3GGZA

Crystal structure of s.cerevisiae ist1 n-terminal domain in complex with did2 mim motif
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
186
structure length
186
Chain Sequence
PSMIPFTIKLKTCLKMCIQRLRYAQEKQQAIAKQSRRQVAQLLLTNKEQKAHYRVETLIHDDIHIELLEILELYCELLLARVQVINDISTEEQLVKEHMDDGINEAIRSLIYAILFVDEVKELSQLKDLMAWKINVEFVNGVIADHIDVPEKIIKKCSPSVPKEELVDLYLKEIAKTYDVPYSKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Increased sodium tolerance protein 1
publication title Structural basis of Ist1 function and Ist1-Did2 interaction in the multivesicular body pathway and cytokinesis.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport, endocytosis
total genus 68
structure length 186
sequence length 186
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03398 Ist1 Regulator of Vps4 activity in the MVB pathway
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.60 Mainly Alpha Up-down Bundle Ferritin Ferritin 3ggzA00
3GGZA 3GGYA 3FRRA 3FRSA
chains in the Genus database with same CATH superfamily
1H96A 5GN8A 3BT5A 4II4A 4Z3BA 2ZG8X 3BVKA 3F36A 1S2ZA 2XGWA 3H7GA 4P18A 3SIDA 3E1QA 2FG4A 5J9VA 1L8IA 2W0OA 3HL1A 5J8SA 5J93A 4LYXA 4DYZA 5IX6A 3NOZX 4CVSA 5GU0X 3RD0A 4M34A 2CLBA 5LS9A 4Y08A 2CN6A 4LQHA 3GVYA 4TW3A 1LKPA 2FL0A 5JACA 2OH3A 1XZ1A 4TOAA 2AR0A 3T9JA 3A68A 1YUXA 2C2FA 1F33A 3AK8A 3IS8A 3E1PA 3BVFA 3QB9A 3NP2X 4IWJA 3OJ5A 1YV1A 3F33A 1SOFA 3E2CA 3JZ9A 4X0JA 4QUWA 5HU6D 2OC5A 3U90A 4MUDA 5GOUA 3R2MA 3LKDA 4ZL5A 2V8TA 3KXUA 2C6RA 3AF8X 1JGCA 5D8XA 5FFEA 5JDOA 5K52A 4MY7A 4W4KB 2BKCA 2WLUA 3ISEA 2BK6A 3RE7A 4AM2A 3UOIA 3SE1A 1ZS3A 2YJKA 4RC7B 3OGHA 5GU2X 3BVIA 1LB3A 4TOBA 2FJCA 4M33A 2XJOA 5JKLA 2ZG9X 3BVLA 3PZAA 3N6OA 4KVSA 1JTSA 5GN8B 4RC8A 5CZUA 3L0MA 4RC6A 3GE4A 4II4B 4TOFA 1OTKA 3KDQA 2C41A 3F32A 4YXMA 1RYTA 4PG1A 1VJXA 3F34A 3PW8A 3AJQA 4YXJA 3R2HA 3WVVA 3FSEA 3ERZA 3PW1A 3E6RA 3Q4OA 1TJOA 1VELA 4ML5A 5J8WA 1TK6A 3UOFA 1RCGA 2V2RA 1BCFA 4ISPA 3IQ1A 2FHAA 3AF9X 5LBHA 4PGKA 1QYBA 1TKOA 3AJOA 3AF7X 4ZLWA 3EZ0A 2CN7A 4ZJKA 2C2JA 4AM4A 4KVQA 