2HTNA

E. coli bacterioferritin in its as-isolated form
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
158
structure length
158
Chain Sequence
MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDWLETELDLIQKMGLQNYLQAQIREEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein, oxidoreductase
molecule keywords Bacterioferritin
publication title Fortuitous structure determination of 'as-isolated' Escherichia coli bacterioferritin in a novel crystal form.
pubmed doi rcsb
total genus 71
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2006-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2htnA00
3PW8C 2BJYA 2WTLA 4R42A 2C2UA 3PW1A 3AK9A 1UMNA 1N1QA 2XJMA 3PVYA 1JI4A 3E2CA 2VXIA 5ERJA 3NP0X 2Z6MA 1JIGA 5C6FA 3KA6A 3VNXA 3E1PA 4PGIA 3R2SA 5FEJA 1O9IA 3PWQC 3Q4NA 1JREA 3UNOA 2YJJA 2XJNA 2Z5QA 4LYUA 5K53A 1VEQA 4U3GA 4CVPA 3WVUA 2OC5A 3AF9X 1JI5A 2Z5PA 1BFRA 1QGHA 1DATA 3F39A 2V2JA 1RCIA 3QHBA 2CEIA 4RC6A 1XZ1A 5IX6A 3KA4A 3Q4RA 5J8WA 2V2PA 3H7GA 4ISMA 4TO9A 3RAVA 3BVEA 2IY4A 3U90A 4TW3A 3F33A 2FZFA 2V2OA 2V15A 1MOJA 4EVBA 4ZKXA 1L8HA 1TK6A 2CF7A 3HL1A 1Z6OM 5K52A 4AM5A 4DYZA 1R03A 1NNQA 4MY7A 3EGMA 1BG7A 1NF6A 4ETRA 3PW8A 3BKNA 4DASA 4LPNA 5J93A 2RBDA 4Z5SA 2C6RA 2CN6A 1VLGA 1RCDA 4XKUA 4ZJKA 1YUZA 1J30A 2VXXA 3BT5A 3WVVA 2Y3QA 4ZKHA 5FFAA 4PG1A 3OJ5A 3R2OA 3GHQA 3PWQA 2CLBA 4KVSA 1LKMA 3KA8A 3QHCA 3WNWA 3FSEA 1AEWA 4M32A 4MJYA 4TOFA 2V2NA 3PWFA 3EZ0A 1S30A 5D8PA 1ZUJA 3BVIA 1VJXA 2BKCA 3FI6A 3F35A 2V2RA 3BVKA 1RCCA 2V2SA 3E1OA 3PVTB 4ZL6A 3PVRA 1B71A 2ZURX 3T9JA 5FFDA 3R2RA 3F34A 2JD70 1F30A 1HRSA 4KVRA 5JACA 1LKOA 4TOCA 2D5KA 5GU3X 5FFCA 3QVDA 2UX1A 5FFEA 3Q4QA 3GE4A 5D8XA 1DPSA 2WLUA 4CVRA 4ML5A 2Z5RA 1S2ZA 2IU2A 4DE6A 3HIUA 1Z4AA 3NP2X 1IESA 4EVDA 1JYBA 4QUWA 4ITWA 5JKLG 4M33A 5HQOA 5D8QA 2XGWA 3ES3A 4II4A 3UOIA 3RD0A 1JKVA 1TKOA 