3GGZA

Crystal structure of s.cerevisiae ist1 n-terminal domain in complex with did2 mim motif
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
186
structure length
186
Chain Sequence
PSMIPFTIKLKTCLKMCIQRLRYAQEKQQAIAKQSRRQVAQLLLTNKEQKAHYRVETLIHDDIHIELLEILELYCELLLARVQVINDISTEEQLVKEHMDDGINEAIRSLIYAILFVDEVKELSQLKDLMAWKINVEFVNGVIADHIDVPEKIIKKCSPSVPKEELVDLYLKEIAKTYDVPYSKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport, endocytosis
molecule keywords Increased sodium tolerance protein 1
publication title Structural basis of Ist1 function and Ist1-Did2 interaction in the multivesicular body pathway and cytokinesis.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 68
structure length 186
sequence length 186
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03398 Ist1 Regulator of Vps4 activity in the MVB pathway
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.60 Mainly Alpha Up-down Bundle Ferritin Ferritin 3ggzA00
3GGYA 3FRRA 3FRSA 3GGZA
chains in the Genus database with same CATH superfamily
2V8TA 2D5KA 1SQ3A 4DYYA 4KVRA 2CHIA 5JKMA 5GU3X 2FJCA 1IESA 4TOBA 1S30A 3AF9X 4ISPA 4E6KA 3C1YA 2F7NA 4CVSA 1L8IA 5HJFA 3DBYA 3O7RA 3RBCA 2IY4A 1BCFA 3T9JA 2YJKA 3PW8A 4EVCA 3PVRB 4MXPA 4TOFA 3C23A 1VLGA 3LKDA 2ITBA 5E1UA 5D8XA 5FFBA 3GE4A 3BT5A 4A25A 4Y08A 3PVRA 5D8YA 2V2PA 3UOFA 4CYAA 2Z5QA 1H96A 2ZA8A 5GN8B 2C6RA 4ZTTA 3HIUA 2Y44A 1VEQA 2V8UA 1JKVA 2C2UA 3PW8C 4PGIA 3F37A 1XZ1A 3KX9A 2V2IA 3GVYA 3HL1A 5GN8A 3F39A 5CMRA 3E1NA 3H7GA 4IWJA 4LYUA 3C1ZA 5FFAA 1Z6OA 2CIHA 4M32A 1RCIA 2WLAA 4CVPA 4OYNA 4DZ0A 1JGCA 3PWQC 4MN9A 3KA6A 3NOZX 2CN6A 4CMYV 1LKOA 4ML5A 1JI4A 3GHQA 4LYXA 2ZURX 3FVBA 3E1LA 3FRRA 3R2OA 2CWLA 4LQJA 3QVDA 4AM2A 1SOFA 2GS4A 2Z5RA 4M35A 3EZ0A 3U90A 1R03A 1L8HA 2CF7A 3RGDA 2RBDA 5D8RA 3QD8A 2VXIA 2BKCA 2CEIA 5FEJA 1Z4AA 2V2JA 2XKQA 1LKPA 3KWOA 1JIGA 4TOAA 3AJPA 3OGHA 1JYBA 3KA9A 1YUZA 5FFEA 4ZL6A 2W0OA 3AK8A 1QYBA 2FG8A 4DYXA 4TO9A 2OC5A 3R2KA 1Z6OM 2HTNA 1S2ZA 2ZA6A 2JD80 2V2SA 4ZKXA 2V2LA 3BVIA 4KVSA 1YUXA 5LG8A 4ZL5A 1NNQA 1YV1A 