3R2MA

1.8a resolution structure of doubly soaked ftna from pseudomonas aeruginosa (ph 7.5)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
154
structure length
154
Chain Sequence
MQGHPEVIDYLNTLLTGELAARDQYFIHSRMYEDWGFSKLYERLNHEMEEETQHADALLRRILLLEGTPRMRPDDIHPGTTVPEMLEADLKLERHVRAALAKGIALCEQHKDFVSRDILKAQLADTEEDHAYWLEQQLGLIARMGLENYLQSQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Bacterioferritin
publication title Two distinct ferritin-like molecules in Pseudomonas aeruginosa: the product of the bfrA gene is a bacterial ferritin (FtnA) and not a bacterioferritin (Bfr).
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 77
structure length 154
sequence length 154
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2011-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3r2mA00
5J93A 2ZG7X 3BKNA 2G4HA 1O9RA 3T9JA 1GWGA 2ZURX 1R03A 5GN8A 2BKCA 3Q4NA 5HJHA 3PW1A 4EVCA 3E1NA 4TOEA 3ISFA 1NFVA 1H96A 1Z6OA 2CHIA 2GS4A 5FEJA 1EUMA 4DYZA 3FI6A 5JKLG 5JKMA 5LBHA 2JD80 1SQ3A 5E1UA 2RBDA 4ZKXA 1SOFA 2FKZA 3HL1A 3GHQA 2V2SA 2OH3A 2CHPA 2FL0A 3O7SA 4ZLWA 4DYXA 3KX9A 4ITWA 3UOIA 3PWFA 4QUWA 3F38A 4LPJA 1JYBA 5GOUA 3EZ0A 1JTSA 3GVYA 2ZG9X 3AJOA 3E2CA 4ZKHA 4ZJKA 5K53A 3BVKA 3SIDA 2V2JA 1RCGA 2V2PA 5D8YA 4M35A 5ERJA 2XKQA 3RD0A 4DASA 2Z5RA 4CVRA 4U3GA 5JACA 5GU0X 3O7RA 2F7NA 5CMRA 3KA6A 1LKOA 3E6SA 4PG0A 1J30A 2OC5A 1Z6OM 4LPMA 4AM4A 4TO9A 3E1PA 2XGWA 3QHCA 2IU2A 4ERUA 2C2FA 2IY4A 5C6FA 4CYBA 3NP2X 4CVPA 5D8SA 1MOJA 3PVRA 3F36A 3AJPA 2FFXJ 4MJYA 3OGHA 5D8PA 3E1MA 2YW7A 4RC5B 5FFAA 2Z5QA 2XJNA 2WLAA 1FHAA 4ITTA 4AM5A 1TKPA 4KVRA 1NF4A 2Z90A 4ZL5A 5GN8B 1DPSA 5LS9A 3KA9A 3BVLA 1ZUJA 3AF7X 2YW6A 1JKUA 4XKSA 2V2OA 4CMYV 5IX6A 3WNWA 4ETRA 1JREA 4MN9A 4PGIA 1VELA 3FSEA 4KVQA 4M33A 4P18A 3AF9X 1L8HA 3R2MA 4IWKA 4RC5A 1VEQA 3KA3A 2XJOA 3EZUA 3R2SA 1AEWA 1RCDA 5D8RA 1VLGA 3Q4QA 2C6RA 3AK9A 4XGSA 4DYYA 1B71A 4LPNA 1MFRA 2V15A 3AK8A 3Q4RA 3QB9A 3SHXA 1NF6A 1LKPA 3PWQC 1F33A 2VZBA 2QQYA 2YJJA 3GE4A 5K52A 2UX1A 1YV1A 5HJFA 3NP0X 2BJYA 5CMQA 4MY7A 3IS8A 3QVDA 5CZUA 1QYBA 5GU1X 3SE1A 1S3QA 2BK6A 4EVDA 3F39A 4REUA 1KRQA 4TOFA 3A9QA 3WVVA 4TODA 2CN7A 3UNOA 4PGKA 5HQOA 3BVEA 3KA8A 4II4B 5J9VA 3PVRB 4M32A 4MUDA 3WVWA 2VXIA 1XZ1A 4ISMA 3E1JA 3R2RA 2QF9A 4MKUA 2WLUA 3EGMA 4DI0A 2V2MA 1L8IA 2FHAA 3PVYA 4RC6A 5LG8A 2V2IA 2CN6A 5JKMG 1F30A 2IB0A 2D5KA 4Z3BA 4RC7A 5GU3X 4II4A 2V2NA 1YUZA 2JD60 1RCEA 2ZA6A 3AF8X 4CY9A 4ISPA 2C2UA 1IESA 4LQJA 3KXUA 4LQNA 1HRSA 2W0OA 4AM2A 3RE7A 1TJOA 3R2OA 3E1QA 5J8WA 4TW3A 3BVFA 5JKLA 1QGHA 3VNXA 3TA8A 3AJQA 2FG4A 2FJCA 3U90A 2ZA7A 2CF7A 2YJKA 4OYNA 4YKHA 4CVTA 2Z6MA 3NOZX 4XKUA 4RC8A 1VEIA 1JI4A 2BW1A 4XKTA 2CIHA 4LQHA 4LQVA 5I4JA 1IERA 3RBCA 5GU2X 4M34A 1BCFA 4KVSA 4PG1A 4E6KA 1RCIA 3F37A 1RYTA 1DVBA 1JI5A 4ZL6A 2ZG8X 1DATA 2CLBA 3FVBA 1JGCA 5ERKA 2VXXA 3R2LA 4LYUA 2GYQA 3PVTB 2WTLA 4TOGA 3PWQA 1XZ3A 2Y3QA 1Z4AA 5D8XA 3F35A 4IXKA 