1XZ3A 5GN8A 5FFBA 2XKQA 4E6KA 4ITTA 3AJPA 2CHIA 2FG8A 3E6RA 2FG4A 4EVCA 4RC5B 1QYBA 5E2DA 5J8SA 4RC7B 1FHAA 1SQ3A 3O7SA 3E1QA 2X170 1F33A 3RGDA 1VEIA 2XJOA 1ZS3A 3UOFA 2FL0A 1YUXA 3NOZX 2QQYA 3R2MA 2V2LA 4M34A 3PW1B 4ZTTA 4RC8A 5JKMG 3PVYB 2BW1A 4DYUA 5LS9A 4CMYV 4ERUA 2ZA6A 1TKPA 4MN9A 2F7NA 4PG0A 2ZA8A 3WVWA 1RCGA 5LG8A 4TOHA 1EUMA 2C41A 1L8IA 2C2FA 3FVBA 3R2HA 4PGKA 4A25A 4AM4A 3QB9A 2ZA7A 4CYAA 3AJOA 2HTNA 1BCFA 4ISPA 1YV1A 4RC6B 4DYXA 2ZG7X 2YJKA 3QZ3A 3F38A 5CMQA 5AXSA 4CYBA 3F37A 4LPMA 1JTSA 2VZBA 2ZG9X 5D8OA 3EZUA 4MKUA 3OGHA 1O9RA 2JD80 3E1MA 1SOFA 2FFXJ 4LYXA 2V2MA 4LQVA 2G4HA 4OYNA 3IQ1A 4IWKA 4CY9A 2CLUA 2CN7A 3IS8A 1DVBA 1RCEA 3SH6A 4CMYA 5JKLA 2CIHA 4CVSA 4YKHA 4ZL5A 5GU0X 2FHAA 5J9VA 2FJCA 2BK6A 2V2IA 3E1NA 2JD60 4M35A 4LPJA 4KVQA 4ZLWA 2GYQA 4AM2A 2GYDA 3R2LA 3GVYA 4XGSA 3O7RA 4P18A 2ZG8X 2C2JA 1Z6OA 3KA9A 3TA8A 5HJFA 5CMRA 3PVRB 1KRQA 2Z90A 4ZKWA 3AK8A 4IXKA 4Z3BA 2GS4A 3KWOA 1JGCA 3MPSA 4REUA 4TOEA 1NF4A 3E6SA 3ISEA 4TOBA 1OTKA 3PVTA 3QD8A 5JKMA 2YW7A 3SE1A 3A68A 1UVHA 3RE7A 1NFVA 4DI0A 4Y08A 2WLAA 4DYYA 2PYBA 3AF7X 4MUDA 1S3QA 3AF8X 1H96A 1GWGA 3E1LA 5D8RA 3ERZA 5GU2X 3E1JA 2FKZA 4TOAA 2IB0A 3R2KA 1IERA 2HR5A 2W0OA 4XKTA 5LG2A 4LQJA 1RYTA 3Q4OA 5ERKA 2YW6A 4TOGA 1LB3A 4IWJA 4XKSA 4II4B 4TODA 3IS7A 3A9QA 3AJQA 3F32A 5GN8B 3KA3A 4DZ0A 5D8SA 1LKPA 5I4JA 3KX9A 4EVEA 3F36A 1MFRA 4LQNA 4CVTA 3ISFA 5E1UA 1VELA 5D8YA 1TJOA 4LQHA 3SIDA 5CZUA 4RC5A 4ZMCA 2OH3A 3PZAA 1JKUA 5LBHA 4RC7A 3KXUA 5GU1X 2CHPA 3BVLA 2ITBA 3BVFA 5HJHA 3RBCA 3SHXA 2QF9A 5GOUA
chains in the Genus database with same CATH superfamily
