3PW8A

The phenylacetyl-coa monooxygenase paaac subcomplex with acetyl-coa
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
247
structure length
247
Chain Sequence
NQLTAYTLRLGDNCLVLSQRLGEWCGHAPELEIDLALANIGLDLLGQARNFLSYAAELAGEGDEDTLAFTRDERQFSNLLLVEQPNGNFADTIARQYFIDAWHVALFTRLMESRDPQLAAISAKAIKEARYHLRFSRGWLERLGNGTDVSGQKMQQAINKLWRFTAELFDADEIDIALSEEGIAVDPRTLRAAWEAEVFAGINEATLNVPQEQAYRTGGKKGLHTEHLGPMLAEMQYLQRVLPGQQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Phenylacetic acid degradation protein paaC
publication title Structural and Functional Studies of the Escherichia coli Phenylacetyl-CoA Monooxygenase Complex.
pubmed doi rcsb
source organism Escherichia coli
total genus 101
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3pw8A00
3HL1A 5CMQA 5J9VA 5IX6A 4YKHA 1ZS3A 3F39A 1NF4A 1RCIA 2ZA7A 1VELA 2XJMA 1QYBA 2CEIA 3F35A 1SQ3A 4LYUA 2V2JA 4OYNA 4KVSA 4ZLWA 5D8YA 5FFEA 3E1QA 3R2LA 1MOJA 1GWGA 4TOAA 4RC6B 3BVIA 3AJQA 3PWQC 2VXXA 1KRQA 3A9QA 3UNOA 2V15A 4LYXA 2ITBA 2HTNA 3GE4A 5J93A 3EZUA 2C2UA 3E6RA 1EUMA 3F36A 2ZG7X 4M32A 4RC6A 3ISEA 1J30A 2Z6MA 4CVRA 2QF9A 4RC5B 5FFDA 3MPSA 3KX9A 2V2OA 4TOCA 1TJOA 2BW1A 2OC5A 1DATA 5ERJA 5AXSA 3KXUA 1O9IA 1VEIA 4IXKA 4ITTA 1RYTA 1XZ1A 5FEJA 4RC5A 5CMRA 5FFBA 4AM2A 3RD0A 4PG1A 3Q4QA 3KWOA 4DASA 4TOHA 5I4JA 3H7GA 5D8RA 4ISMA 4AM5A 4II4B 2GS4A 2XGWA 3WVWA 2FL0A 2GYDA 5E1UA 2YJJA 2FG8A 4REUA 4DYZA 4II4A 2V2LA 5LG8A 3F33A 5E2DA 2BKCA 4MUDA 3IS8A 3BVLA 4MY7A 3SIDA 5HJFA 1N1QA 3NOZX 3OGHA 2ZURX 3RAVA 5HQOA 1RCGA 2FZFA 3AJPA 3QHBA 5D8XA 3RGDA 3U90A 1RCDA 3R2OA 1YUXA 3GHQA 5GOUA 1JKUA 3R2SA 1UMNA 3BKNA 3NP0X 5JKMG 4LPNA 3QD8A 4PGKA 3F32A 1ZUJA 4M34A 1JGCA 4ZL6A 3UOIA 3R2MA 3ES3A 3PVTB 5D8QA 3Q4NA 4ZL5A 3E1JA 1BFRA 3F34A 3SE1A 3F38A 4LPMA 3ISFA 4P18A 5ERKA 3E1OA 3PVTA 4LQNA 3QZ3A 1QGHA 5JACA 3HIUA 4DYYA 4RC7B 4DYUA 3PVYB 5HJHA 2V2SA 2CLUA 3O7SA 5LBHA 2RBDA 4EVCA 1DVBA 2WLUA 1F30A 2F7NA 4RC7A 3PVYA 1S2ZA 3PVRB 4CYAA 5K52A 2JD80 2V2PA 1XZ3A 3KA3A 3T9JA 1TKOA 4EVDA 2VXIA 2C41A 3E1NA 3FI6A 4RC8A 3R2KA 3NP2X 1IERA 4LPJA 2CHPA 3PVRA 3FSEA 4PGIA 3AK8A 3F37A 1H96A 5CZUA 2CN7A 4TODA 4EVEA 3WVVA 3E6SA 2FG4A 3PW8A 3BVKA 3E1LA 4EVBA 1RCEA 1L8HA 3FVBA 1NFVA 1R03A 2D5KA 2JD70 3UOFA 3OJ5A 3EGMA 4DYXA 1Z6OM 4ERUA 2UX1A 1S30A 4XKUA 2C6RA 1BG7A 4ZTTA 4AM4A 1IESA 1LKPA 3AK9A 4PG0A 1MFRA 2IB0A 1S3QA 1VJXA 1F33A 4QUWA 3QB9A 5LG2A 5K53A 2JD60 5J8WA 2GYQA 2Z5QA 4ZMCA 2V2MA 1O9RA 2V2IA 4CVPA 1LKMA 4ZJKA 4ML5A 5GU0X 3E1MA 2YW6A 2YW7A 3GVYA 4IWKA 2OH3A 1SOFA 5JKLG 4M35A 2XJOA 4TW3A 2CF7A 1YV1A 5FFAA 3KA9A 2QQYA 4MKUA 2CHIA 5JKMA 1JKVA 3PWFA 2V2RA 4ZKHA 2ZG9X 2IY4A 4ITWA 4LQHA 3BT5A 5D8PA 3AF7X 2ZA6A 3Q4RA 4CVTA 5C6FA 2YJKA 5FFCA 4U3GA 2C2JA 4ZKWA 3AF9X 3RBCA 4DI0A 1Z6OA 3PW1B 2Z90A 5GU2X 2Z5PA 3PWQA 1TKPA 4Y08A 4KVRA 3RE7A 1JIGA 2ZA8A 3R2RA 3IS7A 2FHAA 3PZAA 1NNQA 1NF6A 4TOFA 1B71A 3SH6A 3EZ0A 2BJYA 3PW1A 4MJYA 3KA4A 1JI5A 