2HTNA

E. coli bacterioferritin in its as-isolated form
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
158
structure length
158
Chain Sequence
MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDWLETELDLIQKMGLQNYLQAQIREEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterioferritin
publication title Fortuitous structure determination of 'as-isolated' Escherichia coli bacterioferritin in a novel crystal form.
pubmed doi rcsb
molecule tags Metal binding protein, oxidoreductase
total genus 71
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2006-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2htnA00
2ZURX 3QHCA 4R42A 4ZLWA 5GU1X 3F35A 2X170 2XJNA 1JREA 4MKUA 3KX9A 3U90A 4RC6B 1TK6A 5GU2X 2Y3QA 1L8HA 1RCEA 1S2ZA 1JKVA 3QHBA 4TOBA 4CMYV 3PVRA 5FFAA 3AJPA 2FL0A 5E1UA 4EVCA 3SIDA 5LBHA 3RAVA 2CLBA 3E6SA 3QB9A 1QGHA 4ZKHA 5HJHA 4II4A 2XJMA 3PW8C 3KA8A 1O9RA 4DE6A 2FG8A 4Z3BA 3RE7A 5J8WA 2YW6A 3AK8A 1JIGA 3A9QA 1QYBA 1JYBA 4DI0A 4ML5A 1YV1A 3WVUA 2CF7A 3AK9A 3AJOA 3PZAA 1BFRA 3ES3A 3UNOA 2V2JA 1Z6OM 4CVRA 5CZUA 1KRQA 3GE4A 1VEIA 4PG0A 3NOZX 4ZL5A 5HJFA 3BVLA 4PG1A 3R2HA 3R2RA 2OH3A 3E1PA 5D8YA 1L8IA 5J9VA 1IERA 4ERUA 4Y08A 4RC7A 2CN6A 5GN8A 2ZG9X 4QUWA 3HL1A 4TODA 4ISMA 3WNWA 1RCIA 4TW3A 2F7NA 3AJQA 1RCCA 5K53A 3NP2X 3Q4NA 5JKMA 1EUMA 2WLUA 3E1MA 1VLGA 5FEJA 5FFDA 5JKMG 4RC5B 2CEIA 4AM5A 4TO9A 1N1QA 3E6RA 3ISEA 3WVWA 2FZFA 2V15A 3GVYA 1XZ3A 5I4JA 3SHXA 4DYZA 4RC6A 4TOAA 2V2MA 2YJKA 2WLAA 1IESA 2CLUA 3PWQA 4AM2A 4TOGA 2XJOA 2GS4A 5JKLG 4IXKA 1MFRA 3PVTB 1LB3A 5GU3X 3E2CA 2V2IA 5J8SA 1S3QA 1VEQA 2FFXJ 3IS8A 2RBDA 4XKUA 3KA4A 3R2LA 4LQHA 2Z5RA 3F32A 3SH6A 1NNQA 2ITBA 1F30A 1GWGA 4CVSA 5GOUA 2Z5PA 3PW1B 1XZ1A 2HR5A 4TOFA 4AM4A 3FVBA 4CVPA 2V2NA 4LPNA 5FFEA 1TJOA 2QF9A 3R2OA 2C2JA 3F38A 3BVFA 2V2SA 5K52A 2BJYA 5E2DA 3Q4OA 4PGKA 4REUA 2CHPA 3EGMA 5HQOA 5J93A 2C41A 4ISPA 4DZ0A 5D8XA 3F34A 3Q4QA 3AF8X 1UMNA 4CYBA 5ERKA 3NP0X 1RCDA 3O7RA 4DYUA 1NFVA 3PW8A 4M33A 4RC8A 4XKSA 3HIUA 2W0OA 4ITTA 1JI5A 4RC5A 1NF4A 4IWJA 3UOIA 2Z90A 5D8QA 2YW7A 3UOFA 3IS7A 3SE1A 1RYTA 4PGIA 4EVEA 1O9IA 3MPSA 5C6FA 2D5KA 4ZKWA 3F33A 3GHQA 3QVDA 1J30A 4M35A 4M32A 3FSEA 2FG4A 3PWFA 3VNXA 2CN7A 2C2FA 3PVTA 4KVSA 5D8PA 5LG8A 3PVYB 2V2LA 5ERJA 2VXXA 4ITWA 3BVEA 2IU2A 5LG2A 2JD70 1H96A 3F39A 2YJJA 4YKHA 1DATA 4LPJA 4DASA 2Z6MA 1NF6A 2FJCA 2UX1A 3KA6A 2GYQA 2XGWA 3PW1A 3T9JA 3RGDA 4M34A 4MUDA 2ZA7A 4ZL6A 1FHAA 1S30A 3OGHA 2JD80 4TOHA 4CMYA 2PYBA 5FFBA 5LS9A 4XKTA 4ETRA 5IX6A 3A68A 3BVKA 2FHAA 2G4HA 3R2MA 3KWOA 3R2SA 4XGSA 3O7SA 4TOEA 2BKCA 1DPSA 3RBCA 4MN9A 1BG7A 2C2UA 3EZ0A 1TKPA 1DVBA 4LQJA 5AXSA 2ZG8X 4E6KA 4MJYA 4LYXA 2GYDA 4EVBA 1BCFA 4KVRA 4P18A 4LPMA 4TOCA 4DYXA 2WTLA 3QZ3A 2V2OA 1UVHA 3BT5A 1LKOA 4DYYA 2JD60 1SQ3A 5CMRA 3E1JA 3KA3A 1YUXA 2Z5QA 1RCGA 2IY4A 2ZG7X 1SOFA 4ZKXA 5CMQA 1OTKA 2OC5A 3PVRB 4CYAA 3TA8A 1ZUJA 3BVIA 3Q4RA 3KA9A 