;  3JZA B;  2G4H A;  1Z6O A;  3R2R A;  1YUZ A;  2VZB A;  5E2D A;  2Z5P A;  3W54 A;  2CEI A;  1NF4 A;  1ZUJ A;  3BVI A;  4ZLW A;  3R2H A;  4ML5 A;  3UNO A;  3QVD A;  3PW8 C;  4XGS A;  2HTN A;  2V2O A;  4LPM A;  4W4K B;  2ZA7 A;  2VXX A;  1BCF A;  5J93 A;  5JDO B;  2XJO A;  4Z5S A;  3E1P A;  4X0J A;  3E1Q A;  4M32 A;  2ZG8 X;  4E40 A;  1IER A;  5GU1 X;  3M6J A;  3UFB A;  3IS8 A;  3IS7 A;  3BVE A;  1JTS A;  3PWF A;  4CY9 A;  3E1J A;  1TKP A;  5K53 A;  3D19 A;  2Y3Q A;  1LKP A;  4RC5 B;  3RE7 A;  3AJQ A;  1QGH A;  2XJN A;  2BJY A;  4CVP A;  4AM2 A;  1HRS A;  3C1Y A;  4MJY A;  1QYB A;  3VV9 A;  1S3Q A;  2FL0 A;  2V2S A;  3UOF A;  2CF7 A;  3R2M A;  2AR0 A;  3A68 A;  4CVS A;  3O7R A;  1J30 A;  4EVB A;  4MUD A;  2CWL A;  3AK8 A;  3EZ0 A;  4Y08 A;  4KXR B;  3U90 A;  2Y44 A;  3OJ5 A;  2CN6 A;  5J8W A;  3KA4 A;  1ZS3 A;  1RYT A;  5HJH A;  1B71 A;  3KDQ A;  3E1O A;  5ERK A;  3SH6 A;  4TOF A;  4RC5 A;  1NFV A;  3VVA A;  4CYA A;  2IB0 A;  3KHK A;  4Z3B A;  1N1Q A;  3VNX A;  1Z4A A;  4LQJ A;  3PW8 A;  1L8H A;  4PGK A;  2YW6 A;  1LB3 A;  1YV1 A;  3F33 A;  3FRR A;  3A9Q A;  4ZL5 A;  2JD7 0;  4AM4 A;  2YJJ A;  4CMY A;  5LS9 A;  5HU6 D;  5LG8 A;  1SOF A;  1OTK A;  3AF7 X;  3V3K B;  2BKC A;  4DZ0 A;  4YKH A;  1IES A;  5I4J A;  4RC6 B;  5D8S A;  2RBD A;  3KA9 A;  3E6S A;  4ZKW A;  1AEW A;  1TJO A; 
#chains in the Genus database with same CATH homology
 2PYB A;  2FKZ A;  1RCG A;  4DAS A;  3NP0 X;  3PWQ C;  3MPS A;  5IX6 A;  2YW7 A;  5FFE A;  1F33 A;  4LQV A;  3E1L A;  4TOH A;  4DYY A;  1JYB A;  2HR5 A;  4W4L B;  1DPS A;  5D8X A;  2GS4 A;  2ZUR X;  2N02 A;  2OKC A;  4P18 A;  2UX1 A;  4PG1 A;  3WVW A;  4EVC A;  3F36 A;  3PVT A;  1VJX A;  2CLB A;  4PGI A;  4ZKH A;  3C23 A;  3R2O A;  1JI4 A;  5CZU A;  3L0M A;  4LPJ A;  4RC6 A;  4TOD A;  4OYN A;  2ZG7 X;  3ERZ A;  3E1M A;  3RBC A;  2V2N A;  4TOA A;  2D5K A;  5HJF A;  2ZG9 X;  3QZ3 A;  3WVV A;  3R2K A;  5LG2 A;  1O9R A;  2X17 0;  3BVF A;  3C21 A;  2WLA A;  3R2S A;  1UVH