3ERZA 4MN9A 4CMYA 1LKOA 2HR5A 3QVDA 1RCCA 4CMYV 2FJCA 3KA8A 2C2FA 1YUZA 4ZKXA 2FKZA 2G4HA 2IU2A 4R42A 4TOEA 1FHAA 3O7RA 5D8SA 2WLAA 2PYBA 4TOBA 4IWJA 4TOGA 3E1PA 2X170 5LS9A 4Z5SA 3R2HA 1L8IA 2XKQA 1VLGA 4XKSA 2Y3QA 4KVQA 2BK6A 3QHCA 3VNXA 3SHXA 3A68A 1JTSA 1AEWA 1JREA 3IQ1A 4XKTA 2CLBA 3Q4OA 4CY9A 2W0OA 4E6KA 1OTKA 2CIHA 2FFXJ 4LQVA 3PW8C 3E2CA 2XJNA 3AF8X 5D8OA 3TA8A 2ZG8X 2V2NA 2Z5RA 2WTLA 3WVUA 5JKLA 1JYBA 4CYBA 5GN8B 4DZ0A 4ETRA 1BCFA 5J8SA 1JI4A 1VEQA 5GU3X 4TO9A 2CN6A 1HRSA 3KA6A 1TK6A 1Z4AA 4CVSA 4ISPA 3WNWA 2VZBA 4DE6A 5GN8A 1DPSA 1UVHA 3AJOA 4Z3BA 1LB3A 3BVFA 4M33A 4A25A 4LQJA 4XGSA 3BVEA 5GU1X
chains in the Genus database with same CATH superfamily
3HL1A 5CMQA 5J9VA 2G38B 5IX6A 4YXJA 4YKHA 1ZS3A 3F39A 1NF4A 1RCIA 2ZA7A 1VELA 2XJMA 3DBYA 1QYBA 2CEIA 3F35A 1SQ3A 3LKDA 4LYUA 2V2JA 4OYNA 4KVSA 4ZLWA 5D8YA 5FFEA 3E1QA 3R2LA 1MOJA 1GWGA 4TOAA 4RC6B 3BVIA 3AJQA 3PWQC 2VXXA 1KRQA 3A9QA 3UNOA 2V15A 4LYXA 2ITBA 3UFBA 2HTNA 3GE4A 5J93A 3EZUA 2C2UA 3E6RA 1EUMA 3F36A 2ZG7X 4M32A 4RC6A 3ISEA 1J30A 2Z6MA 4CVRA 2QF9A 4RC5B 5FFDA 3MPSA 3KX9A 2V2OA 4TOCA 1TJOA 2BW1A 2OC5A 1DATA 5ERJA 5AXSA 3KXUA 1O9IA 1VEIA 4IXKA 4KXRB 4ITTA 1RYTA 1XZ1A 5FEJA 4RC5A 5CMRA 5FFBA 4AM2A 3C23A 3RD0A 4PG1A 3Q4QA 3KWOA 4DASA 4TOHA 5I4JA 3H7GA 5JDOB 5D8RA 4ISMA 4AM5A 4II4B 2GS4A 2XGWA 3WVWA 5JDOA 2FL0A 2GYDA 5E1UA 2YJJA 2FG8A 4REUA 4DYZA 4II4A 2V2LA 5LG8A 3F33A 5E2DA 2BKCA 3C1YA 4MUDA 3IS8A 3BVLA 4MY7A 3SIDA 5HJFA 1N1QA 3NOZX 3OGHA 2ZURX 3RAVA 5HQOA 1RCGA 2FZFA 3V3KB 3AJPA 3QHBA 5D8XA 3RGDA 3U90A 1RCDA 3R2OA 1YUXA 3GHQA 5GOUA 1JKUA 4WJG4 3R2SA 1UMNA 3BKNA 3NP0X 4YXMA 4LPNA 4W4KB 5JKMG 3QD8A 4PGKA 3F32A 1ZUJA 4M34A 1JGCA 4ZL6A 3UOIA 3R2MA 3ES3A 3PVTB 5D8QA 3Q4NA 4ZL5A 3E1JA 2V8TA 3KHKA 1BFRA 3F34A 3VV9A 3SE1A 3F38A 4LPMA 3ISFA 4P18A 5ERKA 3E1OA 3PVTA 4LQNA 3QZ3A 1QGHA 5JACA 3HIUA 4DYYA 4RC7B 4DYUA 3L0MA 3PVYB 5HJHA 2V2SA 2CLUA 3O7SA 5LBHA 2RBDA 4EVCA 1DVBA 2WLUA 1F30A 2F7NA 4RC7A 3PVYA 1S2ZA 3PVRB 4CYAA 5K52A 2Y44A 2JD80 2V2PA 1XZ3A 3KA3A 3T9JA 1TKOA 4EVDA 2VXIA 2C41A 3E1NA 3FI6A 4RC8A 3R2KA 3NP2X 1IERA 4LPJA 2CHPA 3PVRA 3FSEA 4PGIA 3AK8A 3F37A 1H96A 5CZUA 2CN7A 4TODA 4EVEA 3WVVA 3E6SA 2FG4A 3PW8A 3BVKA 3E1LA 4EVBA 1RCEA 1L8HA 3FVBA 1NFVA 1R03A 2D5KA 2JD70 3UOFA 3OJ5A 3EGMA 4DYXA 1Z6OM 4ERUA 2UX1A 1S30A 4XKUA 2C6RA 1BG7A 3FRRA 4ZTTA 4AM4A 1IESA 1LKPA 3AK9A 4PG0A 1MFRA 2IB0A 1S3QA 1VJXA 1F33A 4QUWA 3QB9A 5LG2A 5K53A 2JD60 5J8WA 2GYQA 2Z5QA 4ZMCA 2V2MA 1O9RA 2V2IA 4CVPA 1LKMA 4ZJKA 4ML5A 5GU0X 3E1MA 2YW6A 2YW7A 3GVYA 4IWKA 2OH3A 1SOFA 5JKLG 4M35A 2XJOA 3VVAA 4TW3A 2CF7A 1YV1A 5FFAA 3KA9A 2QQYA 4MKUA 2CHIA 5JKMA 1JKVA 3PWFA 3D19A 2V2RA 4ZKHA 2ZG9X 2IY4A 4ITWA 4LQHA 3BT5A 5D8PA 3AF7X 2ZA6A 3Q4RA 4CVTA 5C6FA 2YJKA 5FFCA 4U3GA 2C2JA 3C1ZA 4ZKWA 3AF9X 3RBCA 4DI0A 1Z6OA 3PW1B 2Z90A 5GU2X 2Z5PA 3PWQA 1TKPA 4Y08A 4KVRA 3RE7A 1JIGA 2ZA8A 3C21A 3R2RA 4MXPA 3IS7A 2WWXB 2FHAA 