1JKVA 1NNQA 5D8OA 3Q4OA 3IQ1A 3PW8C 3ERZA 3PZAA 1TK6A 1S2ZA 4DZ0A 5FFCA 3RGDA 3E1OA 3H7GA 1BFRA 1JIGA 4IWJA 3PVYB 3E6RA 4RC6B 3PVTA 3QHBA 1RCCA 4TOHA 3PW8A 5J8SA 3R2KA 1BG7A 4RC7B 4EVBA 2XJMA 1ZS3A 3QD8A 2Z5PA 2V2RA 4ZKWA 3OJ5A 1N1QA 5AXSA 4TOAA 4LYXA 3MPSA 3F33A 2GYDA 1TKOA 3WVUA 1S30A 3SH6A 2JD70 5E2DA 4Z5SA 4TOBA 2FG8A 5FFDA 3ISEA 3A68A 3R2HA 4TOCA 2V2LA 3E1LA 4ZMCA 3UOFA 2HTNA 2FZFA 5LG2A 4CMYA 1LKMA 3ES3A 3QZ3A 3F32A 2C2JA 4DE6A 4DYUA 4CVSA 1LB3A 1UMNA 3BT5A 2ITBA 1UVHA 3F34A 3IS7A 2HR5A 4Y08A 4A25A 4ML5A 1YUXA 2PYBA 3KWOA 3KA4A 2CLUA 4R42A 2X170 1VJXA 4EVEA 5FFBA 2C41A 5FFEA 1O9IA 3PW1B 3HIUA 3RAVA 4CYAA 2ZA8A 1OTKA 4ZTTA 2CEIA 3BVIA 5D8QA
chains in the Genus database with same CATH superfamily
5J93A 2ZG7X 3BKNA 2G4HA 1O9RA 3T9JA 1GWGA 3C1YA 2V8UA 3C23A 2ZURX 1R03A 2Y44A 5GN8A 2BKCA 3Q4NA 5HJHA 3PW1A 4EVCA 3E1NA 4TOEA 3ISFA 1NFVA 1H96A 2CWLA 1Z6OA 2CHIA 2GS4A 5FEJA 1EUMA 4DYZA 3FI6A 5JKLG 5JKMA 5LBHA 2JD80 1SQ3A 5E1UA 2RBDA 4ZKXA 1SOFA 2FKZA 3HL1A 3GHQA 2V2SA 2OH3A 2CHPA 2FL0A 3O7SA 4ZLWA 4DYXA 5JDOB 3KX9A 4ITWA 3UOIA 3PWFA 4QUWA 3F38A 4LPJA 1JYBA 5GOUA 3EZ0A 1JTSA 3GVYA 2ZG9X 3AJOA 3E2CA 4ZKHA 3FRRA 4ZJKA 5K53A 3BVKA 3SIDA 2V2JA 1RCGA 2V2PA 5D8YA 4M35A 5ERJA 2XKQA 3RD0A 4DASA 2Z5RA 4CVRA 4U3GA 5JACA 5GU0X 5JDOA 3O7RA 2F7NA 5CMRA 3KA6A 1LKOA 3E6SA 4PG0A 1J30A 2OC5A 1Z6OM 4LPMA 4E40A 4AM4A 4TO9A 3E1PA 2XGWA 3QHCA 2IU2A 4ERUA 2C2FA 2IY4A 5C6FA 4CYBA 3NP2X 4CVPA 4W4KB 5D8SA 1MOJA 3C1ZA 3PVRA 3F36A 3AJPA 3GGZA 2FFXJ 4MJYA 3OGHA 5D8PA 3E1MA 2YW7A 4RC5B 5FFAA 2Z5QA 2XJNA 2WLAA 1FHAA 4ITTA 4AM5A 1TKPA 4KVRA 1NF4A 2Z90A 4ZL5A 5GN8B 1DPSA 5LS9A 3KA9A 3BVLA 1ZUJA 3AF7X 2YW6A 1JKUA 4XKSA 2V2OA 3M6JA 4CMYV 5IX6A 3WNWA 4ETRA 1JREA 4MN9A 4PGIA 1VELA 3FSEA 4KVQA 4M33A 4P18A 3AF9X 1L8HA 3R2MA 4IWKA 4RC5A 1VEQA 3KA3A 2XJOA 3EZUA 3R2SA 1AEWA 1RCDA 5D8RA 1VLGA 3Q4QA 2C6RA 3AK9A 4XGSA 3KHKA 4DYYA 3GGYA 1B71A 4LPNA 1MFRA 2V15A 3AK8A 3Q4RA 3QB9A 3SHXA 1NF6A 1LKPA 3PWQC 1F33A 2VZBA 2QQYA 2YJJA 3GE4A 5K52A 2UX1A 1YV1A 5HJFA 3NP0X 2BJYA 5CMQA 3LKDA 4MY7A 3IS8A 3QVDA 5CZUA 1QYBA 5GU1X 3SE1A 3VVAA 1S3QA 2BK6A 4EVDA 3F39A 2OKCA 4REUA 1KRQA 3D19A 4TOFA 3A9QA 3WVVA 4TODA 2CN7A 3UNOA 4PGKA 5HQOA 3BVEA 3KA8A 4II4B 5J9VA 3PVRB 4X0JA 4M32A 3W54A 4MUDA 3WVWA 2VXIA 1XZ1A 4ISMA 3E1JA 3R2RA 2QF9A 4MKUA 2WLUA 3EGMA 4DI0A 2V2MA 1L8IA 2FHAA 3PVYA 4RC6A 5LG8A 2V2IA 2CN6A 5JKMG 1F30A 2IB0A 2D5KA 4Z3BA 4RC7A 5GU3X 4II4A 2V2NA 1YUZA 2JD60 1RCEA 2ZA6A 3AF8X 4CY9A 4ISPA 2C2UA 1IESA 4LQJA 3KXUA 4LQNA 1HRSA 2W0OA 4AM2A 3RE7A 1TJOA 3R2OA 3E1QA 5J8WA 4TW3A 3BVFA 5JKLA 4YXJA 1QGHA 3VNXA 3TA8A 3AJQA 2FG4A 2FJCA 3U90A 2ZA7A 2CF7A 2YJKA 4OYNA 4YKHA 2WWXB 4CVTA 2Z6MA 3NOZX 4XKUA 4RC8A 4KXRB 1VEIA 1JI4A 2BW1A 2MGYA 4XKTA 2CIHA 4LQHA 4LQVA 5I4JA 1IERA 3RBCA 5GU2X 4W4LB 4M34A 1BCFA 4KVSA 4PG1A 4E6KA 1RCIA 3F37A 1RYTA 1DVBA 1JI5A 4ZL6A 2ZG8X 1DATA 2CLBA 3FVBA 1JGCA 5ERKA 2VXXA 3R2LA 4LYUA 