5E1UA 3R2OA 4LQVA 2Z5QA 2V2IA 2C2UA 1L8HA 3F37A 1DATA 3KA3A 4TOGA 5D8QA 4MJYA 2CEIA 5JKMG 3WVUA 4YVZA 2XJNA 2ZURX 5CMRA 3SH6A 3E1MA 3O7SA 4PGIA 5K53A 2PYBA 1N1QA 4LQNA 1EUMA 1JKVA 1S3QA 2FFXJ 2UX1A 3D19A 3Q4QA 4WJG4 2QQYA 3VVAA 1IESA 4E40A 1KRQA 3RAVA 1UMNA 3V3KB 4AM5A 2Z6MA 3WNWA 1B71A 5HJHA 4DYUA 5JDOB 1DPSA 1JIGA 4M35A 4ITWA 3TA8A 1BFRA 2WWXB 3E1JA 4ZL6A 2JD70 4A25A 2YW7A 1JI5A 5D8YA 2Y3QA 3Q4RA 5FEJA 4ZMCA 4TOHA 4CYBA 4ZKWA 2HR5A 1JI4A 3W54A 4EVCA 4RC6B 4ISMA 2CWLA 3UNOA 3VNXA 3KX9A 2BJYA 2V8UA 4EVDA 1R03A 2Z5PA 4RC5A 4W4LB 3M6JA 4REUA 3PW1B 4U3GA 3F38A 1J30A 3FVBA 1SQ3A 1IERA 3PW8C 3QHBA 4XGSA 2IB0A 3EGMA 4KVRA 3EZUA 3KA9A 4DI0A 2BW1A 1F30A 2FZFA 2XJMA 2ZA8A 4E6KA 2FKZA 2YJJA 3KA4A 2HTNA 4XKTA 3C1YA 1UVHA 3KHKA 1TKPA 5I4JA 1HRSA 2XKQA 2N02A 1QGHA 3Q4NA 5HJFA 4MXPA 3R2LA 4CVPA 2V2MA 3C23A 1O9RA 4ZKHA 3AJPA 3NP0X 4KXRB 3R2SA 4ERUA 3WVWA 3PWQA 1YUZA 3E6SA 1LKMA 2GYDA 3AK9A 4MKUA 5GU3X 2CIHA 2F7NA 5HQOA 4TOEA 5FFCA 2V2OA 3PVYA 3JZAB 3IS7A 2WTLA 4ITTA 3QD8A 1BG7A 4EVEA 3E1LA 3C1ZA 2G38B 4DZ0A 2V2PA 3PVTA 3E1OA 2IY4A 5ERKA 4MN9A 1Z6OM 2GYQA 2VXIA 5LG8A 3VV9A 3PVRA 3KA6A 2ZG7X 1VEIA 5CMQA 1AEWA 3RGDA 2ZA6A 2V2SA 5FFDA 3HIUA 3F35A 4ZTTA 4DASA 1NF4A 5ERJA 2QF9A 4RC5B 1GWGA 2GS4A 5D8RA 1RCEA 5FFAA 3QHCA 5JKMA 1DVBA 2FG8A 1MFRA 3ISFA 1JKUA 1XZ3A 4OYNA 4TOCA 2JD80 4DE6A 2V2JA 4IWKA 4CMYA 2ITBA 1FHAA 4EVBA 4LYUA 1JYBA 3DBYA 3MPSA 4Z5SA 2CLUA 2Z90A 1MOJA 2D5KA 3FRSA 5D8SA 2VXXA 2YW6A 3FRRA 1NFVA 2MGYA 1NF6A 3UFBA 3QVDA 2X170 2Z5RA 3KWOA 3PWFA 1Z6OA 2VZBA 3ES3A 5LG2A 5JKLG 2V2NA 3A9QA 3RBCA 5E2DA 1O9IA 4IXKA 4TODA 1VEQA 2G4HA 5GU1X 4DYXA 4CVRA 2RBDA 4CY9A 5D8PA 3BVEA 1Z4AA 4CYAA 4R42A 3GGZA 4LPMA 2CF7A 3GGYA 1S30A 4ETRA 2CHPA 2ZA7A 1ZUJA 4TO9A 3PVYB 3KA8A 3FI6A 5D8OA 2OKCA 3F39A 3O7RA 1RCIA 3BKNA 2IU2A 4DYYA 3PWQC 2V2LA 3R2KA 3PVTB 1JREA 3GHQA 3R2RA 2V15A 4PG0A 3C21A 4YKHA 5FFBA 1RCDA 3PVRB 4LPJA 1NNQA 2WLAA 5AXSA 1RCCA 3SHXA 5C6FA 4CMYV 3QZ3A 4LPNA 4RC7A 3E1NA 4CVTA 4ZKXA 2JD60 4M32A 4XKUA 2CHIA 2Y44A 1VLGA 4XKSA 1LKOA 4LQJA
chains in the Genus database with same CATH topology