3PZAA 1NNQA 1NF6A 4TOFA 1B71A 3SH6A 3EZ0A 2BJYA 3PW1A 4MJYA 3KA4A 1JI5A 2CWLA 3ERZA 4MN9A 4CMYA 1LKOA 2HR5A 4E40A 3QVDA 1RCCA 4CMYV 2FJCA 3KA8A 2C2FA 1YUZA 4ZKXA 2FKZA 2G4HA 2IU2A 4R42A 4TOEA 3GGYA 1FHAA 3W54A 3O7RA 5D8SA 2WLAA 2V8UA 2PYBA 3JZAB 4TOBA 4IWJA 4TOGA 3E1PA 2X170 5LS9A 4Z5SA 3R2HA 1L8IA 2XKQA 1VLGA 4XKSA 2Y3QA 4KVQA 2BK6A 3QHCA 3VNXA 2AR0A 3SHXA 3M6JA 3A68A 1JTSA 1AEWA 3KDQA 1JREA 3IQ1A 4W4LB 4XKTA 2CLBA 3Q4OA 4CY9A 2W0OA 4E6KA 5HU6D 1OTKA 2CIHA 2FFXJ 4LQVA 3PW8C 3E2CA 2XJNA 3AF8X 5D8OA 3JZ9A 3TA8A 2MGYA 2ZG8X 2V2NA 2Z5RA 2WTLA 3WVUA 5JKLA 1JYBA 4CYBA 5GN8B 4DZ0A 4ETRA 1BCFA 5J8SA 1JI4A 1VEQA 5GU3X 4TO9A 2CN6A 1HRSA 3KA6A 1TK6A 1Z4AA 4CVSA 4ISPA 2N02A 3WNWA 2VZBA 4DE6A 5GN8A 3GGZA 1DPSA 1UVHA 3AJOA 4Z3BA 3FRSA 1LB3A 3BVFA 4M33A 4A25A 4LQJA 4XGSA 2OKCA 3N6OA 3BVEA 4YVZA 5GU1X 4X0JA
chains in the Genus database with same CATH topology
3HL1A 5CMQA 5J9VA 2G38B 5IX6A 4YXJA 4YKHA 1ZS3A 3F39A 1NF4A 1RCIA 2ZA7A 1VELA 2XJMA 3DBYA 1QYBA 2CEIA 3F35A 1SQ3A 3LKDA 4LYUA 2V2JA 4OYNA 4KVSA 4ZLWA 5D8YA 5FFEA 3E1QA 3R2LA 1MOJA 1GWGA 4TOAA 4RC6B 3BVIA 3AJQA 3PWQC 2VXXA 1KRQA 3A9QA 3UNOA 2V15A 4LYXA 2ITBA 3UFBA 2HTNA 3GE4A 5J93A 3EZUA 2C2UA 3E6RA 1EUMA 3F36A 2ZG7X 4M32A 4RC6A 3ISEA 1J30A 2Z6MA 4CVRA 2QF9A 4RC5B 5FFDA 3MPSA 3KX9A 2V2OA 4TOCA 1TJOA 2BW1A 2OC5A 1DATA 5ERJA 5AXSA 3KXUA 1O9IA 1VEIA 4IXKA 4KXRB 4ITTA 1RYTA 1XZ1A 5FEJA 4RC5A 5CMRA 5FFBA 4AM2A 3C23A 3RD0A 4PG1A 3Q4QA 3KWOA 4DASA 4TOHA 5I4JA 3H7GA 5JDOB 5D8RA 4ISMA 4AM5A 4II4B 2GS4A 2XGWA 3WVWA 5JDOA 2FL0A 2GYDA 5E1UA 2YJJA 2FG8A 4REUA 4DYZA 4II4A 2V2LA 5LG8A 3F33A 5E2DA 2BKCA 3C1YA 4MUDA 3IS8A 3BVLA 4MY7A 3SIDA 5HJFA 1N1QA 3NOZX 3OGHA 2ZURX 3RAVA 5HQOA 1RCGA 2FZFA 3V3KB 3AJPA 3QHBA 5D8XA 3RGDA 3U90A 1RCDA 3R2OA 1YUXA 3GHQA 5GOUA 1JKUA 4WJG4 3R2SA 1UMNA 3BKNA 3NP0X 4YXMA 4LPNA 4W4KB 5JKMG 3QD8A 4PGKA 3F32A 1ZUJA 4M34A 1JGCA 4ZL6A 3UOIA 3R2MA 3ES3A 3PVTB 5D8QA 3Q4NA 4ZL5A 3E1JA 2V8TA 3KHKA 1BFRA 3F34A 3VV9A 3SE1A 3F38A 4LPMA 3ISFA 4P18A 5ERKA 3E1OA 3PVTA 4LQNA 3QZ3A 1QGHA 5JACA 3HIUA 4DYYA 4RC7B 4DYUA 3L0MA 3PVYB 5HJHA 2V2SA 2CLUA 3O7SA 5LBHA 2RBDA 4EVCA 1DVBA 2WLUA 1F30A 2F7NA 4RC7A 3PVYA 1S2ZA 3PVRB 4CYAA 5K52A 2Y44A 2JD80 2V2PA 1XZ3A 3KA3A 3T9JA 1TKOA 4EVDA 2VXIA 2C41A 3E1NA 3FI6A 4RC8A 3R2KA 3NP2X 1IERA 4LPJA 2CHPA 3PVRA 3FSEA 4PGIA 3AK8A 3F37A 1H96A 5CZUA 2CN7A 4TODA 4EVEA 3WVVA 3E6SA 2FG4A 3PW8A 3BVKA 3E1LA 4EVBA 1RCEA 1L8HA 3FVBA 1NFVA 1R03A 2D5KA 2JD70 3UOFA 3OJ5A 3EGMA 4DYXA 1Z6OM 4ERUA 2UX1A 1S30A 4XKUA 2C6RA 1BG7A 3FRRA 4ZTTA 4AM4A 1IESA 1LKPA 3AK9A 4PG0A 1MFRA 2IB0A 1S3QA 1VJXA 1F33A 4QUWA 3QB9A 5LG2A 5K53A 2JD60 5J8WA 2GYQA 2Z5QA 4ZMCA 2V2MA 1O9RA 2V2IA 4CVPA 1LKMA 4ZJKA 4ML5A 5GU0X 3E1MA 2YW6A 2YW7A 3GVYA 4IWKA 2OH3A 1SOFA 5JKLG 4M35A 2XJOA 3VVAA 4TW3A 2CF7A 1YV1A 5FFAA 3KA9A 2QQYA 4MKUA 2CHIA 5JKMA 1JKVA 3PWFA 3D19A 2V2RA 4ZKHA 2ZG9X 2IY4A 4ITWA 4LQHA 3BT5A 5D8PA 3AF7X 