3C21A 2GYQA 3PVTB 2WTLA 4TOGA 3PWQA 1XZ3A 2Y3QA 3JZ9A 1Z4AA 5D8XA 3F35A 4IXKA 1JKVA 1NNQA 5D8OA 3Q4OA 3IQ1A 3PW8C 2AR0A 3ERZA 3PZAA 1TK6A 1S2ZA 4YXMA 4DZ0A 5FFCA 3RGDA 3E1OA 3H7GA 1BFRA 4WJG4 1JIGA 4IWJA 4MXPA 3PVYB 3E6RA 4RC6B 3PVTA 3QHBA 1RCCA 4TOHA 3PW8A 5J8SA 3R2KA 1BG7A 4RC7B 4EVBA 2XJMA 1ZS3A 3QD8A 2Z5PA 2V2RA 4ZKWA 3OJ5A 1N1QA 5AXSA 4TOAA 4LYXA 3MPSA 3F33A 2GYDA 1TKOA 3WVUA 1S30A 3SH6A 2JD70 5E2DA 4Z5SA 4TOBA 2FG8A 2V8TA 5FFDA 3ISEA 3UFBA 3A68A 3R2HA 4TOCA 2V2LA 3E1LA 3JZAB 4ZMCA 3UOFA 2HTNA 2FZFA 5LG2A 5HU6D 4CMYA 1LKMA 3ES3A 3QZ3A 3F32A 2C2JA 4DE6A 4DYUA 2N02A 4CVSA 1LB3A 1UMNA 3BT5A 2ITBA 3N6OA 1UVHA 3F34A 3IS7A 3DBYA 2HR5A 4Y08A 4YVZA 4A25A 4ML5A 1YUXA 2PYBA 3KWOA 3KA4A 2CLUA 4R42A 2X170 1VJXA 3V3KB 4EVEA 3FRSA 3L0MA 2G38B 5FFBA 3KDQA 2C41A 5FFEA 1O9IA 3PW1B 3HIUA 3RAVA 4CYAA 2ZA8A 1OTKA 4ZTTA 2CEIA 3VV9A 3BVIA 5D8QA
chains in the Genus database with same CATH topology
5J93A 2ZG7X 3BKNA 2G4HA 1O9RA 3T9JA 1GWGA 3C1YA 2V8UA 3C23A 2ZURX 1R03A 2Y44A 5GN8A 2BKCA 3Q4NA 5HJHA 3PW1A 4EVCA 3E1NA 4TOEA 3ISFA 1NFVA 1H96A 2CWLA 1Z6OA 2CHIA 2GS4A 5FEJA 1EUMA 4DYZA 3FI6A 5JKLG 5JKMA 5LBHA 2JD80 1SQ3A 5E1UA 2RBDA 4ZKXA 1SOFA 2FKZA 3HL1A 3GHQA 2V2SA 2OH3A 2CHPA 2FL0A 3O7SA 4ZLWA 4DYXA 5JDOB 3KX9A 4ITWA 3UOIA 3PWFA 4QUWA 3F38A 4LPJA 1JYBA 5GOUA 3EZ0A 1JTSA 3GVYA 2ZG9X 3AJOA 3E2CA 4ZKHA 3FRRA 4ZJKA 5K53A 3BVKA 3SIDA 2V2JA 1RCGA 2V2PA 5D8YA 4M35A 5ERJA 2XKQA 3RD0A 4DASA 2Z5RA 4CVRA 4U3GA 5JACA 5GU0X 5JDOA 3O7RA 2F7NA 5CMRA 3KA6A 1LKOA 3E6SA 4PG0A 1J30A 2OC5A 1Z6OM 4LPMA 4E40A 4AM4A 4TO9A 3E1PA 2XGWA 3QHCA 2IU2A 4ERUA 2C2FA 2IY4A 5C6FA 4CYBA 3NP2X 4CVPA 4W4KB 5D8SA 1MOJA 3C1ZA 3PVRA 3F36A 3AJPA 3GGZA 2FFXJ 4MJYA 3OGHA 5D8PA 3E1MA 2YW7A 4RC5B 5FFAA 2Z5QA 2XJNA 2WLAA 1FHAA 4ITTA 4AM5A 1TKPA 4KVRA 1NF4A 2Z90A 4ZL5A 5GN8B 1DPSA 5LS9A 3KA9A 3BVLA 1ZUJA 3AF7X 2YW6A 1JKUA 4XKSA 2V2OA 3M6JA 4CMYV 5IX6A 3WNWA 4ETRA 1JREA 4MN9A 4PGIA 1VELA 3FSEA 4KVQA 4M33A 4P18A 3AF9X 1L8HA 3R2MA 4IWKA 4RC5A 1VEQA 3KA3A 2XJOA 3EZUA 3R2SA 1AEWA 1RCDA 5D8RA 1VLGA 3Q4QA 2C6RA 3AK9A 4XGSA 3KHKA 4DYYA 3GGYA 1B71A 4LPNA 1MFRA 2V15A 3AK8A 3Q4RA 3QB9A 3SHXA 1NF6A 1LKPA 3PWQC 1F33A 2VZBA 2QQYA 2YJJA 3GE4A 5K52A 2UX1A 1YV1A 5HJFA 3NP0X 2BJYA 5CMQA 3LKDA 4MY7A 3IS8A 3QVDA 5CZUA 1QYBA 5GU1X 3SE1A 3VVAA 1S3QA 2BK6A 4EVDA 3F39A 2OKCA 4REUA 1KRQA 3D19A 4TOFA 3A9QA 3WVVA 4TODA 2CN7A 3UNOA 4PGKA 5HQOA 3BVEA 3KA8A 4II4B 5J9VA 3PVRB 4X0JA 4M32A 3W54A 4MUDA 3WVWA 2VXIA 1XZ1A 4ISMA 3E1JA 3R2RA 2QF9A 4MKUA 2WLUA 3EGMA 4DI0A 2V2MA 1L8IA 2FHAA 3PVYA 4RC6A 5LG8A 2V2IA 2CN6A 5JKMG 1F30A 2IB0A 2D5KA 4Z3BA 4RC7A 5GU3X 4II4A 2V2NA 1YUZA 2JD60 1RCEA 2ZA6A 3AF8X 4CY9A 4ISPA 2C2UA 1IESA 4LQJA 3KXUA 4LQNA 1HRSA 2W0OA 4AM2A 3RE7A 1TJOA 3R2OA 3E1QA 5J8WA 4TW3A 3BVFA 5JKLA 4YXJA 1QGHA 3VNXA 3TA8A 3AJQA 2FG4A 2FJCA 3U90A 2ZA7A 2CF7A 2YJKA 4OYNA 4YKHA 2WWXB 4CVTA 2Z6MA 3NOZX 4XKUA 4RC8A 4KXRB 1VEIA 1JI4A 2BW1A 