1H96A 5GN8A 3BT5A 4II4A 4Z3BA 2ZG8X 3BVKA 3F36A 1S2ZA 2XGWA 3H7GA 4P18A 3SIDA 3E1QA 2FG4A 5J9VA 1L8IA 2W0OA 3HL1A 5J8SA 5J93A 4LYXA 4DYZA 5IX6A 3NOZX 4CVSA 5GU0X 3RD0A 4M34A 2CLBA 5LS9A 4Y08A 2CN6A 4LQHA 3GVYA 4TW3A 1LKPA 2FL0A 5JACA 2OH3A 1XZ1A 4TOAA 2AR0A 3T9JA 3A68A 1YUXA 2C2FA 1F33A 3AK8A 3IS8A 3E1PA 3BVFA 3QB9A 3NP2X 4IWJA 3OJ5A 1YV1A 3F33A 1SOFA 3E2CA 3JZ9A 4X0JA 4QUWA 5HU6D 2OC5A 3U90A 4MUDA 5GOUA 3R2MA 3LKDA 4ZL5A 2V8TA 3KXUA 2C6RA 3AF8X 1JGCA 5D8XA 5FFEA 5JDOA 5K52A 4MY7A 4W4KB 2BKCA 2WLUA 3ISEA 2BK6A 3RE7A 4AM2A 3UOIA 3SE1A 1ZS3A 2YJKA 4RC7B 3OGHA 5GU2X 3BVIA 1LB3A 4TOBA 2FJCA 4M33A 2XJOA 5JKLA 2ZG9X 3BVLA 3PZAA 3N6OA 4KVSA 1JTSA 5GN8B 4RC8A 5CZUA 3L0MA 4RC6A 3GE4A 4II4B 4TOFA 1OTKA 3KDQA 2C41A 3F32A 4YXMA 1RYTA 4PG1A 1VJXA 3F34A 3PW8A 3AJQA 4YXJA 3R2HA 3WVVA 3FSEA 3ERZA 3PW1A 3E6RA 3Q4OA 1TJOA 1VELA 4ML5A 5J8WA 1TK6A 3UOFA 1RCGA 2V2RA 1BCFA 4ISPA 3IQ1A 2FHAA 3AF9X 5LBHA 4PGKA 1QYBA 1TKOA 3AJOA 3AF7X 4ZLWA 3EZ0A 2CN7A 4ZJKA 2C2JA 4AM4A 4KVQA 5E1UA 3R2OA 4LQVA 2Z5QA 2V2IA 2C2UA 1L8HA 3F37A 1DATA 3KA3A 4TOGA 5D8QA 4MJYA 2CEIA 5JKMG 3WVUA 4YVZA 2XJNA 2ZURX 5CMRA 3SH6A 3E1MA 3O7SA 4PGIA 5K53A 2PYBA 1N1QA 4LQNA 1EUMA 1JKVA 1S3QA 2FFXJ 2UX1A 3D19A 3Q4QA 4WJG4 2QQYA 3VVAA 1IESA 4E40A 1KRQA 3RAVA 1UMNA 3V3KB 4AM5A 2Z6MA 3WNWA 1B71A 5HJHA 4DYUA 5JDOB 1DPSA 1JIGA 4M35A 4ITWA 3TA8A 1BFRA 2WWXB 3E1JA 4ZL6A 2JD70 4A25A 2YW7A 1JI5A 5D8YA 2Y3QA 3Q4RA 5FEJA 4ZMCA 4TOHA 4CYBA 4ZKWA 2HR5A 1JI4A 3W54A 4EVCA 4RC6B 4ISMA 2CWLA 3UNOA 3VNXA 3KX9A 2BJYA 2V8UA 4EVDA 1R03A 2Z5PA 4RC5A 4W4LB 3M6JA 4REUA 3PW1B 4U3GA 3F38A 1J30A 3FVBA 1SQ3A 1IERA 3PW8C 3QHBA 4XGSA 2IB0A 3EGMA 4KVRA 3EZUA 3KA9A 4DI0A 2BW1A 1F30A 2FZFA 2XJMA 2ZA8A 4E6KA 2FKZA 2YJJA 3KA4A 2HTNA 4XKTA 3C1YA 1UVHA 3KHKA 1TKPA 5I4JA 1HRSA 2XKQA 2N02A 1QGHA 3Q4NA 5HJFA 4MXPA 3R2LA 4CVPA 2V2MA 3C23A 1O9RA 4ZKHA 3AJPA 3NP0X 4KXRB 3R2SA 4ERUA 3WVWA 3PWQA 1YUZA 3E6SA 1LKMA 2GYDA 3AK9A 4MKUA 5GU3X 2CIHA 2F7NA 5HQOA 4TOEA 5FFCA 2V2OA 3PVYA 3JZAB 3IS7A 2WTLA 4ITTA 3QD8A 1BG7A 4EVEA 3E1LA 3C1ZA 2G38B 4DZ0A 