2G4HA 4RC7B 1KRQA 3RD0A 5D8PA 4CMYA 4CYBA 4ZKHA 4ISMA 2GYDA 2OKCA 4AM5A 4E40A 5J8WA 3ES3A 2BW1A 3D19A 4DE6A 1TKPA 4RC7A 3BVFA 1QGHA 4TW3A 4W4LB 3PVTB 1EUMA 1IERA 4M33A 5JKLG 1B71A 3KDQA 4PG1A 5I4JA 1O9RA 4QUWA 5J9VA 1RCEA 3IQ1A 5C6FA 3PVTA 3Q4RA 3AF8X 1NF6A 5K53A 1AEWA 3M6JA 4M34A 4ETRA 1NF4A 4LQVA 2HR5A 2N02A 4RC6B 1LB3A 2ZG9X 5GU0X 5FFDA 3QHBA 1RYTA 3KA3A 4XGSA 1RCGA 3Q4QA 4TOHA 2G38B 1DPSA 1RCCA 1FHAA 5LG2A 3E1OA 3E1PA 4RC6A 1VJXA 2FZFA 3FSEA 2YJJA 1XZ3A 3AK9A 3R2LA 5FFCA 3E2CA 3OJ5A 3JZAB 3R2SA 5JKMG 2YW7A 3PVYB 3R2HA 5GU2X 3E1MA 3BVEA 5IX6A 1MFRA 2VXXA 4CVRA 2QF9A 3F35A 4RC5B 2WTLA 3QHCA 3V3KB 5D8OA 4TOCA 3PVYA 3E1JA 4EVEA 5D8SA 4RC8A 5GOUA 1JKUA 2CLBA 4CVTA 3N6OA 4RC5A 3WVUA 1LKMA 1MOJA 2Y3QA 1TKOA 3QB9A 5K52A 3KXUA 2FG4A 5GU1X 3W54A 2BJYA 4MY7A 5JACA 4TOEA 3KA4A 2WLUA 3WVVA 4ITTA 2V2MA 1VEIA 2IU2A 2BK6A 2IB0A 3TA8A 4U3GA 3MPSA 2WWXB 4PG0A 4DYUA 2VZBA 3JZ9A 2C2JA 3AF7X 3FRSA 3IS7A 1BFRA 1BG7A 2XJNA 3E6SA 4ZMCA 4LQHA 3EGMA 1VELA 1DVBA 3BVLA 5ERJA 4MUDA 4ZLWA 4Z3BA 2V2NA 3E6RA 2Z6MA 2CHPA 1TK6A 4LQNA 5LS9A 3R2RA 2ZA7A 4XKTA 4XKSA 4IWKA 4II4B 1NFVA 3RE7A 4ITWA 3GGYA 2OH3A 2V2RA 4TODA 1O9IA 3FI6A 3AJOA 4II4A 4KVQA 4YKHA 3ERZA 3KA8A 2C2FA 5HQOA 3KHKA 2ZG7X 3SHXA 1UVHA 5AXSA 4CY9A 1ZS3A 2AR0A 3Q4OA 2XJOA 2FFXJ 2ZG8X 3A9QA 3BKNA 3EZUA 3SH6A 3PZAA 5J8SA 3QZ3A 4XKUA 5LBHA 1GWGA 5J93A 4WJG4 4ERUA 3WNWA 4EVBA 4DI0A 2GYQA 2FKZA 4PGKA 4X0JA 4LPNA 3IS8A 3ISEA 3VVAA 2YW6A 3F32A 1HRSA 4ZJKA 3AJQA 3F33A 4LPJA 4YXMA 3PWQA 3NP2X 5D8QA 2FHAA 5CZUA 1RCDA 2CLUA 1F33A 4DYZA 3NP0X 1JTSA 3Q4NA 3BVKA 2PYBA 1ZUJA 4W4KB 4Z5SA 2JD60 5JDOB 3PWFA 2V2OA 1N1QA 1S3QA 3UFBA 1DATA 4KXRB 2Z5PA 2XJMA 3SIDA 4TOGA 3L0MA 4R42A 5JDOA 3GGZA 5HJHA 4YXJA 3VNXA 2Z90A 4LPMA 3E1QA 2XGWA 4EVDA 4ZKWA 3O7SA 3R2MA 2QQYA 3VV9A 1F30A 3UOIA 4YVZA 5JKLA 1UMNA 3WVWA 3F34A 1TJOA 3ISFA 4MJYA 2V15A 3RAVA 3A68A 2JD70 2X170 3SE1A 4IXKA 5CMQA 4REUA 3UNOA 3PW1B 2UX1A 1JREA 4MKUA 5E2DA 4P18A 5ERKA 1J30A 1OTKA 3PW1A 4AM4A 5HU6D 2FL0A 2CN7A 2C41A 4DASA 3F38A 2MGYA 3C21A 3F36A 1JI5A
chains in the Genus database with same CATH topology