2MGYA 4XKTA 2CIHA 4LQHA 4LQVA 5I4JA 1IERA 3RBCA 5GU2X 4W4LB 4M34A 1BCFA 4KVSA 4PG1A 4E6KA 1RCIA 3F37A 1RYTA 1DVBA 1JI5A 4ZL6A 2ZG8X 1DATA 2CLBA 3FVBA 1JGCA 5ERKA 2VXXA 3R2LA 4LYUA 3C21A 2GYQA 3PVTB 2WTLA 4TOGA 3PWQA 1XZ3A 2Y3QA 3JZ9A 1Z4AA 5D8XA 3F35A 4IXKA 1JKVA 1NNQA 5D8OA 3Q4OA 3IQ1A 3PW8C 2AR0A 3ERZA 3PZAA 1TK6A 1S2ZA 4YXMA 4DZ0A 5FFCA 3RGDA 3E1OA 3H7GA 1BFRA 4WJG4 1JIGA 4IWJA 4MXPA 3PVYB 3E6RA 4RC6B 3PVTA 3QHBA 1RCCA 4TOHA 3PW8A 5J8SA 3R2KA 1BG7A 4RC7B 4EVBA 2XJMA 1ZS3A 3QD8A 2Z5PA 2V2RA 4ZKWA 3OJ5A 1N1QA 5AXSA 4TOAA 4LYXA 3MPSA 3F33A 2GYDA 1TKOA 3WVUA 1S30A 3SH6A 2JD70 5E2DA 4Z5SA 4TOBA 2FG8A 2V8TA 5FFDA 3ISEA 3UFBA 3A68A 3R2HA 4TOCA 2V2LA 3E1LA 3JZAB 4ZMCA 3UOFA 2HTNA 2FZFA 5LG2A 5HU6D 4CMYA 1LKMA 3ES3A 3QZ3A 3F32A 2C2JA 4DE6A 4DYUA 2N02A 4CVSA 1LB3A 1UMNA 3BT5A 2ITBA 3N6OA 1UVHA 3F34A 3IS7A 3DBYA 2HR5A 4Y08A 4YVZA 4A25A 4ML5A 1YUXA 2PYBA 3KWOA 3KA4A 2CLUA 4R42A 2X170 1VJXA 3V3KB 4EVEA 3FRSA 3L0MA 2G38B 5FFBA 3KDQA 2C41A 5FFEA 1O9IA 3PW1B 3HIUA 3RAVA 4CYAA 2ZA8A 1OTKA 4ZTTA 2CEIA 3VV9A 3BVIA 5D8QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J93 A;  2ZG7 X;  3BKN A;  2G4H A;  1O9R A;  3T9J A;  1GWG A;  2ZUR X;  1R03 A;  5GN8 A;  2BKC A;  3Q4N A;  5HJH A;  3PW1 A;  4EVC A;  3E1N A;  4TOE A;  3ISF A;  1NFV A;  1H96 A;  1Z6O A;  2CHI A;  2GS4 A;  5FEJ A;  1EUM A;  4DYZ A;  3FI6 A;  5JKL G;  5JKM A;  5LBH A;  2JD8 0;  1SQ3 A;  5E1U A;  2RBD A;  4ZKX A;  1SOF A;  2FKZ A;  3HL1 A;  3GHQ A;  2V2S A;  2OH3 A;  2CHP A;  2FL0 A;  3O7S A;  4ZLW A;  4DYX A;  3KX9 A;  4ITW A;  3UOI A;  3PWF A;  4QUW A;  3F38 A;  4LPJ A;  1JYB A;  5GOU A;  3EZ0 A;  1JTS A;  3GVY A;  2ZG9 X;  3AJO A;  3E2C A;  4ZKH A;  4ZJK A;  5K53 A;  3BVK A;  3SID A;  2V2J A;  1RCG A;  2V2P A;  5D8Y A;  4M35 A;  5ERJ A;  2XKQ A;  3RD0 A;  4DAS A;  2Z5R A;  4CVR A;  4U3G A;  5JAC A;  5GU0 X;  3O7R A;  2F7N A;  5CMR A;  3KA6 A;  1LKO A;  3E6S A;  4PG0 A;  1J30 A;  2OC5 A;  1Z6O M;  4LPM A;  4AM4 A;  4TO9 A;  3E1P A;  2XGW A;  3QHC A;  2IU2 A;  4ERU A;  2C2F A;  2IY4 A;  5C6F A;  4CYB A;  3NP2 X;  4CVP A;  5D8S A;  1MOJ A;  3PVR A;  3F36 A;  3AJP A;  2FFX J;  4MJY A;  3OGH A;  5D8P A;  3E1M A;  2YW7 A;  4RC5 B;  5FFA A;  2Z5Q A;  2XJN A;  2WLA A;  1FHA A;  4ITT A;  4AM5 A;  1TKP A;  4KVR A;  1NF4 A;  2Z90 A;  4ZL5 A;  5GN8 B;  1DPS A;  5LS9 A;  3KA9 A;  3BVL A;  1ZUJ A;  3AF7 X;  2YW6 A;  1JKU A;  4XKS A;  2V2O A;  4CMY V;  5IX6 A;  3WNW A;  4ETR A;  1JRE A;  4MN9 A;  4PGI A;  1VEL A;  3FSE A;  4KVQ A;  4M33 A;  4P18 A;  3AF9 X;  1L8H A;  3R2M A;  4IWK A;  4RC5 A;  1VEQ A;  3KA3 A;  2XJO A;  3EZU A;  3R2S A;  1AEW A;  1RCD A;  5D8R A;  1VLG A;  3Q4Q A;  2C6R A;  3AK9 A;  4XGS A;  4DYY A;  1B71 A;  4LPN A;  1MFR A;  2V15 A;  3AK8 A;  3Q4R A;  3QB9 A;  3SHX A;  1NF6 A;  1LKP A;  3PWQ C;  1F33 A;  2VZB A;  2QQY A;  2YJJ A;  3GE4 A;  5K52 A;  2UX1 A;  1YV1 A;  5HJF A;  3NP0 X;  