2ZA6A 3Q4RA 4CVTA 5C6FA 2YJKA 5FFCA 4U3GA 2C2JA 3C1ZA 4ZKWA 3AF9X 3RBCA 4DI0A 1Z6OA 3PW1B 2Z90A 5GU2X 2Z5PA 3PWQA 1TKPA 4Y08A 4KVRA 3RE7A 1JIGA 2ZA8A 3C21A 3R2RA 4MXPA 3IS7A 2WWXB 2FHAA 3PZAA 1NNQA 1NF6A 4TOFA 1B71A 3SH6A 3EZ0A 2BJYA 3PW1A 4MJYA 3KA4A 1JI5A 2CWLA 3ERZA 4MN9A 4CMYA 1LKOA 2HR5A 4E40A 3QVDA 1RCCA 4CMYV 2FJCA 3KA8A 2C2FA 1YUZA 4ZKXA 2FKZA 2G4HA 2IU2A 4R42A 4TOEA 3GGYA 1FHAA 3W54A 3O7RA 5D8SA 2WLAA 2V8UA 2PYBA 3JZAB 4TOBA 4IWJA 4TOGA 3E1PA 2X170 5LS9A 4Z5SA 3R2HA 1L8IA 2XKQA 1VLGA 4XKSA 2Y3QA 4KVQA 2BK6A 3QHCA 3VNXA 2AR0A 3SHXA 3M6JA 3A68A 1JTSA 1AEWA 3KDQA 1JREA 3IQ1A 4W4LB 4XKTA 2CLBA 3Q4OA 4CY9A 2W0OA 4E6KA 5HU6D 1OTKA 2CIHA 2FFXJ 4LQVA 3PW8C 3E2CA 2XJNA 3AF8X 5D8OA 3JZ9A 3TA8A 2MGYA 2ZG8X 2V2NA 2Z5RA 2WTLA 3WVUA 5JKLA 1JYBA 4CYBA 5GN8B 4DZ0A 4ETRA 1BCFA 5J8SA 1JI4A 1VEQA 5GU3X 4TO9A 2CN6A 1HRSA 3KA6A 1TK6A 1Z4AA 4CVSA 4ISPA 2N02A 3WNWA 2VZBA 4DE6A 5GN8A 3GGZA 1DPSA 1UVHA 3AJOA 4Z3BA 3FRSA 1LB3A 3BVFA 4M33A 4A25A 4LQJA 4XGSA 2OKCA 3N6OA 3BVEA 4YVZA 5GU1X 4X0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HL1 A;  5CMQ A;  5J9V A;  5IX6 A;  4YKH A;  1ZS3 A;  3F39 A;  1NF4 A;  1RCI A;  2ZA7 A;  1VEL A;  2XJM A;  1QYB A;  2CEI A;  3F35 A;  1SQ3 A;  4LYU A;  2V2J A;  4OYN A;  4KVS A;  4ZLW A;  5D8Y A;  5FFE A;  3E1Q A;  3R2L A;  1MOJ A;  1GWG A;  4TOA A;  4RC6 B;  3BVI A;  3AJQ A;  3PWQ C;  2VXX A;  1KRQ A;  3A9Q A;  3UNO A;  2V15 A;  4LYX A;  2ITB A;  2HTN A;  3GE4 A;  5J93 A;  3EZU A;  2C2U A;  3E6R A;  1EUM A;  3F36 A;  2ZG7 X;  4M32 A;  4RC6 A;  3ISE A;  1J30 A;  2Z6M A;  4CVR A;  2QF9 A;  4RC5 B;  5FFD A;  3MPS A;  3KX9 A;  2V2O A;  4TOC A;  1TJO A;  2BW1 A;  2OC5 A;  1DAT A;  5ERJ A;  5AXS A;  3KXU A;  1O9I A;  1VEI A;  4IXK A;  4ITT A;  1RYT A;  1XZ1 A;  5FEJ A;  4RC5 A;  5CMR A;  5FFB A;  4AM2 A;  3RD0 A;  4PG1 A;  3Q4Q A;  3KWO A;  4DAS A;  4TOH A;  5I4J A;  3H7G A;  5D8R A;  4ISM A;  4AM5 A;  4II4 B;  2GS4 A;  2XGW A;  3WVW A;  2FL0 A;  2GYD A;  5E1U A;  2YJJ A;  2FG8 A;  4REU A;  4DYZ A;  4II4 A;  2V2L A;  5LG8 A;  3F33 A;  5E2D A;  2BKC A;  4MUD A;  3IS8 A;  3BVL A;  4MY7 A;  3SID A;  5HJF A;  1N1Q A;  3NOZ X;  3OGH A;  2ZUR X;  3RAV A;  5HQO A;  1RCG A;  2FZF A;  3AJP A;  3QHB A;  5D8X A;  3RGD A;  3U90 A;  1RCD A;  3R2O A;  1YUX A;  3GHQ A;  5GOU A;  1JKU A;  3R2S A;  1UMN A;  3BKN A;  3NP0 X;  5JKM G;  4LPN A;  3QD8 A;  4PGK A;  3F32 A;  1ZUJ A;  4M34 A;  1JGC A;  4ZL6 A;  3UOI A;  3R2M A;  3ES3 A;  3PVT B;  5D8Q A;  3Q4N A;  4ZL5 A;  3E1J A;  1BFR A;  3F34 A;  3SE1 A;  3F38 A;  4LPM A;  3ISF A;  4P18 A;  5ERK A;  3E1O A;  3PVT A;  4LQN A;  3QZ3 A;  1QGH A;  5JAC A;  3HIU A;  4DYY A;  4RC7 B;  4DYU A;  3PVY B;  5HJH A;  2V2S A;  2CLU A;  3O7S A;  5LBH A;  2RBD A;  4EVC A;  1DVB A;  2WLU A;  1F30 A;  2F7N A;  4RC7 A;  3PVY A;  1S2Z A;  3PVR B;  4CYA A;  5K52 A;  2JD8 0;  2V2P A;  1XZ3 A;  3KA3 A;  3T9J