2C6RA 3F36A 4LQVA 1JTSA 2FKZA 3PVYA 1Z4AA 4KVQA 3E1OA 5GU0X 1B71A 3F37A 2CIHA 3E1NA 3R2KA 3ERZA 4II4B 4ZTTA 1VJXA 5JACA 3RD0A 1LKMA 4EVDA 1AEWA 1JGCA 3E1QA 3QD8A 4ZJKA 3WVVA 4LQNA 2V2PA 2IB0A 4ZMCA 4U3GA 2ZA6A 4CVTA 3ISFA 2XKQA 3BKNA 3H7GA 3E1LA 1JKUA 2VZBA 4Z5SA 4LYUA 1LKPA 1R03A 4CY9A 3PWQC 1ZS3A 2BW1A 1VELA 1TKOA 1JI4A 1HRSA 2ZA8A 1MOJA 3AF7X 2VXIA 1YUZA 2CHIA 4RC7B 5GN8B 4IWKA 4MY7A 2HTNA 5D8RA 1Z6OA 3EZUA 3OJ5A 1F33A 3AF9X 3FI6A 3IQ1A 3KXUA 2QQYA 5D8OA 2V2RA 5JKLA 2BK6A 4A25A 4OYNA 5D8SA 5FFCA
chains in the Genus database with same CATH superfamily
2ZURX 3QHCA 4R42A 4ZLWA 5GU1X 3F35A 2X170 2XJNA 1JREA 4MKUA 3KX9A 3U90A 4RC6B 1TK6A 5GU2X 2Y3QA 1L8HA 1RCEA 1S2ZA 1JKVA 3QHBA 4TOBA 4CMYV 2G38B 3PVRA 5FFAA 3AJPA 5JDOA 2FL0A 5E1UA 4EVCA 3SIDA 5LBHA 2V8TA 3RAVA 2CLBA 3E6SA 3QB9A 2CWLA 1QGHA 4MXPA 4ZKHA 4W4KB 5HJHA 4X0JA 4II4A 2XJMA 3PW8C 3KA8A 1O9RA 4DE6A 2FG8A 4Z3BA 3RE7A 5J8WA 2YW6A 3AK8A 1JIGA 3A9QA 1QYBA 1JYBA 3FRRA 4DI0A 4E40A 4ML5A 1YV1A 3WVUA 2CF7A 3AK9A 3AJOA 3JZAB 3PZAA 1BFRA 3ES3A 3UNOA 2V2JA 2WWXB 1Z6OM 3LKDA 4CVRA 5CZUA 2MGYA 1KRQA 3GE4A 1VEIA 4PG0A 3NOZX 4ZL5A 5HJFA 3BVLA 4PG1A 3R2HA 3R2RA 2OH3A 3E1PA 5D8YA 1L8IA 5J9VA 1IERA 4ERUA 4Y08A 4RC7A 2CN6A 5GN8A 2ZG9X 4QUWA 3HL1A 4TODA 4ISMA 3C23A 3WNWA 1RCIA 4TW3A 2F7NA 3AJQA 1RCCA 5K53A 3NP2X 3Q4NA 5JKMA 1EUMA 2WLUA 3E1MA 1VLGA 3FRSA 5FEJA 5FFDA 5JKMG 4RC5B 2CEIA 4AM5A 4TO9A 1N1QA 3C1YA 3E6RA 3KDQA 3ISEA 3WVWA 2FZFA 2V15A 3GVYA 1XZ3A 5I4JA 3SHXA 4DYZA 4RC6A 4TOAA 2V2MA 2YJKA 2WLAA 1IESA 2CLUA 2V8UA 3PWQA 4AM2A 4TOGA 2XJOA 2GS4A 5JKLG 4IXKA 1MFRA 2OKCA 3PVTB 1LB3A 4YXJA 4KXRB 5GU3X 3E2CA 2Y44A 2V2IA 5J8SA 1S3QA 1VEQA 3UFBA 2FFXJ 3IS8A 2RBDA 4XKUA 3KA4A 3R2LA 4LQHA 2Z5RA 3F32A 3SH6A 1NNQA 2ITBA 1F30A 1GWGA 4CVSA 5GOUA 2Z5PA 3PW1B 3L0MA 1XZ1A 2HR5A 3DBYA 4TOFA 4AM4A 3FVBA 4CVPA 2V2NA 4LPNA 5FFEA 1TJOA 2QF9A 3R2OA 2C2JA 3F38A 3BVFA 2V2SA 5K52A 2BJYA 2N02A 5E2DA 3Q4OA 4PGKA 4REUA 2CHPA 3EGMA 5HQOA 3W54A 5J93A 3KHKA 2C41A 4ISPA 4DZ0A 5D8XA 3F34A 3Q4QA 3AF8X 1UMNA 4CYBA 4WJG4 5ERKA 3NP0X 1RCDA 3O7RA 4DYUA 1NFVA 3PW8A 4M33A 4RC8A 4XKSA 3HIUA 2W0OA 4ITTA 3C21A 5HU6D 1JI5A 4RC5A 1NF4A 4IWJA 3UOIA 2Z90A 5D8QA 2YW7A 3UOFA 3IS7A 3SE1A 1RYTA 4PGIA 4EVEA 1O9IA 3MPSA 5C6FA 2D5KA 4ZKWA 3F33A 3GHQA 3QVDA 1J30A 4M35A 4M32A 3FSEA 2FG4A 3PWFA 3VNXA 2CN7A 2C2FA 3PVTA 4KVSA 5D8PA 5LG8A 3PVYB 2V2LA 5ERJA 2VXXA 4ITWA 3BVEA 2IU2A 5LG2A 2JD70 1H96A 3F39A 2YJJA 4YKHA 1DATA 4LPJA 3N6OA 2Z6MA 4DASA 1NF6A 2FJCA 2UX1A 3KA6A 2GYQA 2XGWA 3PW1A 4W4LB 3T9JA 3C1ZA 3RGDA 4M34A 4MUDA 2ZA7A 4ZL6A 1FHAA 1S30A 3OGHA 2JD80 4TOHA 4CMYA 2PYBA 5FFBA 5LS9A 4XKTA 4ETRA 5IX6A 3A68A 3BVKA 2FHAA 2G4HA 3R2MA 3KWOA 3R2SA 4XGSA 3O7SA 4TOEA 2BKCA 1DPSA 3RBCA 4MN9A 1BG7A 2C2UA 3EZ0A 1TKPA 1DVBA 4LQJA 5AXSA 2ZG8X 3M6JA 4E6KA 4MJYA 4LYXA 2GYDA 4EVBA 1BCFA 4KVRA 3V3KB 4P18A 4LPMA 4TOCA 4DYXA 2WTLA 3QZ3A 2V2OA 1UVHA 3BT5A 