2V2PA 3PVTA 3E1OA 2IY4A 5ERKA 4MN9A 1Z6OM 2GYQA 2VXIA 5LG8A 3VV9A 3PVRA 3KA6A 2ZG7X 1VEIA 5CMQA 1AEWA 3RGDA 2ZA6A 2V2SA 5FFDA 3HIUA 3F35A 4ZTTA 4DASA 1NF4A 5ERJA 2QF9A 4RC5B 1GWGA 2GS4A 5D8RA 1RCEA 5FFAA 3QHCA 5JKMA 1DVBA 2FG8A 1MFRA 3ISFA 1JKUA 1XZ3A 4OYNA 4TOCA 2JD80 4DE6A 2V2JA 4IWKA 4CMYA 2ITBA 1FHAA 4EVBA 4LYUA 1JYBA 3DBYA 3MPSA 4Z5SA 2CLUA 2Z90A 1MOJA 2D5KA 3FRSA 5D8SA 2VXXA 2YW6A 3FRRA 1NFVA 2MGYA 1NF6A 3UFBA 3QVDA 2X170 2Z5RA 3KWOA 3PWFA 1Z6OA 2VZBA 3ES3A 5LG2A 5JKLG 2V2NA 3A9QA 3RBCA 5E2DA 1O9IA 4IXKA 4TODA 1VEQA 2G4HA 5GU1X 4DYXA 4CVRA 2RBDA 4CY9A 5D8PA 3BVEA 1Z4AA 4CYAA 4R42A 3GGZA 4LPMA 2CF7A 3GGYA 1S30A 4ETRA 2CHPA 2ZA7A 1ZUJA 4TO9A 3PVYB 3KA8A 3FI6A 5D8OA 2OKCA 3F39A 3O7RA 1RCIA 3BKNA 2IU2A 4DYYA 3PWQC 2V2LA 3R2KA 3PVTB 1JREA 3GHQA 3R2RA 2V15A 4PG0A 3C21A 4YKHA 5FFBA 1RCDA 3PVRB 4LPJA 1NNQA 2WLAA 5AXSA 1RCCA 3SHXA 5C6FA 4CMYV 3QZ3A 4LPNA 4RC7A 3E1NA 4CVTA 4ZKXA 2JD60 4M32A 4XKUA 2CHIA 2Y44A 1VLGA 4XKSA 1LKOA 4LQJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GGZ A;  3GGY A;  3FRR A;  3FRS A; 
#chains in the Genus database with same CATH topology
 1H96 A;  5GN8 A;  3BT5 A;  4II4 A;  4Z3B A;  2ZG8 X;  3BVK A;  3F36 A;  1S2Z A;  2XGW A;  3H7G A;  4P18 A;  3SID A;  3E1Q A;  2FG4 A;  5J9V A;  1L8I A;  2W0O A;  3HL1 A;  5J8S A;  5J93 A;  4LYX A;  4DYZ A;  5IX6 A;  3NOZ X;  4CVS A;  5GU0 X;  3RD0 A;  4M34 A;  2CLB A;  5LS9 A;  4Y08 A;  2CN6 A;  4LQH A;  3GVY A;  4TW3 A;  1LKP A;  2FL0 A;  5JAC A;  2OH3 A;  1XZ1 A;  4TOA A;  2AR0 A;  3T9J A;  3A68 A;  1YUX A;  2C2F A;  1F33 A;  3AK8 A;  3IS8 A;  3E1P A;  3BVF A;  3QB9 A;  3NP2 X;  4IWJ A;  3OJ5 A;  1YV1 A;  3F33 A;  1SOF A;  3E2C A;  3JZ9 A;  4X0J A;  4QUW A;  5HU6 D;  2OC5 A;  3U90 A;  4MUD A;  5GOU A;  3R2M A;  3LKD A;  4ZL5 A;  2V8T A;  3KXU A;  2C6R A;  3AF8 X;  1JGC A;  5D8X A;  5FFE A;  5JDO A;  5K52 A;  4MY7 A;  4W4K B;  2BKC A;  2WLU A;  3ISE A;  2BK6 A;  3RE7 A;  4AM2 A;  3UOI A;  3SE1 A;  1ZS3 A;  2YJK A;  4RC7 B;  3OGH A;  5GU2 X;  3BVI A;  1LB3 A;  4TOB A;  2FJC A;  4M33 A;  2XJO