A;  2WWX B;  4YXM A;  2CIH A;  3TA8 A;  5J8S A;  5CMR A;  1VEI A;  1JIG A;  3PVR B;  5FEJ A;  4LQH A;  4U3G A;  4ZJK A;  4CMY V;  4ISP A;  4A25 A;  3F35 A;  2V2M A;  5JKM G;  3ISF A;  4ETR A;  5JDO A;  1JKU A;  2C2U A;  2V8T A;  1NF6 A;  2V2L A;  1MOJ A;  1XZ3 A;  2JD8 0;  3E1N A;  1SQ3 A;  1UMN A;  4DI0 A;  2V2P A;  3F37 A;  4KVQ A;  3N6O A;  2CHP A;  1VEQ A;  3E6R A;  3PVY B;  2V8U A;  4ITT A;  5D8O A;  4CYB A;  5E1U A;  5J9V A;  3PVR A;  4LPN A;  2Z5R A;  2ZA8 A;  3Q4O A;  2C41 A;  3F32 A;  2WLU A;  3Q4R A;  1DAT A;  4TOB A;  5JKL A;  1TK6 A;  3T9J A;  2FG8 A;  5D8Y A;  3LKD A;  3R2L A;  1LKO A;  3GGZ A;  4ZMC A;  3KX9 A;  2QQY A;  1BFR A;  3OGH A;  3AK9 A;  4TW3 A;  5JAC A;  3AJP A;  3KA6 A;  2C2J A;  3RAV A;  3RGD A;  1Z6O M;  3NP2 X;  2C6R A;  3FSE A;  5D8P A;  5K52 A;  1DVB A;  3BT5 A;  1JI5 A;  4DYX A;  5FFD A;  3QD8 A;  3NOZ X;  2Z90 A;  3E2C A;  3HL1 A;  2MGY A;  2JD6 0;  2F7N A;  3FI6 A;  4MKU A;  1S2Z A;  3AF8 X;  3GHQ A;  4XKU A;  3PVY A;  4II4 B;  2BW1 A;  2V2J A;  4RC7 B;  4XKS A;  4QUW A;  3GE4 A;  2V15 A;  4ERU A;  2FJC A;  4DYZ A;  1O9I A;  4MXP A;  1R03 A;  4E6K A;  4R42 A;  3JZ9 A;  3SE1 A;  1FHA A;  5AXS A;  2ZA6 A;  2FFX J;  4ISM A;  3F39 A;  1S30 A;  4ITW A;  2Z5Q A;  1VLG A;  2IY4 A;  4LYU A;  1H96 A;  4TOE A;  3PW1 B;  5GN8 B;  1LKM A;  3Q4Q A;  1EUM A;  2YJK A;  3C1Z A;  2XJM A;  1BG7 A;  3BVK A;  3F38 A;  4YVZ A;  4CVT A;  1JKV A;  5CMQ A;  3WVU A;  5GU0 X;  3KA3 A;  4WJG 4;  3O7S A;  4ZKX A;  4II4 A;  3KXU A;  5GU2 X;  2XGW A;  4RC7 A;  2V2R A;  2C2F A;  4EVD A;  3QB9 A;  3F34 A;  2V2I A;  3GGY A;  4ZL6 A;  5FFC A;  2FG4 A;  1KRQ A;  4AM5 A;  3FRS A;  4IWJ A;  4M34 A;  4MY7 A;  2BK6 A;  4REU A;  2OC5 A;  5FFA A;  3EGM A;  3ISE A;  1RCI A;  3PWQ A;  1GWG A;  2XKQ A;  2CLU A;  3KWO A;  1RCD A;  1L8I A;  2GYQ A;  4LYX A;  2CN7 A;  5GU3 X;  3PW1 A;  5GOU A;  5GN8 A;  2OH3 A;  5JKL G;  1TKO A;  2GYD A;  5JKM A;  3AF9 X;  3ES3 A;  3QHB A;  4TOC A;  2IU2 A;  3H7G A;  1MFR