2V8TA 2D5KA 1SQ3A 4DYYA 4KVRA 2CHIA 5JKMA 5GU3X 2FJCA 1IESA 4TOBA 1S30A 3AF9X 4ISPA 4E6KA 3C1YA 2F7NA 4CVSA 1L8IA 5HJFA 3DBYA 3O7RA 3RBCA 2IY4A 1BCFA 3T9JA 2YJKA 3PW8A 4EVCA 3PVRB 4MXPA 4TOFA 3C23A 1VLGA 3LKDA 2ITBA 5E1UA 5D8XA 5FFBA 3GE4A 3BT5A 4A25A 4Y08A 3PVRA 5D8YA 2V2PA 3UOFA 4CYAA 2Z5QA 1H96A 2ZA8A 5GN8B 2C6RA 4ZTTA 3HIUA 2Y44A 1VEQA 2V8UA 1JKVA 2C2UA 3PW8C 4PGIA 3F37A 1XZ1A 3KX9A 2V2IA 3GVYA 3HL1A 5GN8A 3F39A 5CMRA 3E1NA 3H7GA 4IWJA 4LYUA 3C1ZA 5FFAA 1Z6OA 2CIHA 4M32A 1RCIA 2WLAA 4CVPA 4OYNA 4DZ0A 1JGCA 3PWQC 4MN9A 3KA6A 3NOZX 2CN6A 4CMYV 1LKOA 4ML5A 1JI4A 3GHQA 4LYXA 2ZURX 3FVBA 3E1LA 3FRRA 3R2OA 2CWLA 4LQJA 3QVDA 4AM2A 1SOFA 2GS4A 2Z5RA 4M35A 3EZ0A 3U90A 1R03A 1L8HA 2CF7A 3RGDA 2RBDA 5D8RA 3QD8A 2VXIA 2BKCA 2CEIA 5FEJA 1Z4AA 2V2JA 2XKQA 1LKPA 3KWOA 1JIGA 4TOAA 3AJPA 3OGHA 1JYBA 3KA9A 1YUZA 5FFEA 4ZL6A 2W0OA 3AK8A 1QYBA 2FG8A 4DYXA 4TO9A 2OC5A 3R2KA 1Z6OM 2HTNA 1S2ZA 2ZA6A 2JD80 2V2SA 4ZKXA 2V2LA 3BVIA 4KVSA 1YUXA 5LG8A 4ZL5A 1NNQA 1YV1A 2G4HA 4RC7B 1KRQA 3RD0A 5D8PA 4CMYA 4CYBA 4ZKHA 4ISMA 2GYDA 2OKCA 4AM5A 4E40A 5J8WA 3ES3A 2BW1A 3D19A 4DE6A 1TKPA 4RC7A 3BVFA 1QGHA 4TW3A 4W4LB 3PVTB 1EUMA 1IERA 4M33A 5JKLG 1B71A 3KDQA 4PG1A 5I4JA 1O9RA 4QUWA 5J9VA 1RCEA 3IQ1A 5C6FA 3PVTA 3Q4RA 3AF8X 1NF6A 5K53A 1AEWA 3M6JA 4M34A 4ETRA 1NF4A 4LQVA 2HR5A 2N02A 4RC6B 1LB3A 2ZG9X 5GU0X 5FFDA 3QHBA 1RYTA 3KA3A 4XGSA 1RCGA 3Q4QA 4TOHA 2G38B 1DPSA 1RCCA 1FHAA 5LG2A 3E1OA 3E1PA 4RC6A 1VJXA 2FZFA 3FSEA 2YJJA 1XZ3A 3AK9A 3R2LA 5FFCA 3E2CA 3OJ5A 3JZAB 3R2SA 5JKMG 2YW7A 3PVYB 3R2HA 5GU2X 3E1MA 3BVEA 5IX6A 1MFRA 2VXXA 4CVRA 2QF9A 3F35A 4RC5B 2WTLA 3QHCA 3V3KB 5D8OA 4TOCA 3PVYA 3E1JA 4EVEA 5D8SA 4RC8A 5GOUA 1JKUA 2CLBA 4CVTA 3N6OA 4RC5A 3WVUA 1LKMA 1MOJA 2Y3QA 1TKOA 3QB9A 5K52A 3KXUA 2FG4A 5GU1X 3W54A 2BJYA 4MY7A 5JACA 4TOEA 3KA4A 2WLUA 3WVVA 4ITTA 2V2MA 1VEIA 2IU2A 2BK6A 2IB0A 3TA8A 4U3GA 3MPSA 2WWXB 4PG0A 4DYUA 2VZBA 3JZ9A 2C2JA 3AF7X 3FRSA 3IS7A 1BFRA 1BG7A 2XJNA 3E6SA 4ZMCA 4LQHA 3EGMA 1VELA 1DVBA 3BVLA 5ERJA 4MUDA 4ZLWA 4Z3BA 2V2NA 3E6RA 2Z6MA 2CHPA 