A;  5JKL A;  2ZG9 X;  3BVL A;  3PZA A;  3N6O A;  4KVS A;  1JTS A;  5GN8 B;  4RC8 A;  5CZU A;  3L0M A;  4RC6 A;  3GE4 A;  4II4 B;  4TOF A;  1OTK A;  3KDQ A;  2C41 A;  3F32 A;  4YXM A;  1RYT A;  4PG1 A;  1VJX A;  3F34 A;  3PW8 A;  3AJQ A;  4YXJ A;  3R2H A;  3WVV A;  3FSE A;  3ERZ A;  3PW1 A;  3E6R A;  3Q4O A;  1TJO A;  1VEL A;  4ML5 A;  5J8W A;  1TK6 A;  3UOF A;  1RCG A;  2V2R A;  1BCF A;  4ISP A;  3IQ1 A;  2FHA A;  3AF9 X;  5LBH A;  4PGK A;  1QYB A;  1TKO A;  3AJO A;  3AF7 X;  4ZLW A;  3EZ0 A;  2CN7 A;  4ZJK A;  2C2J A;  4AM4 A;  4KVQ A;  5E1U A;  3R2O A;  4LQV A;  2Z5Q A;  2V2I A;  2C2U A;  1L8H A;  3F37 A;  1DAT A;  3KA3 A;  4TOG A;  5D8Q A;  4MJY A;  2CEI A;  5JKM G;  3WVU A;  4YVZ A;  2XJN A;  2ZUR X;  5CMR A;  3SH6 A;  3E1M A;  3O7S A;  4PGI A;  5K53 A;  2PYB A;  1N1Q A;  4LQN A;  1EUM A;  1JKV A;  1S3Q A;  2FFX J;  2UX1 A;  3D19 A;  3Q4Q A;  4WJG 4;  2QQY A;  3VVA A;  1IES A;  4E40 A;  1KRQ A;  3RAV A;  1UMN A;  3V3K B;  4AM5 A;  2Z6M A;  3WNW A;  1B71 A;  5HJH A;  4DYU A;  5JDO B;  1DPS A;  1JIG A;  4M35 A;  4ITW A;  3TA8 A;  1BFR A;  2WWX B;  3E1J A;  4ZL6 A;  2JD7 0;  4A25 A;  2YW7 A;  1JI5 A;  5D8Y A;  2Y3Q A;  3Q4R A;  5FEJ A;  4ZMC A;  4TOH A;  4CYB A;  4ZKW A;  2HR5 A;  1JI4 A;  3W54 A;  4EVC A;  4RC6 B;  4ISM A;  2CWL A;  3UNO A;  3VNX A;  3KX9 A;  2BJY A;  2V8U A;  4EVD A;  1R03 A;  2Z5P A;  4RC5 A;  4W4L B;  3M6J A;  4REU A;  3PW1 B;  4U3G A;  3F38 A;  1J30 A;  3FVB A;  1SQ3 A;  1IER A;  3PW8 C;  3QHB A;  4XGS A;  2IB0 A;  3EGM A;  4KVR A;  3EZU A;  3KA9 A;  4DI0 A;  2BW1 A;  1F30 A;  2FZF A;  2XJM A;  2ZA8 A;  4E6K A;  2FKZ A;  2YJJ A;  3KA4 A;  2HTN A;  4XKT A;  3C1Y A;  1UVH A;  3KHK A;  1TKP A;  5I4J A;  1HRS A;  2XKQ A;  2N02 A;  1QGH A;  3Q4N A;  5HJF A;  4MXP A;  3R2L A;  4CVP A;  2V2M A;  3C23 A;  1O9R A;  4ZKH A;  3AJP A;  3NP0 X;  4KXR B;  3R2S A;  4ERU A;  3WVW A;  3PWQ A;  1YUZ A;  3E6S A;  1LKM A;  2GYD A;  3AK9 A;  4MKU A;  5GU3 X;  2CIH A;  2F7N A;  5HQO A;  4TOE A;  5FFC A;  2V2O A;  3PVY A;  3JZA B;  3IS7 A;  2WTL A;  