2BJY A;  5CMQ A;  4MY7 A;  3IS8 A;  3QVD A;  5CZU A;  1QYB A;  5GU1 X;  3SE1 A;  1S3Q A;  2BK6 A;  4EVD A;  3F39 A;  4REU A;  1KRQ A;  4TOF A;  3A9Q A;  3WVV A;  4TOD A;  2CN7 A;  3UNO A;  4PGK A;  5HQO A;  3BVE A;  3KA8 A;  4II4 B;  5J9V A;  3PVR B;  4M32 A;  4MUD A;  3WVW A;  2VXI A;  1XZ1 A;  4ISM A;  3E1J A;  3R2R A;  2QF9 A;  4MKU A;  2WLU A;  3EGM A;  4DI0 A;  2V2M A;  1L8I A;  2FHA A;  3PVY A;  4RC6 A;  5LG8 A;  2V2I A;  2CN6 A;  5JKM G;  1F30 A;  2IB0 A;  2D5K A;  4Z3B A;  4RC7 A;  5GU3 X;  4II4 A;  2V2N A;  1YUZ A;  2JD6 0;  1RCE A;  2ZA6 A;  3AF8 X;  4CY9 A;  4ISP A;  2C2U A;  1IES A;  4LQJ A;  3KXU A;  4LQN A;  1HRS A;  2W0O A;  4AM2 A;  3RE7 A;  1TJO A;  3R2O A;  3E1Q A;  5J8W A;  4TW3 A;  3BVF A;  5JKL A;  1QGH A;  3VNX A;  3TA8 A;  3AJQ A;  2FG4 A;  2FJC A;  3U90 A;  2ZA7 A;  2CF7 A;  2YJK A;  4OYN A;  4YKH A;  4CVT A;  2Z6M A;  3NOZ X;  4XKU A;  4RC8 A;  1VEI A;  1JI4 A;  2BW1 A;  4XKT A;  2CIH A;  4LQH A;  4LQV A;  5I4J A;  1IER A;  3RBC A;  5GU2 X;  4M34 A;  1BCF A;  4KVS A;  4PG1 A;  4E6K A;  1RCI A;  3F37 A;  1RYT A;  1DVB A;  1JI5 A;  4ZL6 A;  2ZG8 X;  1DAT A;  2CLB A;  3FVB A;  1JGC A;  5ERK A;  2VXX A;  3R2L A;  4LYU A;  2GYQ A;  3PVT B;  2WTL A;  4TOG A;  3PWQ A;  1XZ3 A;  2Y3Q A;  1Z4A A;  5D8X A;  3F35 A;  4IXK A;  1JKV A;  1NNQ A;  5D8O A;  3Q4O A;  3IQ1 A;  3PW8 C;  3ERZ A;  3PZA A;  1TK6 A;  1S2Z A;  4DZ0 A;  5FFC A;  3RGD A;  3E1O A;  3H7G A;  1BFR A;  1JIG A;  4IWJ A;  3PVY B;  3E6R A;  4RC6 B;  3PVT A;  3QHB A;  1RCC A;  4TOH A;  3PW8 A;  5J8S A;  3R2K A;  1BG7 A;  4RC7 B;  4EVB A;  2XJM A;  1ZS3 A;  3QD8 A;  2Z5P A;  2V2R A;  4ZKW A;  3OJ5 A;  1N1Q A;  5AXS A;  4TOA A;  4LYX A;  3MPS A;  3F33 A;  2GYD A;  1TKO A;  3WVU A;  1S30 A;  3SH6 A;  2JD7 0;  5E2D A;  4Z5S A;  4TOB A;  2FG8 A;  5FFD A;  3ISE A;  3A68 A;  3R2H A;  4TOC A;  2V2L A;  3E1L A;  4ZMC A;  3UOF A;  2HTN A;  2FZF A;  5LG2 A;  4CMY A;  1LKM A;  3ES3 A;  3QZ3 A;  3F32 A;  2C2J A;  4DE6 A;  4DYU A;  4CVS A;  1LB3 A;  1UMN A;  3BT5 A;  2ITB A;  1UVH A;  3F34 A;  3IS7 A;  2HR5 A;  4Y08 A;  4A25 A;  4ML5 A;  1YUX A;  2PYB A;  3KWO A;  3KA4 A;  2CLU A;  4R42 A;  2X17 0;  1VJX A;  4EVE A;  5FFB A;  2C41 A;  5FFE A;  1O9I A;  3PW1 B;  3HIU A;  3RAV A;  4CYA A;  2ZA8 A;  1OTK A;  4ZTT A;  2CEI A;  3BVI A;  5D8Q A; 
#chains in the Genus database with same CATH topology
 5J93 A;  2ZG7 X;  3BKN A;  2G4H A;  1O9R A;  3T9J A;  1GWG A;  3C1Y A;  2V8U A;  3C23 A;  2ZUR X;  1R03 A;  2Y44 A;  5GN8 A;  2BKC A;  3Q4N A;  5HJH A;  3PW1 A;  4EVC A;  3E1N A;  4TOE A;  3ISF A;  1NFV A;  1H96 A;  2CWL A;  1Z6O A;  2CHI A;  2GS4 A;  5FEJ A;  1EUM A;  4DYZ A;  3FI6 A;  5JKL G;  5JKM A;  5LBH A;  2JD8 0;  1SQ3 A;  5E1U A;  2RBD A;  4ZKX A;  1SOF A;  2FKZ A;  3HL1 A;  3GHQ A;  2V2S A;  2OH3 A;  2CHP A;  2FL0 A;  3O7S A;  4ZLW A;  4DYX A;  5JDO B;  3KX9 A;  4ITW A;  3UOI