A;  4DE6 A;  4EVE A;  3EZU A;  2W0O A;  5ERJ A;  4KVS A;  1NNQ A;  2G38 B;  3HIU A;  2ITB A;  1RCE A;  4YXJ A;  2WTL A;  2FZF A;  4ZTT A;  4TO9 A;  1RCC A;  4LQN A;  5FFB A;  3AJO A;  3UOI A;  4CVR A;  3IQ1 A;  1XZ1 A;  4M35 A;  5LBH A;  5HQO A;  4MN9 A;  3GVY A;  4RC8 A;  3SHX A;  3PVT B;  4PG0 A;  1YUX A;  3QHC A;  4KVR A;  4TOG A;  3SID A;  5D8Q A;  1JRE A;  3BKN A;  4IWK A;  4XKT A;  2Z6M A;  3KA8 A;  5C6F A;  1VEL A;  3FVB A;  2QF9 A;  3Q4N A;  4DYU A;  1F30 A;  2VXI A;  2FHA A;  2CHI A;  5D8R A;  4M33 A;  3DBY A;  1JGC A;  3RD0 A;  3WNW A;  4IXK A;  3PZA A;  3BVL A;  3JZA B;  2G4H A;  1Z6O A;  3R2R A;  1YUZ A;  2VZB A;  5E2D A;  2Z5P A;  3W54 A;  2CEI A;  1NF4 A;  1ZUJ A;  3BVI A;  4ZLW A;  3R2H A;  4ML5 A;  3UNO A;  3QVD A;  3PW8 C;  4XGS A;  2HTN A;  2V2O A;  4LPM A;  4W4K B;  2ZA7 A;  2VXX A;  1BCF A;  5J93 A;  5JDO B;  2XJO A;  4Z5S A;  3E1P A;  4X0J A;  3E1Q A;  4M32 A;  2ZG8 X;  4E40 A;  1IER A;  5GU1 X;  3M6J A;  3UFB A;  3IS8 A;  3IS7 A;  3BVE A;  1JTS A;  3PWF A;  4CY9 A;  3E1J A;  1TKP A;  5K53 A;  3D19 A;  2Y3Q A;  1LKP A;  4RC5 B;  3RE7 A;  3AJQ A;  1QGH A;  2XJN A;  2BJY A;  4CVP A;  4AM2 A;  1HRS A;  3C1Y A;  4MJY A;  1QYB A;  3VV9 A;  1S3Q A;  2FL0 A;  2V2S A;  3UOF A;  2CF7 A;  3R2M A;  2AR0 A;  3A68 A;  4CVS A;  3O7R A;  1J30 A;  4EVB A;  4MUD A;  2CWL A;  3AK8 A;  3EZ0 A;  4Y08 A;  4KXR B;  3U90 A;  2Y44 A;  3OJ5 A;  2CN6 A;  5J8W A;  3KA4 A;  1ZS3 A;  1RYT A;  5HJH A;  1B71 A;  3KDQ A;  3E1O A;  5ERK A;  3SH6 A;  4TOF A;  4RC5 A;  1NFV A;  3VVA A;  4CYA A;  2IB0 A;  3KHK A;  4Z3B A;  1N1Q A;  3VNX A;  1Z4A A;  4LQJ A;  3PW8 A;  1L8H A;  4PGK A;  2YW6 A;  1LB3 A;  1YV1 A;  3F33 A;  3FRR A;  3A9Q A;  4ZL5 A;  2JD7 0;  4AM4 A;  2YJJ A;  4CMY A;  5LS9 A;  5HU6 D;  5LG8 A;  1SOF A;  1OTK A;  3AF7 X;  3V3K B;  2BKC A;  4DZ0 A;  4YKH A;  1IES A;  5I4J A;  4RC6 B;  5D8S A;  2RBD A;  3KA9 A;  3E6S A;  4ZKW A;  1AEW A;  1TJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...