1TK6A 4LQNA 5LS9A 3R2RA 2ZA7A 4XKTA 4XKSA 4IWKA 4II4B 1NFVA 3RE7A 4ITWA 3GGYA 2OH3A 2V2RA 4TODA 1O9IA 3FI6A 3AJOA 4II4A 4KVQA 4YKHA 3ERZA 3KA8A 2C2FA 5HQOA 3KHKA 2ZG7X 3SHXA 1UVHA 5AXSA 4CY9A 1ZS3A 2AR0A 3Q4OA 2XJOA 2FFXJ 2ZG8X 3A9QA 3BKNA 3EZUA 3SH6A 3PZAA 5J8SA 3QZ3A 4XKUA 5LBHA 1GWGA 5J93A 4WJG4 4ERUA 3WNWA 4EVBA 4DI0A 2GYQA 2FKZA 4PGKA 4X0JA 4LPNA 3IS8A 3ISEA 3VVAA 2YW6A 3F32A 1HRSA 4ZJKA 3AJQA 3F33A 4LPJA 4YXMA 3PWQA 3NP2X 5D8QA 2FHAA 5CZUA 1RCDA 2CLUA 1F33A 4DYZA 3NP0X 1JTSA 3Q4NA 3BVKA 2PYBA 1ZUJA 4W4KB 4Z5SA 2JD60 5JDOB 3PWFA 2V2OA 1N1QA 1S3QA 3UFBA 1DATA 4KXRB 2Z5PA 2XJMA 3SIDA 4TOGA 3L0MA 4R42A 5JDOA 3GGZA 5HJHA 4YXJA 3VNXA 2Z90A 4LPMA 3E1QA 2XGWA 4EVDA 4ZKWA 3O7SA 3R2MA 2QQYA 3VV9A 1F30A 3UOIA 4YVZA 5JKLA 1UMNA 3WVWA 3F34A 1TJOA 3ISFA 4MJYA 2V15A 3RAVA 3A68A 2JD70 2X170 3SE1A 4IXKA 5CMQA 4REUA 3UNOA 3PW1B 2UX1A 1JREA 4MKUA 5E2DA 4P18A 5ERKA 1J30A 1OTKA 3PW1A 4AM4A 5HU6D 2FL0A 2CN7A 2C41A 4DASA 3F38A 2MGYA 3C21A 3F36A 1JI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GGY A;  3FRR A;  3FRS A;  3GGZ A; 
#chains in the Genus database with same CATH topology
 2V8T A;  2D5K A;  1SQ3 A;  4DYY A;  4KVR A;  2CHI A;  5JKM A;  5GU3 X;  2FJC A;  1IES A;  4TOB A;  1S30 A;  3AF9 X;  4ISP A;  4E6K A;  3C1Y A;  2F7N A;  4CVS A;  1L8I A;  5HJF A;  3DBY A;  3O7R A;  3RBC A;  2IY4 A;  1BCF A;  3T9J A;  2YJK A;  3PW8 A;  4EVC A;  3PVR B;  4MXP A;  4TOF A;  3C23 A;  1VLG A;  3LKD A;  2ITB A;  5E1U A;  5D8X A;  5FFB A;  3GE4 A;  3BT5 A;  4A25 A;  4Y08 A;  3PVR A;  5D8Y A;  2V2P A;  3UOF A;  4CYA A;  2Z5Q A;  1H96 A;  2ZA8 A;  5GN8 B;  2C6R A;  4ZTT A;  3HIU A;  2Y44 A;  1VEQ A;  2V8U A;  1JKV A;  2C2U A;  3PW8 C;  4PGI A;  3F37 A;  1XZ1 A;  3KX9 A;  2V2I A;  3GVY A;  3HL1 A;  5GN8 A;  3F39 A;  5CMR A;  3E1N A;  3H7G A;  4IWJ A;  4LYU A;  3C1Z A;  5FFA A;  1Z6O A;  2CIH A;  4M32 A;  1RCI A;  2WLA A;  4CVP A;  4OYN A;  4DZ0 A;  1JGC A;  3PWQ C;  4MN9 A;  3KA6 A;  3NOZ X;  2CN6 A;  4CMY V;  1LKO A;  4ML5 A;  1JI4 A;  3GHQ A;  4LYX A;  2ZUR X;  3FVB A;  3E1L A;  3FRR A;  3R2O A;  2CWL A;  4LQJ A;  3QVD A;  4AM2 A;  1SOF A;  2GS4 A;  2Z5R A;  4M35 A;  3EZ0 A;  3U90 A;  1R03 A;  1L8H A;  2CF7 A;  3RGD A;  2RBD A;  5D8R A;  3QD8 A;  2VXI A;  2BKC A;  2CEI A;  5FEJ A;  1Z4A A;  2V2J A;  2XKQ A;  1LKP A;  3KWO A;  1JIG A;  4TOA A;  3AJP A;  3OGH A;  1JYB A;  3KA9 A;  1YUZ A;  5FFE A;  4ZL6 A;  2W0O A;  3AK8 A;  1QYB A;  2FG8 A;  4DYX A;  4TO9 A;  2OC5 A;  3R2K A;  1Z6O M;  2HTN A;  1S2Z A;  2ZA6 A;  2JD8 0;  2V2S A;  4ZKX A;  2V2L A;  3BVI A;  4KVS A;  1YUX A;  5LG8 A;  4ZL5 A;  1NNQ A;  1YV1 A;  2G4H A;  4RC7 B;  1KRQ A;  3RD0 A;  5D8P A;  4CMY A;  4CYB A;  4ZKH A;  4ISM A;  2GYD A;  2OKC A;  4AM5 A;  4E40 A;  5J8W A;  3ES3 A;  2BW1 A;  3D19 A;  4DE6 A;  1TKP A;  4RC7 A;  3BVF A;  1QGH A;  4TW3 A;  4W4L B;  3PVT B;  1EUM A;  1IER A;  4M33 A;  5JKL G;  1B71 A;  3KDQ A;  4PG1 A;  5I4J A;  1O9R A;  4QUW A;  5J9V A;  1RCE A;  3IQ1 A;  5C6F A;  3PVT A;  3Q4R A;  3AF8 X;  1NF6 A;  5K53 A;  1AEW A;  3M6J A;  4M34 A;  4ETR A;  1NF4 A;  4LQV A;  2HR5 A;  2N02 A;  4RC6 B;  1LB3 A;  2ZG9 X;  5GU0 X;  5FFD A;  3QHB A;  1RYT A;  3KA3 A;  4XGS A;  1RCG A;  3Q4Q A;  4TOH A;  2G38 B;  1DPS A;  1RCC A;  1FHA A;  5LG2 A;  3E1O A;  3E1P A;  4RC6 A;  1VJX A;  2FZF A;  3FSE A;  2YJJ A;  1XZ3 A;  3AK9 A;  3R2L A;  5FFC A;  3E2C A;  3OJ5 A;  3JZA B;  3R2S A;  5JKM G;  2YW7 A;  3PVY B;  3R2H A;  5GU2 X;  3E1M A;  3BVE A;  5IX6 A;  1MFR A;  2VXX A;  4CVR A;  2QF9 A;  3F35 A;  4RC5 B;  2WTL A;  3QHC A;  3V3K B;  5D8O A;  4TOC A;  3PVY A;  3E1J A;  4EVE A;  5D8S A;  4RC8 A;  5GOU A;  1JKU A;  2CLB A;  4CVT A;  3N6O A;  4RC5 A;  3WVU A;  1LKM A;  1MOJ A;  2Y3Q A;  1TKO A;  3QB9 A;  5K52 A;  3KXU A;  2FG4 A;  5GU1 X;  3W54 A;  2BJY A;  4MY7 A;  5JAC A;  4TOE A;  3KA4 A;  2WLU A;  3WVV A;  4ITT A;  2V2M A;  1VEI A;  2IU2 A;  2BK6 A;  2IB0 A;  3TA8 A;  4U3G A;  3MPS A;  2WWX B;  4PG0 A;  4DYU A;  2VZB A;  3JZ9 A;  2C2J A;  3AF7 X;  3FRS A;  3IS7 A;  1BFR A;  1BG7 A;  2XJN A;  3E6S A;  4ZMC A;  4LQH A;  3EGM A;  1VEL A;  1DVB A;  3BVL A;  5ERJ A;  