A;  1TKO A;  4EVD A;  2VXI A;  2C41 A;  3E1N A;  3FI6 A;  4RC8 A;  3R2K A;  3NP2 X;  1IER A;  4LPJ A;  2CHP A;  3PVR A;  3FSE A;  4PGI A;  3AK8 A;  3F37 A;  1H96 A;  5CZU A;  2CN7 A;  4TOD A;  4EVE A;  3WVV A;  3E6S A;  2FG4 A;  3PW8 A;  3BVK A;  3E1L A;  4EVB A;  1RCE A;  1L8H A;  3FVB A;  1NFV A;  1R03 A;  2D5K A;  2JD7 0;  3UOF A;  3OJ5 A;  3EGM A;  4DYX A;  1Z6O M;  4ERU A;  2UX1 A;  1S30 A;  4XKU A;  2C6R A;  1BG7 A;  4ZTT A;  4AM4 A;  1IES A;  1LKP A;  3AK9 A;  4PG0 A;  1MFR A;  2IB0 A;  1S3Q A;  1VJX A;  1F33 A;  4QUW A;  3QB9 A;  5LG2 A;  5K53 A;  2JD6 0;  5J8W A;  2GYQ A;  2Z5Q A;  4ZMC A;  2V2M A;  1O9R A;  2V2I A;  4CVP A;  1LKM A;  4ZJK A;  4ML5 A;  5GU0 X;  3E1M A;  2YW6 A;  2YW7 A;  3GVY A;  4IWK A;  2OH3 A;  1SOF A;  5JKL G;  4M35 A;  2XJO A;  4TW3 A;  2CF7 A;  1YV1 A;  5FFA A;  3KA9 A;  2QQY A;  4MKU A;  2CHI A;  5JKM A;  1JKV A;  3PWF A;  2V2R A;  4ZKH A;  2ZG9 X;  2IY4 A;  4ITW A;  4LQH A;  3BT5 A;  5D8P A;  3AF7 X;  2ZA6 A;  3Q4R A;  4CVT A;  5C6F A;  2YJK A;  5FFC A;  4U3G A;  2C2J A;  4ZKW A;  3AF9 X;  3RBC A;  4DI0 A;  1Z6O A;  3PW1 B;  2Z90 A;  5GU2 X;  2Z5P A;  3PWQ A;  1TKP A;  4Y08 A;  4KVR A;  3RE7 A;  1JIG A;  2ZA8 A;  3R2R A;  3IS7 A;  2FHA A;  3PZA A;  1NNQ A;  1NF6 A;  4TOF A;  1B71 A;  3SH6 A;  3EZ0 A;  2BJY A;  3PW1 A;  4MJY A;  3KA4 A;  1JI5 A;  3ERZ A;  4MN9 A;  4CMY A;  1LKO A;  2HR5 A;  3QVD A;  1RCC A;  4CMY V;  2FJC A;  3KA8 A;  2C2F A;  1YUZ A;  4ZKX A;  2FKZ A;  2G4H A;  2IU2 A;  4R42 A;  4TOE A;  1FHA A;  3O7R A;  5D8S A;  2WLA A;  2PYB A;  4TOB A;  4IWJ A;  4TOG A;  3E1P A;  2X17 0;  5LS9 A;  4Z5S A;  3R2H A;  1L8I A;  2XKQ A;  1VLG A;  4XKS A;  2Y3Q A;  4KVQ A;  2BK6 A;  3QHC A;  3VNX A;  3SHX A;  3A68 A;  1JTS A;  1AEW A;  1JRE A;  3IQ1 A;  4XKT A;  2CLB A;  3Q4O A;  4CY9 A;  2W0O A;  4E6K A;  1OTK A;  2CIH A;  2FFX J;  4LQV A;  3PW8 C;  3E2C A;  2XJN A;  3AF8 X;  5D8O A;  3TA8 A;  2ZG8 X;  2V2N A;  2Z5R A;  2WTL A;  3WVU A;  5JKL A;  1JYB A;  4CYB A;  5GN8 B;  4DZ0 A;  4ETR A;  1BCF A;  5J8S A;  1JI4 A;  1VEQ A;  5GU3 X;  4TO9 A;  2CN6 A;  1HRS A;  3KA6 A;  1TK6 A;  1Z4A A;  4CVS A;  4ISP A;  3WNW A;  2VZB A;  4DE6 A;  5GN8 A;  1DPS A;  1UVH A;  3AJO A;  4Z3B A;  1LB3 A;  3BVF A;  4M33 A;  4A25 A;  4LQJ A;  4XGS A;  3BVE A;  5GU1 X; 
#chains in the Genus database with same CATH topology
 3HL1 A;  5CMQ A;  5J9V A;  2G38 B;  5IX6 A;  4YXJ A;  4YKH A;  1ZS3 A;  3F39 A;  1NF4 A;  1RCI A;  2ZA7 A;  1VEL A;  2XJM A;  3DBY A;  1QYB A;  2CEI A;  3F35 A;  1SQ3 A;  3LKD A;  4LYU A;  2V2J A;  4OYN A;  4KVS A;  4ZLW A;  5D8Y A;  5FFE A;  3E1Q A;  3R2L A;  1MOJ A;  1GWG A;  4TOA A;  4RC6 B;  3BVI A;  3AJQ A;  3PWQ C;  2VXX A;  1KRQ A;  3A9Q A;  3UNO A;  2V15 A;  4LYX A;  2ITB A;  3UFB A;  2HTN A;  3GE4 A;  5J93 A;  3EZU A;  2C2U A;  3E6R A;  1EUM A;  3F36 A;  2ZG7 X;  4M32 A;  4RC6 A;  3ISE A;  1J30 