4ITT A;  3QD8 A;  1BG7 A;  4EVE A;  3E1L A;  3C1Z A;  2G38 B;  4DZ0 A;  2V2P A;  3PVT A;  3E1O A;  2IY4 A;  5ERK A;  4MN9 A;  1Z6O M;  2GYQ A;  2VXI A;  5LG8 A;  3VV9 A;  3PVR A;  3KA6 A;  2ZG7 X;  1VEI A;  5CMQ A;  1AEW A;  3RGD A;  2ZA6 A;  2V2S A;  5FFD A;  3HIU A;  3F35 A;  4ZTT A;  4DAS A;  1NF4 A;  5ERJ A;  2QF9 A;  4RC5 B;  1GWG A;  2GS4 A;  5D8R A;  1RCE A;  5FFA A;  3QHC A;  5JKM A;  1DVB A;  2FG8 A;  1MFR A;  3ISF A;  1JKU A;  1XZ3 A;  4OYN A;  4TOC A;  2JD8 0;  4DE6 A;  2V2J A;  4IWK A;  4CMY A;  2ITB A;  1FHA A;  4EVB A;  4LYU A;  1JYB A;  3DBY A;  3MPS A;  4Z5S A;  2CLU A;  2Z90 A;  1MOJ A;  2D5K A;  3FRS A;  5D8S A;  2VXX A;  2YW6 A;  3FRR A;  1NFV A;  2MGY A;  1NF6 A;  3UFB A;  3QVD A;  2X17 0;  2Z5R A;  3KWO A;  3PWF A;  1Z6O A;  2VZB A;  3ES3 A;  5LG2 A;  5JKL G;  2V2N A;  3A9Q A;  3RBC A;  5E2D A;  1O9I A;  4IXK A;  4TOD A;  1VEQ A;  2G4H A;  5GU1 X;  4DYX A;  4CVR A;  2RBD A;  4CY9 A;  5D8P A;  3BVE A;  1Z4A A;  4CYA A;  4R42 A;  3GGZ A;  4LPM A;  2CF7 A;  3GGY A;  1S30 A;  4ETR A;  2CHP A;  2ZA7 A;  1ZUJ A;  4TO9 A;  3PVY B;  3KA8 A;  3FI6 A;  5D8O A;  2OKC A;  3F39 A;  3O7R A;  1RCI A;  3BKN A;  2IU2 A;  4DYY A;  3PWQ C;  2V2L A;  3R2K A;  3PVT B;  1JRE A;  3GHQ A;  3R2R A;  2V15 A;  4PG0 A;  3C21 A;  4YKH A;  5FFB A;  1RCD A;  3PVR B;  4LPJ A;  1NNQ A;  2WLA A;  5AXS A;  1RCC A;  3SHX A;  5C6F A;  4CMY V;  3QZ3 A;  4LPN A;  4RC7 A;  3E1N A;  4CVT A;  4ZKX A;  2JD6 0;  4M32 A;  4XKU A;  2CHI A;  2Y44 A;  1VLG A;  4XKS A;  1LKO A;  4LQJ A; 
#chains in the Genus database with same CATH homology
 1H96 A;  5GN8 A;  3BT5 A;  4II4 A;  4Z3B A;  2ZG8 X;  3BVK A;  3F36 A;  1S2Z A;  2XGW A;  3H7G A;  4P18 A;  3SID A;  3E1Q A;  2FG4 A;  5J9V A;  1L8I A;  2W0O A;  3HL1 A;  5J8S A;  5J93 A;  4LYX A;  4DYZ A;  5IX6 A;  3NOZ X;  4CVS A;  5GU0 X;  3RD0 A;  4M34 A;  2CLB A;  5LS9 A;  4Y08 A;  2CN6 A;  4LQH A;  3GVY A;  4TW3 A;  1LKP A;  2FL0 A;  5JAC A;  2OH3 A;  1XZ1 A;  4TOA A;  2AR0 A;  3T9J A;  3A68 A;  1YUX A;  2C2F A;  1F33 A;  3AK8 A;  3IS8 A;  