4MUD A;  4ZLW A;  4Z3B A;  2V2N A;  3E6R A;  2Z6M A;  2CHP A;  1TK6 A;  4LQN A;  5LS9 A;  3R2R A;  2ZA7 A;  4XKT A;  4XKS A;  4IWK A;  4II4 B;  1NFV A;  3RE7 A;  4ITW A;  3GGY A;  2OH3 A;  2V2R A;  4TOD A;  1O9I A;  3FI6 A;  3AJO A;  4II4 A;  4KVQ A;  4YKH A;  3ERZ A;  3KA8 A;  2C2F A;  5HQO A;  3KHK A;  2ZG7 X;  3SHX A;  1UVH A;  5AXS A;  4CY9 A;  1ZS3 A;  2AR0 A;  3Q4O A;  2XJO A;  2FFX J;  2ZG8 X;  3A9Q A;  3BKN A;  3EZU A;  3SH6 A;  3PZA A;  5J8S A;  3QZ3 A;  4XKU A;  5LBH A;  1GWG A;  5J93 A;  4WJG 4;  4ERU A;  3WNW A;  4EVB A;  4DI0 A;  2GYQ A;  2FKZ A;  4PGK A;  4X0J A;  4LPN A;  3IS8 A;  3ISE A;  3VVA A;  2YW6 A;  3F32 A;  1HRS A;  4ZJK A;  3AJQ A;  3F33 A;  4LPJ A;  4YXM A;  3PWQ A;  3NP2 X;  5D8Q A;  2FHA A;  5CZU A;  1RCD A;  2CLU A;  1F33 A;  4DYZ A;  3NP0 X;  1JTS A;  3Q4N A;  3BVK A;  2PYB A;  1ZUJ A;  4W4K B;  4Z5S A;  2JD6 0;  5JDO B;  3PWF A;  2V2O A;  1N1Q A;  1S3Q A;  3UFB A;  1DAT A;  4KXR B;  2Z5P A;  2XJM A;  3SID A;  4TOG A;  3L0M A;  4R42 A;  5JDO A;  3GGZ A;  5HJH A;  4YXJ A;  3VNX A;  2Z90 A;  4LPM A;  3E1Q A;  2XGW A;  4EVD A;  4ZKW A;  3O7S A;  3R2M A;  2QQY A;  3VV9 A;  1F30 A;  3UOI A;  4YVZ A;  5JKL A;  1UMN A;  3WVW A;  3F34 A;  1TJO A;  3ISF A;  4MJY A;  2V15 A;  3RAV A;  3A68 A;  2JD7 0;  2X17 0;  3SE1 A;  4IXK A;  5CMQ A;  4REU A;  3UNO A;  3PW1 B;  2UX1 A;  1JRE A;  4MKU A;  5E2D A;  4P18 A;  5ERK A;  1J30 A;  1OTK A;  3PW1 A;  4AM4 A;  5HU6 D;  2FL0 A;  2CN7 A;  2C41 A;  4DAS A;  3F38 A;  2MGY A;  3C21 A;  3F36 A;  1JI5 A; 
#chains in the Genus database with same CATH homology
 2V8T A;  2D5K A;  1SQ3 A;  4DYY A;  4KVR A;  2CHI A;  5JKM A;  5GU3 X;  2FJC A;  1IES A;  4TOB A;  1S30 A;  3AF9 X;  4ISP A;  4E6K A;  3C1Y A;  2F7N A;  4CVS A;  1L8I A;  5HJF A;  3DBY A;  3O7R A;  3RBC A;  2IY4 A;  1BCF A;  3T9J A;  2YJK A;  3PW8 A;  4EVC A;  3PVR B;  4MXP A;  4TOF A;  3C23 A;  1VLG A;  3LKD A;  2ITB A;  5E1U A;  5D8X A;  5FFB A;  3GE4 A;  3BT5 A;  4A25 A;  4Y08 A;  3PVR A;  5D8Y A;  2V2P A;  3UOF A;  4CYA A;  2Z5Q A;  1H96 