1LKOA 4DYYA 2JD60 1SQ3A 3GGZA 5CMRA 3E1JA 3KA3A 1YUXA 2Z5QA 1RCGA 2IY4A 2ZG7X 1SOFA 4ZKXA 5CMQA 1OTKA 2OC5A 3PVRB 3VVAA 4CYAA 5JDOB 3TA8A 1ZUJA 3BVIA 3Q4RA 3KA9A 2C6RA 3F36A 4LQVA 1JTSA 2FKZA 3PVYA 1Z4AA 4KVQA 3E1OA 5GU0X 1B71A 3F37A 2CIHA 3E1NA 2AR0A 3R2KA 3ERZA 4II4B 4ZTTA 1VJXA 5JACA 3RD0A 4YVZA 3JZ9A 1LKMA 4EVDA 1AEWA 1JGCA 3E1QA 3QD8A 3VV9A 4ZJKA 3WVVA 4LQNA 2V2PA 2IB0A 4ZMCA 3D19A 4U3GA 2ZA6A 4CVTA 3ISFA 2XKQA 3BKNA 3H7GA 3E1LA 1JKUA 2VZBA 4Z5SA 4LYUA 1LKPA 1R03A 4CY9A 3PWQC 1ZS3A 2BW1A 1VELA 1TKOA 1JI4A 3GGYA 1HRSA 2ZA8A 1MOJA 3AF7X 2VXIA 1YUZA 2CHIA 4RC7B 5GN8B 4IWKA 4YXMA 4MY7A 2HTNA 5D8RA 1Z6OA 3EZUA 3OJ5A 1F33A 3AF9X 3FI6A 3IQ1A 3KXUA 2QQYA 5D8OA 2V2RA 5JKLA 2BK6A 4A25A 4OYNA 5D8SA 5FFCA
chains in the Genus database with same CATH topology
2ZURX 3QHCA 4R42A 4ZLWA 5GU1X 3F35A 2X170 2XJNA 1JREA 4MKUA 3KX9A 3U90A 4RC6B 1TK6A 5GU2X 2Y3QA 1L8HA 1RCEA 1S2ZA 1JKVA 3QHBA 4TOBA 4CMYV 2G38B 3PVRA 5FFAA 3AJPA 5JDOA 2FL0A 5E1UA 4EVCA 3SIDA 5LBHA 2V8TA 3RAVA 2CLBA 3E6SA 3QB9A 2CWLA 1QGHA 4MXPA 4ZKHA 4W4KB 5HJHA 4X0JA 4II4A 2XJMA 3PW8C 3KA8A 1O9RA 4DE6A 2FG8A 4Z3BA 3RE7A 5J8WA 2YW6A 3AK8A 1JIGA 3A9QA 1QYBA 1JYBA 3FRRA 4DI0A 4E40A 4ML5A 1YV1A 3WVUA 2CF7A 3AK9A 3AJOA 3JZAB 3PZAA 1BFRA 3ES3A 3UNOA 2V2JA 2WWXB 1Z6OM 3LKDA 4CVRA 5CZUA 2MGYA 1KRQA 3GE4A 1VEIA 4PG0A 3NOZX 4ZL5A 5HJFA 3BVLA 4PG1A 3R2HA 3R2RA 2OH3A 3E1PA 5D8YA 1L8IA 5J9VA 1IERA 4ERUA 4Y08A 4RC7A 2CN6A 5GN8A 2ZG9X 4QUWA 3HL1A 4TODA 4ISMA 3C23A 3WNWA 1RCIA 4TW3A 2F7NA 3AJQA 1RCCA 5K53A 3NP2X 3Q4NA 5JKMA 1EUMA 2WLUA 3E1MA 1VLGA 3FRSA 5FEJA 5FFDA 5JKMG 4RC5B 2CEIA 4AM5A 4TO9A 1N1QA 3C1YA 3E6RA 3KDQA 3ISEA 3WVWA 2FZFA 2V15A 3GVYA 1XZ3A 5I4JA 3SHXA 4DYZA 4RC6A 4TOAA 2V2MA 2YJKA 2WLAA 1IESA 2CLUA 2V8UA 3PWQA 4AM2A 4TOGA 2XJOA 2GS4A 5JKLG 4IXKA 1MFRA 2OKCA 3PVTB 1LB3A 4YXJA 4KXRB 5GU3X 3E2CA 2Y44A 2V2IA 5J8SA 1S3QA 1VEQA 3UFBA 2FFXJ 3IS8A 2RBDA 4XKUA 3KA4A 3R2LA 4LQHA 2Z5RA 3F32A 3SH6A 1NNQA 2ITBA 1F30A 1GWGA 4CVSA 5GOUA 2Z5PA 3PW1B 3L0MA 1XZ1A 2HR5A 3DBYA 4TOFA 4AM4A 3FVBA 4CVPA 2V2NA 4LPNA 5FFEA 1TJOA 2QF9A 3R2OA 2C2JA 3F38A 3BVFA 2V2SA 5K52A 2BJYA 2N02A 5E2DA 3Q4OA 4PGKA 4REUA 2CHPA 3EGMA 5HQOA 3W54A 5J93A 3KHKA 2C41A 4ISPA 4DZ0A 5D8XA 3F34A 3Q4QA 3AF8X 1UMNA 4CYBA 4WJG4 5ERKA 3NP0X 1RCDA 3O7RA 4DYUA 1NFVA 3PW8A 4M33A 4RC8A 4XKSA 3HIUA 2W0OA 4ITTA 3C21A 5HU6D 1JI5A 4RC5A 1NF4A 4IWJA 3UOIA 2Z90A 5D8QA 2YW7A 3UOFA 3IS7A 3SE1A 1RYTA 4PGIA 4EVEA 1O9IA 3MPSA 5C6FA 2D5KA 4ZKWA 3F33A 3GHQA 3QVDA 1J30A 4M35A 4M32A 3FSEA 2FG4A 3PWFA 3VNXA 2CN7A 2C2FA 3PVTA 4KVSA 5D8PA 5LG8A 3PVYB 2V2LA 5ERJA 2VXXA 4ITWA 3BVEA 2IU2A 5LG2A 2JD70 1H96A 3F39A 2YJJA 4YKHA 1DATA 4LPJA 3N6OA 2Z6MA 4DASA 1NF6A 2FJCA 2UX1A 3KA6A 2GYQA 2XGWA 3PW1A 4W4LB 3T9JA 3C1ZA 3RGDA 4M34A 4MUDA 2ZA7A 4ZL6A 1FHAA 1S30A 3OGHA 2JD80 4TOHA 4CMYA 2PYBA 5FFBA 5LS9A 4XKTA 4ETRA 5IX6A 3A68A 3BVKA 2FHAA 2G4HA 3R2MA 3KWOA 