3E1P A;  3BVF A;  3QB9 A;  3NP2 X;  4IWJ A;  3OJ5 A;  1YV1 A;  3F33 A;  1SOF A;  3E2C A;  3JZ9 A;  4X0J A;  4QUW A;  5HU6 D;  2OC5 A;  3U90 A;  4MUD A;  5GOU A;  3R2M A;  3LKD A;  4ZL5 A;  2V8T A;  3KXU A;  2C6R A;  3AF8 X;  1JGC A;  5D8X A;  5FFE A;  5JDO A;  5K52 A;  4MY7 A;  4W4K B;  2BKC A;  2WLU A;  3ISE A;  2BK6 A;  3RE7 A;  4AM2 A;  3UOI A;  3SE1 A;  1ZS3 A;  2YJK A;  4RC7 B;  3OGH A;  5GU2 X;  3BVI A;  1LB3 A;  4TOB A;  2FJC A;  4M33 A;  2XJO A;  5JKL A;  2ZG9 X;  3BVL A;  3PZA A;  3N6O A;  4KVS A;  1JTS A;  5GN8 B;  4RC8 A;  5CZU A;  3L0M A;  4RC6 A;  3GE4 A;  4II4 B;  4TOF A;  1OTK A;  3KDQ A;  2C41 A;  3F32 A;  4YXM A;  1RYT A;  4PG1 A;  1VJX A;  3F34 A;  3PW8 A;  3AJQ A;  4YXJ A;  3R2H A;  3WVV A;  3FSE A;  3ERZ A;  3PW1 A;  3E6R A;  3Q4O A;  1TJO A;  1VEL A;  4ML5 A;  5J8W A;  1TK6 A;  3UOF A;  1RCG A;  2V2R A;  1BCF A;  4ISP A;  3IQ1 A;  2FHA A;  3AF9 X;  5LBH A;  4PGK A;  1QYB A;  1TKO A;  3AJO A;  3AF7 X;  4ZLW A;  3EZ0 A;  2CN7 A;  4ZJK A;  2C2J A;  4AM4 A;  4KVQ A;  5E1U A;  3R2O A;  4LQV A;  2Z5Q A;  2V2I A;  2C2U A;  1L8H A;  3F37 A;  1DAT A;  3KA3 A;  4TOG A;  5D8Q A;  4MJY A;  2CEI A;  5JKM G;  3WVU A;  4YVZ A;  2XJN A;  2ZUR X;  5CMR A;  3SH6 A;  3E1M A;  3O7S A;  4PGI A;  5K53 A;  2PYB A;  1N1Q A;  4LQN A;  1EUM A;  1JKV A;  1S3Q A;  2FFX J;  2UX1 A;  3D19 A;  3Q4Q A;  4WJG 4;  2QQY A;  3VVA A;  1IES A;  4E40 A;  1KRQ A;  3RAV A;  1UMN A;  3V3K B;  4AM5 A;  2Z6M A;  3WNW A;  1B71 A;  5HJH A;  4DYU A;  5JDO B;  1DPS A;  1JIG A;  4M35 A;  4ITW A;  3TA8 A;  1BFR A;  2WWX B;  3E1J A;  4ZL6 A;  2JD7 0;  4A25 A;  2YW7 A;  1JI5 A;  5D8Y A;  2Y3Q A;  3Q4R A;  5FEJ A;  4ZMC A;  4TOH A;  4CYB A;  4ZKW A;  2HR5 A;  1JI4 A;  3W54 A;  4EVC A;  4RC6 B;  4ISM A;  2CWL A;  3UNO A;  3VNX A;  3KX9 A;  2BJY A;  2V8U A;  4EVD A;  1R03 A;  2Z5P A;  4RC5 A;  4W4L B;  3M6J A;  4REU A;  3PW1 B;  4U3G A;  3F38 A;  1J30 A;  3FVB A;  1SQ3 A;  1IER A;  3PW8 C;  3QHB A;  4XGS A;  2IB0 A;  3EGM A;  4KVR A;  3EZU A;  3KA9 A;  4DI0 A;  2BW1 A;  1F30 A;  2FZF A;  