3PW8C 2BJYA 2WTLA 4R42A 2C2UA 3PW1A 3AK9A 1UMNA 1N1QA 2XJMA 3PVYA 3W54A 1JI4A 3E2CA 2VXIA 5ERJA 3NP0X 2Z6MA 1JIGA 5C6FA 3KA6A 3VNXA 5JDOA 3E1PA 4PGIA 3R2SA 5FEJA 1O9IA 3PWQC 3Q4NA 1JREA 3UNOA 2YJJA 2XJNA 2Z5QA 4LYUA 5K53A 1VEQA 3FRRA 4U3GA 4CVPA 3WVUA 2OC5A 3AF9X 4YXMA 1JI5A 2Z5PA 1BFRA 1QGHA 1DATA 3F39A 2V2JA 1RCIA 3QHBA 2CEIA 3GGYA 4RC6A 1XZ1A 5IX6A 3KA4A 3Q4RA 5J8WA 2V2PA 3H7GA 4ISMA 4TO9A 3RAVA 3N6OA 3BVEA 2IY4A 3U90A 3C23A 4TW3A 3F33A 2FZFA 2V2OA 2V15A 1MOJA 4EVBA 4ZKXA 1L8HA 1TK6A 2CF7A 3HL1A 1Z6OM 5K52A 4AM5A 4DYZA 1R03A 1NNQA 4MY7A 3EGMA 1BG7A 1NF6A 4ETRA 3PW8A 3BKNA 4DASA 4E40A 4LPNA 5J93A 2RBDA 4Z5SA 2C6RA 2CN6A 1VLGA 1RCDA 4XKUA 4ZJKA 1YUZA 1J30A 2VXXA 3BT5A 3WVVA 2Y3QA 4ZKHA 5FFAA 4PG1A 3OJ5A 3R2OA 2WWXB 3GHQA 3PWQA 2CLBA 4KVSA 1LKMA 3KA8A 3QHCA 3WNWA 3FSEA 1AEWA 4M32A 4MJYA 4TOFA 2V2NA 3PWFA 3EZ0A 1S30A 5D8PA 1ZUJA 3BVIA 1VJXA 2BKCA 3FI6A 3F35A 2V2RA 3BVKA 1RCCA 2AR0A 2V2SA 3E1OA 3PVTB 4ZL6A 3PVRA 1B71A 2ZURX 3T9JA 5FFDA 3R2RA 4WJG4 3F34A 2JD70 1F30A 1HRSA 4KVRA 5JACA 1LKOA 4TOCA 2D5KA 5GU3X 4W4KB 5FFCA 3QVDA 4YVZA 2UX1A 3C1YA 5FFEA 3Q4QA 3GE4A 4KXRB 3C1ZA 5D8XA 1DPSA 2WLUA 4CVRA 2G38B 4ML5A 2Z5RA 1S2ZA 2IU2A 2OKCA 4DE6A 3HIUA 1Z4AA 3NP2X 1IESA 4EVDA 1JYBA 3C21A 4QUWA 4ITWA 5JKLG 4M33A 5HQOA 3LKDA 5D8QA 2XGWA 3ES3A 4II4A 3UOIA 3RD0A 1JKVA 1TKOA 1XZ3A 5GN8A 5FFBA 2XKQA 4E6KA 4ITTA 3AJPA 2CHIA 2FG8A 3E6RA 2FG4A 4EVCA 4RC5B 1QYBA 5E2DA 5J8SA 4RC7B 1FHAA 3JZAB 1SQ3A 3O7SA 3E1QA 2X170 1F33A 3RGDA 1VEIA 2XJOA 1ZS3A 3UOFA 2FL0A 4MXPA 1YUXA 3NOZX 2QQYA 3R2MA 3GGZA 2V2LA 4M34A 3JZ9A 3PW1B 4ZTTA 4RC8A 5JKMG 3PVYB 3V3KB 2BW1A 4DYUA 5LS9A 4CMYV 4ERUA 2ZA6A 1TKPA 4MN9A 2F7NA 4PG0A 2ZA8A 3WVWA 5JDOB 1RCGA 5LG8A 4TOHA 1EUMA 2C41A 1L8IA 2C2FA 3FVBA 3R2HA 4PGKA 4A25A 4AM4A 3QB9A 2ZA7A 4CYAA 3AJOA 2HTNA 1BCFA 4ISPA 1YV1A 4RC6B 4DYXA 2ZG7X 2YJKA 3QZ3A 3F38A 5CMQA 5AXSA 4CYBA 3F37A 4LPMA 1JTSA 2VZBA 2ZG9X 3D19A 5D8OA 3EZUA 4MKUA 3OGHA 1O9RA 2JD80 3E1MA 1SOFA 2FFXJ 3VV9A 3KHKA 4LYXA 2V2MA 3M6JA 4LQVA 2G4HA 4OYNA 3IQ1A 4IWKA 4CY9A 2CLUA 2CN7A 3IS8A 1DVBA 1RCEA 3SH6A 4CMYA 5JKLA 