3R2SA 4XGSA 3O7SA 4TOEA 2BKCA 1DPSA 3RBCA 4MN9A 1BG7A 2C2UA 3EZ0A 1TKPA 1DVBA 4LQJA 5AXSA 2ZG8X 3M6JA 4E6KA 4MJYA 4LYXA 2GYDA 4EVBA 1BCFA 4KVRA 3V3KB 4P18A 4LPMA 4TOCA 4DYXA 2WTLA 3QZ3A 2V2OA 1UVHA 3BT5A 1LKOA 4DYYA 2JD60 1SQ3A 3GGZA 5CMRA 3E1JA 3KA3A 1YUXA 2Z5QA 1RCGA 2IY4A 2ZG7X 1SOFA 4ZKXA 5CMQA 1OTKA 2OC5A 3PVRB 3VVAA 4CYAA 5JDOB 3TA8A 1ZUJA 3BVIA 3Q4RA 3KA9A 2C6RA 3F36A 4LQVA 1JTSA 2FKZA 3PVYA 1Z4AA 4KVQA 3E1OA 5GU0X 1B71A 3F37A 2CIHA 3E1NA 2AR0A 3R2KA 3ERZA 4II4B 4ZTTA 1VJXA 5JACA 3RD0A 4YVZA 3JZ9A 1LKMA 4EVDA 1AEWA 1JGCA 3E1QA 3QD8A 3VV9A 4ZJKA 3WVVA 4LQNA 2V2PA 2IB0A 4ZMCA 3D19A 4U3GA 2ZA6A 4CVTA 3ISFA 2XKQA 3BKNA 3H7GA 3E1LA 1JKUA 2VZBA 4Z5SA 4LYUA 1LKPA 1R03A 4CY9A 3PWQC 1ZS3A 2BW1A 1VELA 1TKOA 1JI4A 3GGYA 1HRSA 2ZA8A 1MOJA 3AF7X 2VXIA 1YUZA 2CHIA 4RC7B 5GN8B 4IWKA 4YXMA 4MY7A 2HTNA 5D8RA 1Z6OA 3EZUA 3OJ5A 1F33A 3AF9X 3FI6A 3IQ1A 3KXUA 2QQYA 5D8OA 2V2RA 5JKLA 2BK6A 4A25A 4OYNA 5D8SA 5FFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZUR X;  3QHC A;  4R42 A;  4ZLW A;  5GU1 X;  3F35 A;  2X17 0;  2XJN A;  1JRE A;  4MKU A;  3KX9 A;  3U90 A;  4RC6 B;  1TK6 A;  5GU2 X;  2Y3Q A;  1L8H A;  1RCE A;  1S2Z A;  1JKV A;  3QHB A;  4TOB A;  4CMY V;  3PVR A;  5FFA A;  3AJP A;  2FL0 A;  5E1U A;  4EVC A;  3SID A;  5LBH A;  3RAV A;  2CLB A;  3E6S A;  3QB9 A;  1QGH A;  4ZKH A;  5HJH A;  4II4 A;  2XJM A;  3PW8 C;  3KA8 A;  1O9R A;  4DE6 A;  2FG8 A;  4Z3B A;  3RE7 A;  5J8W A;  2YW6 A;  3AK8 A;  1JIG A;  3A9Q A;  1QYB A;  1JYB A;  4DI0 A;  4ML5 A;  1YV1 A;  3WVU A;  2CF7 A;  3AK9 A;  3AJO A;  3PZA A;  1BFR A;  3ES3 A;  3UNO A;  2V2J A;  1Z6O M;  4CVR A;  5CZU A;  1KRQ A;  3GE4 A;  1VEI A;  4PG0 A;  3NOZ X;  4ZL5 A;  5HJF A;  3BVL A;  4PG1 A;  3R2H A;  3R2R A;  2OH3 A;  3E1P A;  5D8Y A;  1L8I A;  5J9V A;  1IER A;  4ERU A;  4Y08 A;  4RC7 A;  2CN6 A;  5GN8 A;  2ZG9 X;  4QUW A;  3HL1 A;  4TOD A;  4ISM A;  3WNW A;  1RCI A;  4TW3 A;  2F7N A;  3AJQ A;  1RCC A;  5K53 A;  3NP2 X;  3Q4N A;  5JKM A;  1EUM A;  2WLU A;  3E1M A;  1VLG A;  5FEJ A;  5FFD A;  5JKM G;  4RC5 B;  2CEI A;  4AM5 A;  4TO9 A;  1N1Q A;  3E6R A;  3ISE A;  3WVW A;  2FZF A;  2V15 A;  3GVY A;  1XZ3 A;  5I4J A;  3SHX A;  4DYZ A;  4RC6 A;  4TOA A;  2V2M A;  2YJK A;  2WLA A;  1IES A;  2CLU A;  3PWQ A;  4AM2 A;  4TOG A;  2XJO A;  2GS4 A;  5JKL G;  4IXK A;  1MFR A;  3PVT B;  1LB3 A;  5GU3 X;  3E2C A;  2V2I A;  5J8S A;  1S3Q A;  1VEQ A;  2FFX J;  3IS8 A;  2RBD A;  4XKU A;  3KA4 A;  3R2L A;  4LQH A;  2Z5R A;  3F32 A;  3SH6 A;  1NNQ A;  2ITB A;  1F30 A;  1GWG A;  4CVS A;  5GOU A;  2Z5P A;  3PW1 B;  1XZ1 A;  2HR5 A;  4TOF A;  4AM4 A;  3FVB A;  4CVP A;  2V2N A;  4LPN A;  5FFE A;  1TJO A;  2QF9 A;  3R2O A;  2C2J A;  3F38 A;  3BVF A;  2V2S A;  5K52 A;  2BJY A;  5E2D A;  3Q4O A;  4PGK A;  4REU A;  2CHP A;  3EGM A;  5HQO A;  5J93 A;  2C41 A;  4ISP A;  4DZ0 A;  5D8X A;  3F34 A;  3Q4Q