2XJM A;  2ZA8 A;  4E6K A;  2FKZ A;  2YJJ A;  3KA4 A;  2HTN A;  4XKT A;  3C1Y A;  1UVH A;  3KHK A;  1TKP A;  5I4J A;  1HRS A;  2XKQ A;  2N02 A;  1QGH A;  3Q4N A;  5HJF A;  4MXP A;  3R2L A;  4CVP A;  2V2M A;  3C23 A;  1O9R A;  4ZKH A;  3AJP A;  3NP0 X;  4KXR B;  3R2S A;  4ERU A;  3WVW A;  3PWQ A;  1YUZ A;  3E6S A;  1LKM A;  2GYD A;  3AK9 A;  4MKU A;  5GU3 X;  2CIH A;  2F7N A;  5HQO A;  4TOE A;  5FFC A;  2V2O A;  3PVY A;  3JZA B;  3IS7 A;  2WTL A;  4ITT A;  3QD8 A;  1BG7 A;  4EVE A;  3E1L A;  3C1Z A;  2G38 B;  4DZ0 A;  2V2P A;  3PVT A;  3E1O A;  2IY4 A;  5ERK A;  4MN9 A;  1Z6O M;  2GYQ A;  2VXI A;  5LG8 A;  3VV9 A;  3PVR A;  3KA6 A;  2ZG7 X;  1VEI A;  5CMQ A;  1AEW A;  3RGD A;  2ZA6 A;  2V2S A;  5FFD A;  3HIU A;  3F35 A;  4ZTT A;  4DAS A;  1NF4 A;  5ERJ A;  2QF9 A;  4RC5 B;  1GWG A;  2GS4 A;  5D8R A;  1RCE A;  5FFA A;  3QHC A;  5JKM A;  1DVB A;  2FG8 A;  1MFR A;  3ISF A;  1JKU A;  1XZ3 A;  4OYN A;  4TOC A;  2JD8 0;  4DE6 A;  2V2J A;  4IWK A;  4CMY A;  2ITB A;  1FHA A;  4EVB A;  4LYU A;  1JYB A;  3DBY A;  3MPS A;  4Z5S A;  2CLU A;  2Z90 A;  1MOJ A;  2D5K A;  3FRS A;  5D8S A;  2VXX A;  2YW6 A;  3FRR A;  1NFV A;  2MGY A;  1NF6 A;  3UFB A;  3QVD A;  2X17 0;  2Z5R A;  3KWO A;  3PWF A;  1Z6O A;  2VZB A;  3ES3 A;  5LG2 A;  5JKL G;  2V2N A;  3A9Q A;  3RBC A;  5E2D A;  1O9I A;  4IXK A;  4TOD A;  1VEQ A;  2G4H A;  5GU1 X;  4DYX A;  4CVR A;  2RBD A;  4CY9 A;  5D8P A;  3BVE A;  1Z4A A;  4CYA A;  4R42 A;  3GGZ A;  4LPM A;  2CF7 A;  3GGY A;  1S30 A;  4ETR A;  2CHP A;  2ZA7 A;  1ZUJ A;  4TO9 A;  3PVY B;  3KA8 A;  3FI6 A;  5D8O A;  2OKC A;  3F39 A;  3O7R A;  1RCI A;  3BKN A;  2IU2 A;  4DYY A;  3PWQ C;  2V2L A;  3R2K A;  3PVT B;  1JRE A;  3GHQ A;  3R2R A;  2V15 A;  4PG0 A;  3C21 A;  4YKH A;  5FFB A;  1RCD A;  3PVR B;  4LPJ A;  1NNQ A;  2WLA A;  5AXS A;  1RCC A;  3SHX A;  5C6F A;  4CMY V;  3QZ3 A;  4LPN A;  4RC7 A;  3E1N A;  4CVT A;  4ZKX A;  2JD6 0;  4M32 A;  4XKU A;  2CHI A;  2Y44 A;  1VLG A;  4XKS A;  1LKO A;  4LQJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...