A;  2ZA8 A;  5GN8 B;  2C6R A;  4ZTT A;  3HIU A;  2Y44 A;  1VEQ A;  2V8U A;  1JKV A;  2C2U A;  3PW8 C;  4PGI A;  3F37 A;  1XZ1 A;  3KX9 A;  2V2I A;  3GVY A;  3HL1 A;  5GN8 A;  3F39 A;  5CMR A;  3E1N A;  3H7G A;  4IWJ A;  4LYU A;  3C1Z A;  5FFA A;  1Z6O A;  2CIH A;  4M32 A;  1RCI A;  2WLA A;  4CVP A;  4OYN A;  4DZ0 A;  1JGC A;  3PWQ C;  4MN9 A;  3KA6 A;  3NOZ X;  2CN6 A;  4CMY V;  1LKO A;  4ML5 A;  1JI4 A;  3GHQ A;  4LYX A;  2ZUR X;  3FVB A;  3E1L A;  3FRR A;  3R2O A;  2CWL A;  4LQJ A;  3QVD A;  4AM2 A;  1SOF A;  2GS4 A;  2Z5R A;  4M35 A;  3EZ0 A;  3U90 A;  1R03 A;  1L8H A;  2CF7 A;  3RGD A;  2RBD A;  5D8R A;  3QD8 A;  2VXI A;  2BKC A;  2CEI A;  5FEJ A;  1Z4A A;  2V2J A;  2XKQ A;  1LKP A;  3KWO A;  1JIG A;  4TOA A;  3AJP A;  3OGH A;  1JYB A;  3KA9 A;  1YUZ A;  5FFE A;  4ZL6 A;  2W0O A;  3AK8 A;  1QYB A;  2FG8 A;  4DYX A;  4TO9 A;  2OC5 A;  3R2K A;  1Z6O M;  2HTN A;  1S2Z A;  2ZA6 A;  2JD8 0;  2V2S A;  4ZKX A;  2V2L A;  3BVI A;  4KVS A;  1YUX A;  5LG8 A;  4ZL5 A;  1NNQ A;  1YV1 A;  2G4H A;  4RC7 B;  1KRQ A;  3RD0 A;  5D8P A;  4CMY A;  4CYB A;  4ZKH A;  4ISM A;  2GYD A;  2OKC A;  4AM5 A;  4E40 A;  5J8W A;  3ES3 A;  2BW1 A;  3D19 A;  4DE6 A;  1TKP A;  4RC7 A;  3BVF A;  1QGH A;  4TW3 A;  4W4L B;  3PVT B;  1EUM A;  1IER A;  4M33 A;  5JKL G;  1B71 A;  3KDQ A;  4PG1 A;  5I4J A;  1O9R A;  4QUW A;  5J9V A;  1RCE A;  3IQ1 A;  5C6F A;  3PVT A;  3Q4R A;  3AF8 X;  1NF6 A;  5K53 A;  1AEW A;  3M6J A;  4M34 A;  4ETR A;  1NF4 A;  4LQV A;  2HR5 A;  2N02 A;  4RC6 B;  1LB3 A;  2ZG9 X;  5GU0 X;  5FFD A;  3QHB A;  1RYT A;  3KA3 A;  4XGS A;  1RCG A;  3Q4Q A;  4TOH A;  2G38 B;  1DPS A;  1RCC A;  1FHA A;  5LG2 A;  3E1O A;  3E1P A;  4RC6 A;  1VJX A;  2FZF A;  3FSE A;  2YJJ A;  1XZ3 A;  3AK9 A;  3R2L A;  5FFC A;  3E2C A;  3OJ5 A;  3JZA B;  3R2S A;  5JKM G;  2YW7 A;  3PVY B;  3R2H A;  5GU2 X;  3E1M A;  3BVE A;  5IX6 A;  1MFR A;  2VXX A;  4CVR A;  2QF9 A;  3F35 A;  4RC5 B;  2WTL A;  3QHC A;  3V3K B;  5D8O A;  4TOC A;  3PVY A;  3E1J A;  4EVE A;  5D8S A;  4RC8 A;  5GOU A;  1JKU A;  2CLB