A;  2Z6M A;  4CVR A;  2QF9 A;  4RC5 B;  5FFD A;  3MPS A;  3KX9 A;  2V2O A;  4TOC A;  1TJO A;  2BW1 A;  2OC5 A;  1DAT A;  5ERJ A;  5AXS A;  3KXU A;  1O9I A;  1VEI A;  4IXK A;  4KXR B;  4ITT A;  1RYT A;  1XZ1 A;  5FEJ A;  4RC5 A;  5CMR A;  5FFB A;  4AM2 A;  3C23 A;  3RD0 A;  4PG1 A;  3Q4Q A;  3KWO A;  4DAS A;  4TOH A;  5I4J A;  3H7G A;  5JDO B;  5D8R A;  4ISM A;  4AM5 A;  4II4 B;  2GS4 A;  2XGW A;  3WVW A;  5JDO A;  2FL0 A;  2GYD A;  5E1U A;  2YJJ A;  2FG8 A;  4REU A;  4DYZ A;  4II4 A;  2V2L A;  5LG8 A;  3F33 A;  5E2D A;  2BKC A;  3C1Y A;  4MUD A;  3IS8 A;  3BVL A;  4MY7 A;  3SID A;  5HJF A;  1N1Q A;  3NOZ X;  3OGH A;  2ZUR X;  3RAV A;  5HQO A;  1RCG A;  2FZF A;  3V3K B;  3AJP A;  3QHB A;  5D8X A;  3RGD A;  3U90 A;  1RCD A;  3R2O A;  1YUX A;  3GHQ A;  5GOU A;  1JKU A;  4WJG 4;  3R2S A;  1UMN A;  3BKN A;  3NP0 X;  4YXM A;  4LPN A;  4W4K B;  5JKM G;  3QD8 A;  4PGK A;  3F32 A;  1ZUJ A;  4M34 A;  1JGC A;  4ZL6 A;  3UOI A;  3R2M A;  3ES3 A;  3PVT B;  5D8Q A;  3Q4N A;  4ZL5 A;  3E1J A;  2V8T A;  3KHK A;  1BFR A;  3F34 A;  3VV9 A;  3SE1 A;  3F38 A;  4LPM A;  3ISF A;  4P18 A;  5ERK A;  3E1O A;  3PVT A;  4LQN A;  3QZ3 A;  1QGH A;  5JAC A;  3HIU A;  4DYY A;  4RC7 B;  4DYU A;  3L0M A;  3PVY B;  5HJH A;  2V2S A;  2CLU A;  3O7S A;  5LBH A;  2RBD A;  4EVC A;  1DVB A;  2WLU A;  1F30 A;  2F7N A;  4RC7 A;  3PVY A;  1S2Z A;  3PVR B;  4CYA A;  5K52 A;  2Y44 A;  2JD8 0;  2V2P A;  1XZ3 A;  3KA3 A;  3T9J A;  1TKO A;  4EVD A;  2VXI A;  2C41 A;  3E1N A;  3FI6 A;  4RC8 A;  3R2K A;  3NP2 X;  1IER A;  4LPJ A;  2CHP A;  3PVR A;  3FSE A;  4PGI A;  3AK8 A;  3F37 A;  1H96 A;  5CZU A;  2CN7 A;  4TOD A;  4EVE A;  3WVV A;  3E6S A;  2FG4 A;  3PW8 A;  3BVK A;  3E1L A;  4EVB A;  1RCE A;  1L8H A;  3FVB A;  1NFV A;  1R03 A;  2D5K A;  2JD7 0;  3UOF A;  3OJ5 A;  3EGM A;  4DYX A;  1Z6O M;  4ERU A;  2UX1 A;  1S30 A;  4XKU A;  2C6R A;  1BG7 A;  3FRR A;  4ZTT A;  4AM4 A;  1IES A;  1LKP A;  3AK9 A;  4PG0 A;  1MFR A;  2IB0 A;  1S3Q A;  1VJX A;  1F33 A;  4QUW A;  3QB9 A;  5LG2 A;  5K53 A;  2JD6 0;  5J8W A;  2GYQ A;  2Z5Q A;  4ZMC A;  2V2M A;  1O9R A;  2V2I A;  4CVP A;  1LKM A;  4ZJK A;  4ML5 A;  5GU0 X;  3E1M A;  2YW6 A;  2YW7 A;  3GVY A;  4IWK A;  2OH3 A;  1SOF A;  5JKL G;  4M35 A;  2XJO A;  3VVA A;  4TW3 A;  2CF7 A;  1YV1 A;  5FFA A;  3KA9 A;  2QQY A;  4MKU A;  2CHI A;  5JKM A;  1JKV A;  3PWF A;  3D19 A;  2V2R A;  4ZKH A;  2ZG9 X;  2IY4 A;  4ITW A;  4LQH A;  3BT5 A;  5D8P A;  3AF7 X;  2ZA6 A;  3Q4R A;  4CVT A;  5C6F A;  2YJK A;  5FFC A;  4U3G A;  2C2J A;  3C1Z A;  4ZKW A;  3AF9 X;  3RBC A;  4DI0 A;  1Z6O A;  3PW1 B;  2Z90 A;  5GU2 X;  2Z5P A;  3PWQ A;  1TKP A;  4Y08 A;  4KVR A;  3RE7 A;  1JIG A;  2ZA8 A;  3C21 A;  3R2R A;  4MXP A;  3IS7 A;  2WWX B;  2FHA A;  3PZA A;  1NNQ A;  1NF6 A;  4TOF A;  1B71 A;  3SH6 A;  3EZ0 A;  2BJY A;  3PW1 A;  4MJY A;  3KA4 A;  1JI5 A;  2CWL A;  3ERZ A;  4MN9 A;  4CMY A;  1LKO A;  2HR5 A;  4E40 A;  3QVD A;  1RCC A;  4CMY V;  2FJC A;  3KA8 A;  2C2F A;  1YUZ A;  4ZKX A;  2FKZ A;  2G4H A;  2IU2 A;  4R42 A;  4TOE A;  3GGY A;  1FHA A;  3W54 A;  3O7R A;  5D8S A;  2WLA A;  2V8U A;  2PYB A;  3JZA B;  4TOB A;  4IWJ A;  4TOG A;  3E1P A;  2X17 0;  5LS9 A;  4Z5S A;  3R2H A;  1L8I A;  2XKQ A;  1VLG A;  4XKS A;  2Y3Q A;  4KVQ A;  2BK6 A;  3QHC A;  3VNX A;  2AR0 A;  3SHX A;  3M6J A;  3A68 A;  1JTS A;  1AEW A;  3KDQ A;  1JRE A;  3IQ1 A;  4W4L B;  4XKT A;  2CLB A;  3Q4O A;  4CY9 A;  2W0O A;  4E6K A;  5HU6 D;  1OTK A;  2CIH A;  2FFX J;  4LQV A;  3PW8 C;  3E2C A;  2XJN A;  3AF8 X;  5D8O A;  3JZ9 A;  3TA8 A;  2MGY A;  2ZG8 X;  2V2N A;  2Z5R A;  2WTL A;  3WVU A;  5JKL A;  1JYB A;  4CYB A;  5GN8 B;  4DZ0 A;  4ETR A;  1BCF A;  5J8S A;  1JI4 A;  1VEQ A;  5GU3 X;  4TO9 A;  2CN6 A;  1HRS A;  3KA6 A;  1TK6 A;  1Z4A A;  4CVS A;  4ISP A;  2N02 A;  3WNW A;  2VZB A;  4DE6 A;  5GN8 A;  3GGZ A;  1DPS A;  1UVH A;  3AJO A;  4Z3B A;  3FRS A;  1LB3 A;  3BVF A;  4M33 A;  4A25 A;  4LQJ A;  4XGS A;  2OKC A;  3N6O A;  3BVE A;  4YVZ A;  5GU1 X;  4X0J A; 
#chains in the Genus database with same CATH homology
 3HL1 A;  5CMQ A;  5J9V A;  2G38 B;  5IX6 A;  4YXJ A;  4YKH A;  1ZS3 A;  3F39 A;  1NF4 A;  1RCI A;  2ZA7 A;  1VEL A;  2XJM A;  3DBY A;  1QYB A;  2CEI A;  3F35 A;  1SQ3 A;  3LKD A;  4LYU A;  2V2J A;  4OYN A;  4KVS A;  4ZLW A;  5D8Y A;  5FFE A;  3E1Q A;  3R2L A;  1MOJ A;  1GWG A;  4TOA A;  4RC6 B;  3BVI A;  3AJQ A;  3PWQ C;  2VXX A;  1KRQ A;  3A9Q A;  3UNO A;  2V15 A;  4LYX A;  2ITB A;  3UFB A;  2HTN A;  3GE4 A;  5J93 A;  3EZU A;  2C2U A;  3E6R A;  1EUM A;  3F36 A;  2ZG7 X;  4M32 A;  4RC6 A;  3ISE A;  1J30 A;  2Z6M A;  4CVR A;  2QF9 A;  4RC5 B;  5FFD A;  3MPS A;  3KX9 A;  2V2O A;  4TOC A;  1TJO A;  2BW1 A;  2OC5 A;  1DAT A;  5ERJ A;  5AXS A;  3KXU A;  1O9I A;  1VEI A;  4IXK A;  4KXR B;  4ITT A;  1RYT A;  1XZ1 A;  5FEJ A;  4RC5 A;  5CMR A;  5FFB A;  4AM2 A;  3C23 A;  3RD0 A;  4PG1 A;  3Q4Q A;  3KWO A;  4DAS A;  4TOH A;  5I4J A;  3H7G A;  5JDO B;  5D8R A;  4ISM A;  4AM5 A;  4II4 B;  2GS4 A;  2XGW A;  3WVW A;  5JDO A;  2FL0 A;  2GYD A;  5E1U A;  2YJJ A;  2FG8 A;  4REU A;  4DYZ A;  4II4 A;  2V2L A;  5LG8 A;  3F33 A;  5E2D A;  2BKC A;  3C1Y A;  4MUD A;  3IS8 A;  3BVL A;  4MY7 A;  3SID A;  5HJF A;  1N1Q A;  3NOZ X;  3OGH A;  2ZUR X;  3RAV A;  5HQO A;  1RCG A;  2FZF A;  3V3K B;  3AJP A;  3QHB A;  5D8X A;  3RGD A;  3U90 A;  1RCD A;  3R2O A;  1YUX A;  3GHQ A;  5GOU A;  1JKU A;  4WJG 4;  3R2S A;  1UMN A;  3BKN A;  3NP0 X;  4YXM A;  4LPN A;  4W4K B;  5JKM G;  3QD8 A;  4PGK A;  3F32 A;  1ZUJ A;  4M34 A;  1JGC A;  4ZL6 A;  3UOI A;  3R2M A;  3ES3 A;  3PVT B;  5D8Q A;  3Q4N A;  4ZL5 A;  3E1J A;  2V8T A;  3KHK A;  1BFR A;  3F34 A;  3VV9 A;  3SE1 A;  3F38 A;  4LPM A;  3ISF A;  4P18 A;  5ERK A;  3E1O A;  3PVT A;  4LQN A;  3QZ3 A;  1QGH