A;  3AF8 X;  1UMN A;  4CYB A;  5ERK A;  3NP0 X;  1RCD A;  3O7R A;  4DYU A;  1NFV A;  3PW8 A;  4M33 A;  4RC8 A;  4XKS A;  3HIU A;  2W0O A;  4ITT A;  1JI5 A;  4RC5 A;  1NF4 A;  4IWJ A;  3UOI A;  2Z90 A;  5D8Q A;  2YW7 A;  3UOF A;  3IS7 A;  3SE1 A;  1RYT A;  4PGI A;  4EVE A;  1O9I A;  3MPS A;  5C6F A;  2D5K A;  4ZKW A;  3F33 A;  3GHQ A;  3QVD A;  1J30 A;  4M35 A;  4M32 A;  3FSE A;  2FG4 A;  3PWF A;  3VNX A;  2CN7 A;  2C2F A;  3PVT A;  4KVS A;  5D8P A;  5LG8 A;  3PVY B;  2V2L A;  5ERJ A;  2VXX A;  4ITW A;  3BVE A;  2IU2 A;  5LG2 A;  2JD7 0;  1H96 A;  3F39 A;  2YJJ A;  4YKH A;  1DAT A;  4LPJ A;  4DAS A;  2Z6M A;  1NF6 A;  2FJC A;  2UX1 A;  3KA6 A;  2GYQ A;  2XGW A;  3PW1 A;  3T9J A;  3RGD A;  4M34 A;  4MUD A;  2ZA7 A;  4ZL6 A;  1FHA A;  1S30 A;  3OGH A;  2JD8 0;  4TOH A;  4CMY A;  2PYB A;  5FFB A;  5LS9 A;  4XKT A;  4ETR A;  5IX6 A;  3A68 A;  3BVK A;  2FHA A;  2G4H A;  3R2M A;  3KWO A;  3R2S A;  4XGS A;  3O7S A;  4TOE A;  2BKC A;  1DPS A;  3RBC A;  4MN9 A;  1BG7 A;  2C2U A;  3EZ0 A;  1TKP A;  1DVB A;  4LQJ A;  5AXS A;  2ZG8 X;  4E6K A;  4MJY A;  4LYX A;  2GYD A;  4EVB A;  1BCF A;  4KVR A;  4P18 A;  4LPM A;  4TOC A;  4DYX A;  2WTL A;  3QZ3 A;  2V2O A;  1UVH A;  3BT5 A;  1LKO A;  4DYY A;  2JD6 0;  1SQ3 A;  5CMR A;  3E1J A;  3KA3 A;  1YUX A;  2Z5Q A;  1RCG A;  2IY4 A;  2ZG7 X;  1SOF A;  4ZKX A;  5CMQ A;  1OTK A;  2OC5 A;  3PVR B;  4CYA A;  3TA8 A;  1ZUJ A;  3BVI A;  3Q4R A;  3KA9 A;  2C6R A;  3F36 A;  4LQV A;  1JTS A;  2FKZ A;  3PVY A;  1Z4A A;  4KVQ A;  3E1O A;  5GU0 X;  1B71 A;  3F37 A;  2CIH A;  3E1N A;  3R2K A;  3ERZ A;  4II4 B;  4ZTT A;  1VJX A;  5JAC A;  3RD0 A;  1LKM A;  4EVD A;  1AEW A;  1JGC A;  3E1Q A;  3QD8 A;  4ZJK A;  3WVV A;  4LQN A;  2V2P A;  2IB0 A;  4ZMC A;  4U3G A;  2ZA6 A;  4CVT A;  3ISF A;  2XKQ A;  3BKN A;  3H7G A;  3E1L A;  1JKU A;  2VZB A;  4Z5S A;  4LYU A;  1LKP A;  1R03 A;  4CY9 A;  3PWQ C;  1ZS3 A;  2BW1 A;  1VEL A;  1TKO A;  1JI4 A;  1HRS A;  2ZA8 A;  1MOJ A;  3AF7 X;  2VXI A;  1YUZ A;  2CHI A;  4RC7 B;  5GN8 B;  4IWK A;  4MY7 A;  2HTN A;  5D8R A;  1Z6O A;  3EZU A;  3OJ5 A;  1F33 A;  3AF9 X;  3FI6 A;  3IQ1 A;  3KXU A;  2QQY A;  5D8O A;  2V2R A;  5JKL A;  2BK6 A;  4A25 A;  4OYN A;  5D8S A;  5FFC A; 
#chains in the Genus database with same CATH topology
 2ZUR X;  3QHC A;  4R42 A;  4ZLW A;  5GU1 X;  3F35 A;  2X17 0;  2XJN A;  1JRE A;  4MKU A;  3KX9 A;  3U90 A;  4RC6 B;  1TK6 A;  5GU2 X;  2Y3Q A;  1L8H A;  1RCE A;  1S2Z A;  1JKV A;  3QHB A;  4TOB A;  4CMY V;  2G38 B;  3PVR A;  5FFA A;  3AJP A;  5JDO A;  2FL0 A;  5E1U A;  4EVC A;  3SID A;  5LBH A;  2V8T A;  3RAV A;  2CLB A;  3E6S A;  3QB9 A;  2CWL A;  1QGH A;  4MXP A;  4ZKH A;  4W4K B;  5HJH A;  4X0J A;  4II4 A;  2XJM A;  3PW8 C;  3KA8 A;  1O9R A;  4DE6 A;  2FG8 A;  4Z3B A;  3RE7 A;  5J8W A;  2YW6 A;  3AK8 A;  1JIG A;  3A9Q A;  1QYB A;  1JYB A;  3FRR