A;  4CVT A;  3N6O A;  4RC5 A;  3WVU A;  1LKM A;  1MOJ A;  2Y3Q A;  1TKO A;  3QB9 A;  5K52 A;  3KXU A;  2FG4 A;  5GU1 X;  3W54 A;  2BJY A;  4MY7 A;  5JAC A;  4TOE A;  3KA4 A;  2WLU A;  3WVV A;  4ITT A;  2V2M A;  1VEI A;  2IU2 A;  2BK6 A;  2IB0 A;  3TA8 A;  4U3G A;  3MPS A;  2WWX B;  4PG0 A;  4DYU A;  2VZB A;  3JZ9 A;  2C2J A;  3AF7 X;  3FRS A;  3IS7 A;  1BFR A;  1BG7 A;  2XJN A;  3E6S A;  4ZMC A;  4LQH A;  3EGM A;  1VEL A;  1DVB A;  3BVL A;  5ERJ A;  4MUD A;  4ZLW A;  4Z3B A;  2V2N A;  3E6R A;  2Z6M A;  2CHP A;  1TK6 A;  4LQN A;  5LS9 A;  3R2R A;  2ZA7 A;  4XKT A;  4XKS A;  4IWK A;  4II4 B;  1NFV A;  3RE7 A;  4ITW A;  3GGY A;  2OH3 A;  2V2R A;  4TOD A;  1O9I A;  3FI6 A;  3AJO A;  4II4 A;  4KVQ A;  4YKH A;  3ERZ A;  3KA8 A;  2C2F A;  5HQO A;  3KHK A;  2ZG7 X;  3SHX A;  1UVH A;  5AXS A;  4CY9 A;  1ZS3 A;  2AR0 A;  3Q4O A;  2XJO A;  2FFX J;  2ZG8 X;  3A9Q A;  3BKN A;  3EZU A;  3SH6 A;  3PZA A;  5J8S A;  3QZ3 A;  4XKU A;  5LBH A;  1GWG A;  5J93 A;  4WJG 4;  4ERU A;  3WNW A;  4EVB A;  4DI0 A;  2GYQ A;  2FKZ A;  4PGK A;  4X0J A;  4LPN A;  3IS8 A;  3ISE A;  3VVA A;  2YW6 A;  3F32 A;  1HRS A;  4ZJK A;  3AJQ A;  3F33 A;  4LPJ A;  4YXM A;  3PWQ A;  3NP2 X;  5D8Q A;  2FHA A;  5CZU A;  1RCD A;  2CLU A;  1F33 A;  4DYZ A;  3NP0 X;  1JTS A;  3Q4N A;  3BVK A;  2PYB A;  1ZUJ A;  4W4K B;  4Z5S A;  2JD6 0;  5JDO B;  3PWF A;  2V2O A;  1N1Q A;  1S3Q A;  3UFB A;  1DAT A;  4KXR B;  2Z5P A;  2XJM A;  3SID A;  4TOG A;  3L0M A;  4R42 A;  5JDO A;  3GGZ A;  5HJH A;  4YXJ A;  3VNX A;  2Z90 A;  4LPM A;  3E1Q A;  2XGW A;  4EVD A;  4ZKW A;  3O7S A;  3R2M A;  2QQY A;  3VV9 A;  1F30 A;  3UOI A;  4YVZ A;  5JKL A;  1UMN A;  3WVW A;  3F34 A;  1TJO A;  3ISF A;  4MJY A;  2V15 A;  3RAV A;  3A68 A;  2JD7 0;  2X17 0;  3SE1 A;  4IXK A;  5CMQ A;  4REU A;  3UNO A;  3PW1 B;  2UX1 A;  1JRE A;  4MKU A;  5E2D A;  4P18 A;  5ERK A;  1J30 A;  1OTK A;  3PW1 A;  4AM4 A;  5HU6 D;  2FL0 A;  2CN7 A;  2C41 A;  4DAS A;  3F38 A;  2MGY A;  3C21 A;  3F36 A;  1JI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...