A;  3PWF A;  4QUW A;  3F38 A;  4LPJ A;  1JYB A;  5GOU A;  3EZ0 A;  1JTS A;  3GVY A;  2ZG9 X;  3AJO A;  3E2C A;  4ZKH A;  3FRR A;  4ZJK A;  5K53 A;  3BVK A;  3SID A;  2V2J A;  1RCG A;  2V2P A;  5D8Y A;  4M35 A;  5ERJ A;  2XKQ A;  3RD0 A;  4DAS A;  2Z5R A;  4CVR A;  4U3G A;  5JAC A;  5GU0 X;  5JDO A;  3O7R A;  2F7N A;  5CMR A;  3KA6 A;  1LKO A;  3E6S A;  4PG0 A;  1J30 A;  2OC5 A;  1Z6O M;  4LPM A;  4E40 A;  4AM4 A;  4TO9 A;  3E1P A;  2XGW A;  3QHC A;  2IU2 A;  4ERU A;  2C2F A;  2IY4 A;  5C6F A;  4CYB A;  3NP2 X;  4CVP A;  4W4K B;  5D8S A;  1MOJ A;  3C1Z A;  3PVR A;  3F36 A;  3AJP A;  3GGZ A;  2FFX J;  4MJY A;  3OGH A;  5D8P A;  3E1M A;  2YW7 A;  4RC5 B;  5FFA A;  2Z5Q A;  2XJN A;  2WLA A;  1FHA A;  4ITT A;  4AM5 A;  1TKP A;  4KVR A;  1NF4 A;  2Z90 A;  4ZL5 A;  5GN8 B;  1DPS A;  5LS9 A;  3KA9 A;  3BVL A;  1ZUJ A;  3AF7 X;  2YW6 A;  1JKU A;  4XKS A;  2V2O A;  3M6J A;  4CMY V;  5IX6 A;  3WNW A;  4ETR A;  1JRE A;  4MN9 A;  4PGI A;  1VEL A;  3FSE A;  4KVQ A;  4M33 A;  4P18 A;  3AF9 X;  1L8H A;  3R2M A;  4IWK A;  4RC5 A;  1VEQ A;  3KA3 A;  2XJO A;  3EZU A;  3R2S A;  1AEW A;  1RCD A;  5D8R A;  1VLG A;  3Q4Q A;  2C6R A;  3AK9 A;  4XGS A;  3KHK A;  4DYY A;  3GGY A;  1B71 A;  4LPN A;  1MFR A;  2V15 A;  3AK8 A;  3Q4R A;  3QB9 A;  3SHX A;  1NF6 A;  1LKP A;  3PWQ C;  1F33 A;  2VZB A;  2QQY A;  2YJJ A;  3GE4 A;  5K52 A;  2UX1 A;  1YV1 A;  5HJF A;  3NP0 X;  2BJY A;  5CMQ A;  3LKD A;  4MY7 A;  3IS8 A;  3QVD A;  5CZU A;  1QYB A;  5GU1 X;  3SE1 A;  3VVA A;  1S3Q A;  2BK6 A;  4EVD A;  3F39 A;  2OKC A;  4REU A;  1KRQ A;  3D19 A;  4TOF A;  3A9Q A;  3WVV A;  4TOD A;  2CN7 A;  3UNO A;  4PGK A;  5HQO A;  3BVE A;  3KA8 A;  4II4 B;  5J9V A;  3PVR B;  4X0J A;  4M32 A;  3W54 A;  4MUD A;  3WVW A;  2VXI A;  1XZ1 A;  4ISM A;  3E1J A;  3R2R A;  2QF9 A;  4MKU A;  2WLU A;  3EGM A;  4DI0 A;  2V2M A;  1L8I A;  2FHA A;  3PVY A;  4RC6 A;  5LG8 A;  2V2I A;  2CN6 A;  5JKM G;  1F30 A;  2IB0 A;  2D5K A;  4Z3B A;  4RC7 A;  5GU3 X;  4II4 A;  2V2N A;  1YUZ A;  2JD6 0;  1RCE A;  2ZA6 A;  3AF8 X;  4CY9 A;  4ISP A;  2C2U A;  1IES A;  4LQJ A;  3KXU A;  4LQN A;  1HRS A;  2W0O A;  4AM2 A;  3RE7 A;  1TJO A;  3R2O A;  3E1Q A;  5J8W A;  4TW3 A;  3BVF A;  5JKL A;  4YXJ A;  1QGH A;  3VNX A;  3TA8 A;  3AJQ A;  2FG4 A;  2FJC A;  3U90 A;  2ZA7 A;  2CF7 A;  2YJK A;  4OYN A;  4YKH A;  2WWX B;  4CVT A;  2Z6M A;  3NOZ X;  4XKU A;  4RC8 A;  4KXR B;  1VEI A;  1JI4 A;  2BW1 A;  2MGY A;  4XKT A;  2CIH A;  4LQH A;  4LQV A;  5I4J A;  1IER A;  3RBC A;  5GU2 X;  4W4L B;  4M34 A;  1BCF A;  4KVS A;  4PG1 A;  4E6K A;  1RCI A;  3F37 A;  1RYT A;  1DVB A;  1JI5 A;  4ZL6 A;  2ZG8 X;  1DAT A;  2CLB A;  3FVB A;  1JGC A;  5ERK A;  2VXX A;  3R2L A;  4LYU A;  3C21 A;  2GYQ A;  3PVT B;  2WTL A;  4TOG A;  3PWQ A;  1XZ3 A;  2Y3Q A;  3JZ9 A;  1Z4A A;  5D8X A;  3F35 A;  4IXK A;  1JKV A;  1NNQ A;  5D8O A;  3Q4O A;  3IQ1 A;  