A;  4DI0 A;  4E40 A;  4ML5 A;  1YV1 A;  3WVU A;  2CF7 A;  3AK9 A;  3AJO A;  3JZA B;  3PZA A;  1BFR A;  3ES3 A;  3UNO A;  2V2J A;  2WWX B;  1Z6O M;  3LKD A;  4CVR A;  5CZU A;  2MGY A;  1KRQ A;  3GE4 A;  1VEI A;  4PG0 A;  3NOZ X;  4ZL5 A;  5HJF A;  3BVL A;  4PG1 A;  3R2H A;  3R2R A;  2OH3 A;  3E1P A;  5D8Y A;  1L8I A;  5J9V A;  1IER A;  4ERU A;  4Y08 A;  4RC7 A;  2CN6 A;  5GN8 A;  2ZG9 X;  4QUW A;  3HL1 A;  4TOD A;  4ISM A;  3C23 A;  3WNW A;  1RCI A;  4TW3 A;  2F7N A;  3AJQ A;  1RCC A;  5K53 A;  3NP2 X;  3Q4N A;  5JKM A;  1EUM A;  2WLU A;  3E1M A;  1VLG A;  3FRS A;  5FEJ A;  5FFD A;  5JKM G;  4RC5 B;  2CEI A;  4AM5 A;  4TO9 A;  1N1Q A;  3C1Y A;  3E6R A;  3KDQ A;  3ISE A;  3WVW A;  2FZF A;  2V15 A;  3GVY A;  1XZ3 A;  5I4J A;  3SHX A;  4DYZ A;  4RC6 A;  4TOA A;  2V2M A;  2YJK A;  2WLA A;  1IES A;  2CLU A;  2V8U A;  3PWQ A;  4AM2 A;  4TOG A;  2XJO A;  2GS4 A;  5JKL G;  4IXK A;  1MFR A;  2OKC A;  3PVT B;  1LB3 A;  4YXJ A;  4KXR B;  5GU3 X;  3E2C A;  2Y44 A;  2V2I A;  5J8S A;  1S3Q A;  1VEQ A;  3UFB A;  2FFX J;  3IS8 A;  2RBD A;  4XKU A;  3KA4 A;  3R2L A;  4LQH A;  2Z5R A;  3F32 A;  3SH6 A;  1NNQ A;  2ITB A;  1F30 A;  1GWG A;  4CVS A;  5GOU A;  2Z5P A;  3PW1 B;  3L0M A;  1XZ1 A;  2HR5 A;  3DBY A;  4TOF A;  4AM4 A;  3FVB A;  4CVP A;  2V2N A;  4LPN A;  5FFE A;  1TJO A;  2QF9 A;  3R2O A;  2C2J A;  3F38 A;  3BVF A;  2V2S A;  5K52 A;  2BJY A;  2N02 A;  5E2D A;  3Q4O A;  4PGK A;  4REU A;  2CHP A;  3EGM A;  5HQO A;  3W54 A;  5J93 A;  3KHK A;  2C41 A;  4ISP A;  4DZ0 A;  5D8X A;  3F34 A;  3Q4Q A;  3AF8 X;  1UMN A;  4CYB A;  4WJG 4;  5ERK A;  3NP0 X;  1RCD A;  3O7R A;  4DYU A;  1NFV A;  3PW8 A;  4M33 A;  4RC8 A;  4XKS A;  3HIU A;  2W0O A;  4ITT A;  3C21 A;  5HU6 D;  1JI5 A;  4RC5 A;  1NF4 A;  4IWJ A;  3UOI A;  2Z90 A;  5D8Q A;  2YW7 A;  3UOF A;  3IS7 A;  3SE1 A;  1RYT A;  4PGI A;  4EVE A;  1O9I A;  3MPS A;  5C6F A;  2D5K A;  4ZKW A;  3F33 A;  3GHQ A;  3QVD A;  1J30 A;  4M35 A;  4M32 A;  3FSE A;  2FG4 A;  3PWF A;  3VNX A;  2CN7 A;  2C2F A;  3PVT A;  4KVS A;  5D8P A;  5LG8 A;  3PVY B;  2V2L A;  5ERJ A;  2VXX A;  4ITW A;  3BVE A;  2IU2 A;  5LG2 A;  2JD7 0;  1H96 A;  3F39 A;  2YJJ A;  4YKH A;  1DAT A;  4LPJ A;  3N6O A;  2Z6M A;  4DAS A;  1NF6 A;  2FJC A;  2UX1 A;  3KA6 A;  2GYQ A;  2XGW A;  3PW1 A;  4W4L B;  3T9J A;  3C1Z A;  3RGD A;  4M34 A;  4MUD A;  2ZA7 A;  4ZL6 A;  1FHA A;  1S30 A;  3OGH A;  2JD8 0;  4TOH A;  4CMY A;  2PYB A;  5FFB A;  5LS9 A;  4XKT A;  4ETR A;  5IX6 A;  3A68 A;  3BVK A;  2FHA A;  2G4H A;  3R2M A;  3KWO A;  3R2S A;  4XGS A;  3O7S A;  4TOE A;  2BKC A;  1DPS A;  3RBC A;  4MN9 A;  1BG7 A;  2C2U A;  3EZ0 A;  1TKP A;  1DVB A;  4LQJ A;  5AXS A;  2ZG8 X;  3M6J A;  4E6K A;  4MJY A;  4LYX A;  2GYD A;  4EVB A;  1BCF A;  4KVR A;  3V3K B;  4P18 A;  4LPM A;  4TOC A;  4DYX A;  2WTL A;  3QZ3 A;  2V2O A;  1UVH A;  3BT5 A;  1LKO A;  