A;  5JAC A;  3HIU A;  4DYY A;  4RC7 B;  4DYU A;  3L0M A;  3PVY B;  5HJH A;  2V2S A;  2CLU A;  3O7S A;  5LBH A;  2RBD A;  4EVC A;  1DVB A;  2WLU A;  1F30 A;  2F7N A;  4RC7 A;  3PVY A;  1S2Z A;  3PVR B;  4CYA A;  5K52 A;  2Y44 A;  2JD8 0;  2V2P A;  1XZ3 A;  3KA3 A;  3T9J A;  1TKO A;  4EVD A;  2VXI A;  2C41 A;  3E1N A;  3FI6 A;  4RC8 A;  3R2K A;  3NP2 X;  1IER A;  4LPJ A;  2CHP A;  3PVR A;  3FSE A;  4PGI A;  3AK8 A;  3F37 A;  1H96 A;  5CZU A;  2CN7 A;  4TOD A;  4EVE A;  3WVV A;  3E6S A;  2FG4 A;  3PW8 A;  3BVK A;  3E1L A;  4EVB A;  1RCE A;  1L8H A;  3FVB A;  1NFV A;  1R03 A;  2D5K A;  2JD7 0;  3UOF A;  3OJ5 A;  3EGM A;  4DYX A;  1Z6O M;  4ERU A;  2UX1 A;  1S30 A;  4XKU A;  2C6R A;  1BG7 A;  3FRR A;  4ZTT A;  4AM4 A;  1IES A;  1LKP A;  3AK9 A;  4PG0 A;  1MFR A;  2IB0 A;  1S3Q A;  1VJX A;  1F33 A;  4QUW A;  3QB9 A;  5LG2 A;  5K53 A;  2JD6 0;  5J8W A;  2GYQ A;  2Z5Q A;  4ZMC A;  2V2M A;  1O9R A;  2V2I A;  4CVP A;  1LKM A;  4ZJK A;  4ML5 A;  5GU0 X;  3E1M A;  2YW6 A;  2YW7 A;  3GVY A;  4IWK A;  2OH3 A;  1SOF A;  5JKL G;  4M35 A;  2XJO A;  3VVA A;  4TW3 A;  2CF7 A;  1YV1 A;  5FFA A;  3KA9 A;  2QQY A;  4MKU A;  2CHI A;  5JKM A;  1JKV A;  3PWF A;  3D19 A;  2V2R A;  4ZKH A;  2ZG9 X;  2IY4 A;  4ITW A;  4LQH A;  3BT5 A;  5D8P A;  3AF7 X;  2ZA6 A;  3Q4R A;  4CVT A;  5C6F A;  2YJK A;  5FFC A;  4U3G A;  2C2J A;  3C1Z A;  4ZKW A;  3AF9 X;  3RBC A;  4DI0 A;  1Z6O A;  3PW1 B;  2Z90 A;  5GU2 X;  2Z5P A;  3PWQ A;  1TKP A;  4Y08 A;  4KVR A;  3RE7 A;  1JIG A;  2ZA8 A;  3C21 A;  3R2R A;  4MXP A;  3IS7 A;  2WWX B;  2FHA A;  3PZA A;  1NNQ A;  1NF6 A;  4TOF A;  1B71 A;  3SH6 A;  3EZ0 A;  2BJY A;  3PW1 A;  4MJY A;  3KA4 A;  1JI5 A;  2CWL A;  3ERZ A;  4MN9 A;  4CMY A;  1LKO A;  2HR5 A;  4E40 A;  3QVD A;  1RCC A;  4CMY V;  2FJC A;  3KA8 A;  2C2F A;  1YUZ A;  4ZKX A;  2FKZ A;  2G4H A;  2IU2 A;  4R42 A;  4TOE A;  3GGY A;  1FHA A;  3W54 A;  3O7R A;  5D8S A;  2WLA A;  2V8U A;  2PYB A;  3JZA B;  4TOB A;  4IWJ A;  4TOG A;  3E1P A;  2X17 0;  5LS9 A;  4Z5S A;  3R2H A;  1L8I A;  2XKQ A;  1VLG A;  4XKS A;  2Y3Q A;  4KVQ A;  2BK6 A;  3QHC A;  3VNX A;  2AR0 A;  3SHX A;  3M6J A;  3A68 A;  1JTS A;  1AEW A;  3KDQ A;  1JRE A;  3IQ1 A;  4W4L B;  4XKT A;  2CLB A;  3Q4O A;  4CY9 A;  2W0O A;  4E6K A;  5HU6 D;  1OTK A;  2CIH A;  2FFX J;  4LQV A;  3PW8 C;  3E2C A;  2XJN A;  3AF8 X;  5D8O A;  3JZ9 A;  3TA8 A;  2MGY A;  2ZG8 X;  2V2N A;  2Z5R A;  2WTL A;  3WVU A;  5JKL A;  1JYB A;  4CYB A;  5GN8 B;  4DZ0 A;  4ETR A;  1BCF A;  5J8S A;  1JI4 A;  1VEQ A;  5GU3 X;  4TO9 A;  2CN6 A;  1HRS A;  3KA6 A;  1TK6 A;  1Z4A A;  4CVS A;  4ISP A;  2N02 A;  3WNW A;  2VZB A;  4DE6 A;  5GN8 A;  3GGZ A;  1DPS A;  1UVH A;  3AJO A;  4Z3B A;  3FRS A;  1LB3 A;  3BVF A;  4M33 A;  4A25 A;  4LQJ A;  4XGS A;  2OKC A;  3N6O A;  3BVE A;  4YVZ A;  5GU1 X;  4X0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...