3PW8 C;  2AR0 A;  3ERZ A;  3PZA A;  1TK6 A;  1S2Z A;  4YXM A;  4DZ0 A;  5FFC A;  3RGD A;  3E1O A;  3H7G A;  1BFR A;  4WJG 4;  1JIG A;  4IWJ A;  4MXP A;  3PVY B;  3E6R A;  4RC6 B;  3PVT A;  3QHB A;  1RCC A;  4TOH A;  3PW8 A;  5J8S A;  3R2K A;  1BG7 A;  4RC7 B;  4EVB A;  2XJM A;  1ZS3 A;  3QD8 A;  2Z5P A;  2V2R A;  4ZKW A;  3OJ5 A;  1N1Q A;  5AXS A;  4TOA A;  4LYX A;  3MPS A;  3F33 A;  2GYD A;  1TKO A;  3WVU A;  1S30 A;  3SH6 A;  2JD7 0;  5E2D A;  4Z5S A;  4TOB A;  2FG8 A;  2V8T A;  5FFD A;  3ISE A;  3UFB A;  3A68 A;  3R2H A;  4TOC A;  2V2L A;  3E1L A;  3JZA B;  4ZMC A;  3UOF A;  2HTN A;  2FZF A;  5LG2 A;  5HU6 D;  4CMY A;  1LKM A;  3ES3 A;  3QZ3 A;  3F32 A;  2C2J A;  4DE6 A;  4DYU A;  2N02 A;  4CVS A;  1LB3 A;  1UMN A;  3BT5 A;  2ITB A;  3N6O A;  1UVH A;  3F34 A;  3IS7 A;  3DBY A;  2HR5 A;  4Y08 A;  4YVZ A;  4A25 A;  4ML5 A;  1YUX A;  2PYB A;  3KWO A;  3KA4 A;  2CLU A;  4R42 A;  2X17 0;  1VJX A;  3V3K B;  4EVE A;  3FRS A;  3L0M A;  2G38 B;  5FFB A;  3KDQ A;  2C41 A;  5FFE A;  1O9I A;  3PW1 B;  3HIU A;  3RAV A;  4CYA A;  2ZA8 A;  1OTK A;  4ZTT A;  2CEI A;  3VV9 A;  3BVI A;  5D8Q A; 
#chains in the Genus database with same CATH homology
 5J93 A;  2ZG7 X;  3BKN A;  2G4H A;  1O9R A;  3T9J A;  1GWG A;  3C1Y A;  2V8U A;  3C23 A;  2ZUR X;  1R03 A;  2Y44 A;  5GN8 A;  2BKC A;  3Q4N A;  5HJH A;  3PW1 A;  4EVC A;  3E1N A;  4TOE A;  3ISF A;  1NFV A;  1H96 A;  2CWL A;  1Z6O A;  2CHI A;  2GS4 A;  5FEJ A;  1EUM A;  4DYZ A;  3FI6 A;  5JKL G;  5JKM A;  5LBH A;  2JD8 0;  1SQ3 A;  5E1U A;  2RBD A;  4ZKX A;  1SOF A;  2FKZ A;  3HL1 A;  3GHQ A;  2V2S A;  2OH3 A;  2CHP A;  2FL0 A;  3O7S A;  4ZLW A;  4DYX A;  5JDO B;  3KX9 A;  4ITW A;  3UOI A;  3PWF A;  4QUW A;  3F38 A;  4LPJ A;  1JYB A;  5GOU A;  3EZ0 A;  1JTS A;  3GVY A;  2ZG9 X;  3AJO A;  3E2C A;  4ZKH A;  3FRR A;  4ZJK A;  5K53 A;  3BVK A;  3SID A;  2V2J A;  1RCG A;  2V2P A;  5D8Y A;  4M35 A;  5ERJ A;  2XKQ A;  3RD0 A;  4DAS A;  2Z5R A;  4CVR A;  4U3G A;  5JAC A;  5GU0 X;  5JDO A;  3O7R A;  2F7N A;  5CMR A;  3KA6 A;  1LKO A;  3E6S A;  4PG0 A;  1J30 A;  2OC5 A;  1Z6O M;  4LPM A;  4E40 A;  4AM4 A;  4TO9 A;  3E1P A;  2XGW A;  3QHC A;  2IU2 A;  4ERU A;  2C2F A;  2IY4 A;  5C6F A;  4CYB A;  3NP2 X;  4CVP A;  4W4K B;  5D8S A;  1MOJ A;  3C1Z A;  3PVR A;  3F36 A;  3AJP A;  3GGZ A;  2FFX J;  4MJY A;  3OGH A;  5D8P A;  3E1M A;  2YW7 A;  4RC5 B;  5FFA A;  2Z5Q A;  2XJN A;  2WLA A;  1FHA A;  4ITT A;  4AM5 A;  1TKP A;  4KVR A;  1NF4 A;  2Z90 A;  4ZL5 A;  5GN8 B;  1DPS A;  5LS9 A;  3KA9 A;  3BVL A;  1ZUJ A;  3AF7 X;  2YW6 A;  1JKU A;  4XKS A;  2V2O A;  3M6J A;  4CMY V;  5IX6 A;  3WNW A;  4ETR A;  1JRE A;  4MN9 A;  4PGI A;  1VEL A;  3FSE A;  4KVQ A;  4M33 A;  4P18 A;  3AF9 X;  1L8H A;  3R2M A;  4IWK A;  4RC5 A;  1VEQ A;  3KA3 A;  2XJO A;  3EZU A;  3R2S A;  1AEW A;  1RCD A;  5D8R A;  1VLG A;  3Q4Q A;  2C6R A;  3AK9 A;  4XGS A;  