4DYY A;  2JD6 0;  1SQ3 A;  3GGZ A;  5CMR A;  3E1J A;  3KA3 A;  1YUX A;  2Z5Q A;  1RCG A;  2IY4 A;  2ZG7 X;  1SOF A;  4ZKX A;  5CMQ A;  1OTK A;  2OC5 A;  3PVR B;  3VVA A;  4CYA A;  5JDO B;  3TA8 A;  1ZUJ A;  3BVI A;  3Q4R A;  3KA9 A;  2C6R A;  3F36 A;  4LQV A;  1JTS A;  2FKZ A;  3PVY A;  1Z4A A;  4KVQ A;  3E1O A;  5GU0 X;  1B71 A;  3F37 A;  2CIH A;  3E1N A;  2AR0 A;  3R2K A;  3ERZ A;  4II4 B;  4ZTT A;  1VJX A;  5JAC A;  3RD0 A;  4YVZ A;  3JZ9 A;  1LKM A;  4EVD A;  1AEW A;  1JGC A;  3E1Q A;  3QD8 A;  3VV9 A;  4ZJK A;  3WVV A;  4LQN A;  2V2P A;  2IB0 A;  4ZMC A;  3D19 A;  4U3G A;  2ZA6 A;  4CVT A;  3ISF A;  2XKQ A;  3BKN A;  3H7G A;  3E1L A;  1JKU A;  2VZB A;  4Z5S A;  4LYU A;  1LKP A;  1R03 A;  4CY9 A;  3PWQ C;  1ZS3 A;  2BW1 A;  1VEL A;  1TKO A;  1JI4 A;  3GGY A;  1HRS A;  2ZA8 A;  1MOJ A;  3AF7 X;  2VXI A;  1YUZ A;  2CHI A;  4RC7 B;  5GN8 B;  4IWK A;  4YXM A;  4MY7 A;  2HTN A;  5D8R A;  1Z6O A;  3EZU A;  3OJ5 A;  1F33 A;  3AF9 X;  3FI6 A;  3IQ1 A;  3KXU A;  2QQY A;  5D8O A;  2V2R A;  5JKL A;  2BK6 A;  4A25 A;  4OYN A;  5D8S A;  5FFC A; 
#chains in the Genus database with same CATH homology
 2ZUR X;  3QHC A;  4R42 A;  4ZLW A;  5GU1 X;  3F35 A;  2X17 0;  2XJN A;  1JRE A;  4MKU A;  3KX9 A;  3U90 A;  4RC6 B;  1TK6 A;  5GU2 X;  2Y3Q A;  1L8H A;  1RCE A;  1S2Z A;  1JKV A;  3QHB A;  4TOB A;  4CMY V;  2G38 B;  3PVR A;  5FFA A;  3AJP A;  5JDO A;  2FL0 A;  5E1U A;  4EVC A;  3SID A;  5LBH A;  2V8T A;  3RAV A;  2CLB A;  3E6S A;  3QB9 A;  2CWL A;  1QGH A;  4MXP A;  4ZKH A;  4W4K B;  5HJH A;  4X0J A;  4II4 A;  2XJM A;  3PW8 C;  3KA8 A;  1O9R A;  4DE6 A;  2FG8 A;  4Z3B A;  3RE7 A;  5J8W A;  2YW6 A;  3AK8 A;  1JIG A;  3A9Q A;  1QYB A;  1JYB A;  3FRR A;  4DI0 A;  4E40 A;  4ML5 A;  1YV1 A;  3WVU A;  2CF7 A;  3AK9 A;  3AJO A;  3JZA B;  3PZA A;  1BFR A;  3ES3 A;  3UNO A;  2V2J A;  2WWX B;  1Z6O M;  3LKD A;  4CVR A;  5CZU A;  2MGY A;  1KRQ A;  3GE4 A;  1VEI A;  4PG0 A;  3NOZ X;  4ZL5 A;  5HJF A;  3BVL A;  4PG1 A;  3R2H A;  3R2R A;  2OH3 A;  3E1P A;  5D8Y A;  1L8I A;  5J9V A;  1IER A;  4ERU A;  4Y08 A;  4RC7 A;  2CN6 A;  5GN8 A;  2ZG9 X;  4QUW A;  3HL1 A;  4TOD A;  4ISM A;  3C23 A;  3WNW A;  1RCI A;  4TW3 A;  2F7N A;  3AJQ A;  1RCC A;  5K53 A;  3NP2 X;  3Q4N A;  5JKM A;  1EUM A;  2WLU A;  3E1M A;  1VLG A;  3FRS A;  5FEJ A;  5FFD A;  5JKM G;  4RC5 B;  2CEI A;  4AM5 A;  4TO9 A;  1N1Q A;  3C1Y A;  3E6R A;  3KDQ A;  3ISE A;  3WVW A;  2FZF A;  2V15 A;  3GVY A;  1XZ3 A;  5I4J A;  3SHX A;  4DYZ A;  4RC6 A;  4TOA A;  2V2M A;  2YJK A;  2WLA A;  1IES A;  2CLU A;  2V8U A;  3PWQ A;  4AM2 A;  4TOG A;  2XJO A;  2GS4 A;  5JKL G;  4IXK A;  1MFR A;  2OKC A;  3PVT B;  1LB3 A;  4YXJ A;  4KXR B;  5GU3 X;  3E2C A;  2Y44 A;  2V2I A;  5J8S A;  1S3Q A;  1VEQ A;  3UFB A;  2FFX J;  3IS8 A;  2RBD A;  4XKU A;  3KA4 A;  3R2L A;  4LQH A;  2Z5R A;  3F32 A;  3SH6 A;  