2CIHA 4CVSA 4YKHA 4ZL5A 2V8TA 5GU0X 2FHAA 5J9VA 2FJCA 2BK6A 2V2IA 3E1NA 2JD60 4M35A 4LPJA 4KVQA 3VVAA 4ZLWA 2GYQA 4AM2A 3KDQA 2GYDA 3R2LA 4YXJA 3GVYA 4XGSA 3O7RA 4P18A 2ZG8X 2C2JA 1Z6OA 3KA9A 3TA8A 5HJFA 5CMRA 3PVRB 1KRQA 2Z90A 4ZKWA 5HU6D 3AK8A 4IXKA 4Z3BA 2GS4A 3KWOA 1JGCA 3MPSA 4REUA 4TOEA 1NF4A 3E6SA 3ISEA 4TOBA 1OTKA 3PVTA 3QD8A 5JKMA 2YW7A 3SE1A 3A68A 1UVHA 3RE7A 1NFVA 4DI0A 4Y08A 2WLAA 4DYYA 4W4LB 2PYBA 3L0MA 3AF7X 4MUDA 1S3QA 3AF8X 1H96A 1GWGA 3E1LA 5D8RA 3ERZA 5GU2X 3E1JA 2FKZA 4TOAA 2MGYA 3UFBA 2IB0A 2Y44A 3R2KA 1IERA 2HR5A 2W0OA 4XKTA 5LG2A 4LQJA 1RYTA 3DBYA 3Q4OA 5ERKA 2YW6A 4TOGA 1LB3A 4IWJA 4XKSA 4II4B 4TODA 3IS7A 3A9QA 3AJQA 2N02A 3F32A 5GN8B 3KA3A 4DZ0A 5D8SA 1LKPA 2V8UA 5I4JA 3KX9A 4EVEA 3F36A 1MFRA 4LQNA 4CVTA 3ISFA 5E1UA 1VELA 5D8YA 1TJOA 4LQHA 3SIDA 5CZUA 4X0JA 4RC5A 4ZMCA 2OH3A 3PZAA 2CWLA 1JKUA 5LBHA 3FRSA 4RC7A 3KXUA 5GU1X 2CHPA 3BVLA 2ITBA 3BVFA 5HJHA 3RBCA 3SHXA 2QF9A 5GOUA
chains in the Genus database with same CATH topology
3PW8C 2BJYA 2WTLA 4R42A 2C2UA 3PW1A 3AK9A 1UMNA 1N1QA 2XJMA 3PVYA 3W54A 1JI4A 3E2CA 2VXIA 5ERJA 3NP0X 2Z6MA 1JIGA 5C6FA 3KA6A 3VNXA 5JDOA 3E1PA 4PGIA 3R2SA 5FEJA 1O9IA 3PWQC 3Q4NA 1JREA 3UNOA 2YJJA 2XJNA 2Z5QA 4LYUA 5K53A 1VEQA 3FRRA 4U3GA 4CVPA 3WVUA 2OC5A 3AF9X 4YXMA 1JI5A 2Z5PA 1BFRA 1QGHA 1DATA 3F39A 2V2JA 1RCIA 3QHBA 2CEIA 3GGYA 4RC6A 1XZ1A 5IX6A 3KA4A 3Q4RA 5J8WA 2V2PA 3H7GA 4ISMA 4TO9A 3RAVA 3N6OA 3BVEA 2IY4A 3U90A 3C23A 4TW3A 3F33A 2FZFA 2V2OA 2V15A 1MOJA 4EVBA 4ZKXA 1L8HA 1TK6A 2CF7A 3HL1A 1Z6OM 5K52A 4AM5A 4DYZA 1R03A 1NNQA 4MY7A 3EGMA 1BG7A 1NF6A 4ETRA 3PW8A 3BKNA 4DASA 4E40A 4LPNA 5J93A 2RBDA 4Z5SA 2C6RA 2CN6A 1VLGA 1RCDA 4XKUA 4ZJKA 1YUZA 1J30A 2VXXA 3BT5A 3WVVA 2Y3QA 4ZKHA 5FFAA 4PG1A 3OJ5A 3R2OA 2WWXB 3GHQA 3PWQA 2CLBA 4KVSA 1LKMA 3KA8A 3QHCA 3WNWA 3FSEA 1AEWA 4M32A 4MJYA 4TOFA 2V2NA 