3KHK A;  4DYY A;  3GGY A;  1B71 A;  4LPN A;  1MFR A;  2V15 A;  3AK8 A;  3Q4R A;  3QB9 A;  3SHX A;  1NF6 A;  1LKP A;  3PWQ C;  1F33 A;  2VZB A;  2QQY A;  2YJJ A;  3GE4 A;  5K52 A;  2UX1 A;  1YV1 A;  5HJF A;  3NP0 X;  2BJY A;  5CMQ A;  3LKD A;  4MY7 A;  3IS8 A;  3QVD A;  5CZU A;  1QYB A;  5GU1 X;  3SE1 A;  3VVA A;  1S3Q A;  2BK6 A;  4EVD A;  3F39 A;  2OKC A;  4REU A;  1KRQ A;  3D19 A;  4TOF A;  3A9Q A;  3WVV A;  4TOD A;  2CN7 A;  3UNO A;  4PGK A;  5HQO A;  3BVE A;  3KA8 A;  4II4 B;  5J9V A;  3PVR B;  4X0J A;  4M32 A;  3W54 A;  4MUD A;  3WVW A;  2VXI A;  1XZ1 A;  4ISM A;  3E1J A;  3R2R A;  2QF9 A;  4MKU A;  2WLU A;  3EGM A;  4DI0 A;  2V2M A;  1L8I A;  2FHA A;  3PVY A;  4RC6 A;  5LG8 A;  2V2I A;  2CN6 A;  5JKM G;  1F30 A;  2IB0 A;  2D5K A;  4Z3B A;  4RC7 A;  5GU3 X;  4II4 A;  2V2N A;  1YUZ A;  2JD6 0;  1RCE A;  2ZA6 A;  3AF8 X;  4CY9 A;  4ISP A;  2C2U A;  1IES A;  4LQJ A;  3KXU A;  4LQN A;  1HRS A;  2W0O A;  4AM2 A;  3RE7 A;  1TJO A;  3R2O A;  3E1Q A;  5J8W A;  4TW3 A;  3BVF A;  5JKL A;  4YXJ A;  1QGH A;  3VNX A;  3TA8 A;  3AJQ A;  2FG4 A;  2FJC A;  3U90 A;  2ZA7 A;  2CF7 A;  2YJK A;  4OYN A;  4YKH A;  2WWX B;  4CVT A;  2Z6M A;  3NOZ X;  4XKU A;  4RC8 A;  4KXR B;  1VEI A;  1JI4 A;  2BW1 A;  2MGY A;  4XKT A;  2CIH A;  4LQH A;  4LQV A;  5I4J A;  1IER A;  3RBC A;  5GU2 X;  4W4L B;  4M34 A;  1BCF A;  4KVS A;  4PG1 A;  4E6K A;  1RCI A;  3F37 A;  1RYT A;  1DVB A;  1JI5 A;  4ZL6 A;  2ZG8 X;  1DAT A;  2CLB A;  3FVB A;  1JGC A;  5ERK A;  2VXX A;  3R2L A;  4LYU A;  3C21 A;  2GYQ A;  3PVT B;  2WTL A;  4TOG A;  3PWQ A;  1XZ3 A;  2Y3Q A;  3JZ9 A;  1Z4A A;  5D8X A;  3F35 A;  4IXK A;  1JKV A;  1NNQ A;  5D8O A;  3Q4O A;  3IQ1 A;  3PW8 C;  2AR0 A;  3ERZ A;  3PZA A;  1TK6 A;  1S2Z A;  4YXM A;  4DZ0 A;  5FFC A;  3RGD A;  3E1O A;  3H7G A;  1BFR A;  4WJG 4;  1JIG A;  4IWJ A;  4MXP A;  3PVY B;  3E6R A;  4RC6 B;  3PVT A;  3QHB A;  1RCC A;  4TOH A;  3PW8 A;  5J8S A;  3R2K A;  1BG7 A;  4RC7 B;  4EVB A;  2XJM A;  1ZS3 A;  3QD8 A;  2Z5P A;  2V2R A;  4ZKW A;  3OJ5 A;  1N1Q A;  5AXS A;  4TOA A;  4LYX A;  3MPS A;  3F33 A;  2GYD A;  1TKO A;  3WVU A;  1S30 A;  3SH6 A;  2JD7 0;  5E2D A;  4Z5S A;  4TOB A;  2FG8 A;  2V8T A;  5FFD A;  3ISE A;  3UFB A;  3A68 A;  3R2H A;  4TOC A;  2V2L A;  3E1L A;  3JZA B;  4ZMC A;  3UOF A;  2HTN A;  2FZF A;  5LG2 A;  5HU6 D;  4CMY A;  1LKM A;  3ES3 A;  3QZ3 A;  3F32 A;  2C2J A;  4DE6 A;  4DYU A;  2N02 A;  4CVS A;  1LB3 A;  1UMN A;  3BT5 A;  2ITB A;  3N6O A;  1UVH A;  3F34 A;  3IS7 A;  3DBY A;  2HR5 A;  4Y08 A;  4YVZ A;  4A25 A;  4ML5 A;  1YUX A;  2PYB A;  3KWO A;  3KA4 A;  2CLU A;  4R42 A;  2X17 0;  1VJX A;  3V3K B;  4EVE A;  3FRS A;  3L0M A;  2G38 B;  5FFB A;  3KDQ A;  2C41 A;  5FFE A;  1O9I A;  3PW1 B;  3HIU A;  3RAV A;  4CYA A;  2ZA8 A;  1OTK A;  4ZTT A;  2CEI A;  3VV9 A;  3BVI A;  5D8Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...