1NNQ A;  2ITB A;  1F30 A;  1GWG A;  4CVS A;  5GOU A;  2Z5P A;  3PW1 B;  3L0M A;  1XZ1 A;  2HR5 A;  3DBY A;  4TOF A;  4AM4 A;  3FVB A;  4CVP A;  2V2N A;  4LPN A;  5FFE A;  1TJO A;  2QF9 A;  3R2O A;  2C2J A;  3F38 A;  3BVF A;  2V2S A;  5K52 A;  2BJY A;  2N02 A;  5E2D A;  3Q4O A;  4PGK A;  4REU A;  2CHP A;  3EGM A;  5HQO A;  3W54 A;  5J93 A;  3KHK A;  2C41 A;  4ISP A;  4DZ0 A;  5D8X A;  3F34 A;  3Q4Q A;  3AF8 X;  1UMN A;  4CYB A;  4WJG 4;  5ERK A;  3NP0 X;  1RCD A;  3O7R A;  4DYU A;  1NFV A;  3PW8 A;  4M33 A;  4RC8 A;  4XKS A;  3HIU A;  2W0O A;  4ITT A;  3C21 A;  5HU6 D;  1JI5 A;  4RC5 A;  1NF4 A;  4IWJ A;  3UOI A;  2Z90 A;  5D8Q A;  2YW7 A;  3UOF A;  3IS7 A;  3SE1 A;  1RYT A;  4PGI A;  4EVE A;  1O9I A;  3MPS A;  5C6F A;  2D5K A;  4ZKW A;  3F33 A;  3GHQ A;  3QVD A;  1J30 A;  4M35 A;  4M32 A;  3FSE A;  2FG4 A;  3PWF A;  3VNX A;  2CN7 A;  2C2F A;  3PVT A;  4KVS A;  5D8P A;  5LG8 A;  3PVY B;  2V2L A;  5ERJ A;  2VXX A;  4ITW A;  3BVE A;  2IU2 A;  5LG2 A;  2JD7 0;  1H96 A;  3F39 A;  2YJJ A;  4YKH A;  1DAT A;  4LPJ A;  3N6O A;  2Z6M A;  4DAS A;  1NF6 A;  2FJC A;  2UX1 A;  3KA6 A;  2GYQ A;  2XGW A;  3PW1 A;  4W4L B;  3T9J A;  3C1Z A;  3RGD A;  4M34 A;  4MUD A;  2ZA7 A;  4ZL6 A;  1FHA A;  1S30 A;  3OGH A;  2JD8 0;  4TOH A;  4CMY A;  2PYB A;  5FFB A;  5LS9 A;  4XKT A;  4ETR A;  5IX6 A;  3A68 A;  3BVK A;  2FHA A;  2G4H A;  3R2M A;  3KWO A;  3R2S A;  4XGS A;  3O7S A;  4TOE A;  2BKC A;  1DPS A;  3RBC A;  4MN9 A;  1BG7 A;  2C2U A;  3EZ0 A;  1TKP A;  1DVB A;  4LQJ A;  5AXS A;  2ZG8 X;  3M6J A;  4E6K A;  4MJY A;  4LYX A;  2GYD A;  4EVB A;  1BCF A;  4KVR A;  3V3K B;  4P18 A;  4LPM A;  4TOC A;  4DYX A;  2WTL A;  3QZ3 A;  2V2O A;  1UVH A;  3BT5 A;  1LKO A;  4DYY A;  2JD6 0;  1SQ3 A;  3GGZ A;  5CMR A;  3E1J A;  3KA3 A;  1YUX A;  2Z5Q A;  1RCG A;  2IY4 A;  2ZG7 X;  1SOF A;  4ZKX A;  5CMQ A;  1OTK A;  2OC5 A;  3PVR B;  3VVA A;  4CYA A;  5JDO B;  3TA8 A;  1ZUJ A;  3BVI A;  3Q4R A;  3KA9 A;  2C6R A;  3F36 A;  4LQV A;  1JTS A;  2FKZ A;  3PVY A;  1Z4A A;  4KVQ A;  3E1O A;  5GU0 X;  1B71 A;  3F37 A;  2CIH A;  3E1N A;  2AR0 A;  3R2K A;  3ERZ A;  4II4 B;  4ZTT A;  1VJX A;  5JAC A;  3RD0 A;  4YVZ A;  3JZ9 A;  1LKM A;  4EVD A;  1AEW A;  1JGC A;  3E1Q A;  3QD8 A;  3VV9 A;  4ZJK A;  3WVV A;  4LQN A;  2V2P A;  2IB0 A;  4ZMC A;  3D19 A;  4U3G A;  2ZA6 A;  4CVT A;  3ISF A;  2XKQ A;  3BKN A;  3H7G A;  3E1L A;  1JKU A;  2VZB A;  4Z5S A;  4LYU A;  1LKP A;  1R03 A;  4CY9 A;  3PWQ C;  1ZS3 A;  2BW1 A;  1VEL A;  1TKO A;  1JI4 A;  3GGY A;  1HRS A;  2ZA8 A;  1MOJ A;  3AF7 X;  2VXI A;  1YUZ A;  2CHI A;  4RC7 B;  5GN8 B;  4IWK A;  4YXM A;  4MY7 A;  2HTN A;  5D8R A;  1Z6O A;  3EZU A;  3OJ5 A;  1F33 A;  3AF9 X;  3FI6 A;  3IQ1 A;  3KXU A;  2QQY A;  5D8O A;  2V2R A;  5JKL A;  2BK6 A;  4A25 A;  4OYN A;  5D8S A;  5FFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...