3PWFA 3EZ0A 1S30A 5D8PA 1ZUJA 3BVIA 1VJXA 2BKCA 3FI6A 3F35A 2V2RA 3BVKA 1RCCA 2AR0A 2V2SA 3E1OA 3PVTB 4ZL6A 3PVRA 1B71A 2ZURX 3T9JA 5FFDA 3R2RA 4WJG4 3F34A 2JD70 1F30A 1HRSA 4KVRA 5JACA 1LKOA 4TOCA 2D5KA 5GU3X 4W4KB 5FFCA 3QVDA 4YVZA 2UX1A 3C1YA 5FFEA 3Q4QA 3GE4A 4KXRB 3C1ZA 5D8XA 1DPSA 2WLUA 4CVRA 2G38B 4ML5A 2Z5RA 1S2ZA 2IU2A 2OKCA 4DE6A 3HIUA 1Z4AA 3NP2X 1IESA 4EVDA 1JYBA 3C21A 4QUWA 4ITWA 5JKLG 4M33A 5HQOA 3LKDA 5D8QA 2XGWA 3ES3A 4II4A 3UOIA 3RD0A 1JKVA 1TKOA 1XZ3A 5GN8A 5FFBA 2XKQA 4E6KA 4ITTA 3AJPA 2CHIA 2FG8A 3E6RA 2FG4A 4EVCA 4RC5B 1QYBA 5E2DA 5J8SA 4RC7B 1FHAA 3JZAB 1SQ3A 3O7SA 3E1QA 2X170 1F33A 3RGDA 1VEIA 2XJOA 1ZS3A 3UOFA 2FL0A 4MXPA 1YUXA 3NOZX 2QQYA 3R2MA 3GGZA 2V2LA 4M34A 3JZ9A 3PW1B 4ZTTA 4RC8A 5JKMG 3PVYB 3V3KB 2BW1A 4DYUA 5LS9A 4CMYV 4ERUA 2ZA6A 1TKPA 4MN9A 2F7NA 4PG0A 2ZA8A 3WVWA 5JDOB 1RCGA 5LG8A 4TOHA 1EUMA 2C41A 1L8IA 2C2FA 3FVBA 3R2HA 4PGKA 4A25A 4AM4A 3QB9A 2ZA7A 4CYAA 3AJOA 2HTNA 1BCFA 4ISPA 1YV1A 4RC6B 4DYXA 2ZG7X 2YJKA 3QZ3A 3F38A 5CMQA 5AXSA 4CYBA 3F37A 4LPMA 1JTSA 2VZBA 2ZG9X 3D19A 5D8OA 3EZUA 4MKUA 3OGHA 1O9RA 2JD80 3E1MA 1SOFA 2FFXJ 3VV9A 3KHKA 4LYXA 2V2MA 3M6JA 4LQVA 2G4HA 4OYNA 3IQ1A 4IWKA 4CY9A 2CLUA 2CN7A 3IS8A 1DVBA 1RCEA 3SH6A 4CMYA 5JKLA 2CIHA 4CVSA 4YKHA 4ZL5A 2V8TA 5GU0X 2FHAA 5J9VA 2FJCA 2BK6A 2V2IA 3E1NA 2JD60 4M35A 4LPJA 4KVQA 3VVAA 4ZLWA 2GYQA 4AM2A 3KDQA 2GYDA 3R2LA 4YXJA 3GVYA 4XGSA 3O7RA 4P18A 2ZG8X 2C2JA 1Z6OA 3KA9A 3TA8A 5HJFA 5CMRA 3PVRB 1KRQA 2Z90A 4ZKWA 5HU6D 3AK8A 4IXKA 4Z3BA 2GS4A 3KWOA 1JGCA 3MPSA 4REUA 4TOEA 1NF4A 3E6SA 3ISEA 4TOBA 1OTKA 3PVTA 3QD8A 5JKMA 2YW7A 3SE1A 3A68A 1UVHA 3RE7A 1NFVA 4DI0A 4Y08A 2WLAA 4DYYA 4W4LB 2PYBA 3L0MA 3AF7X 4MUDA 1S3QA 3AF8X 1H96A 1GWGA 3E1LA 5D8RA 3ERZA 5GU2X 3E1JA 2FKZA 4TOAA 2MGYA 3UFBA 2IB0A 2Y44A 3R2KA 1IERA 2HR5A 2W0OA 4XKTA 5LG2A 4LQJA 1RYTA 3DBYA 3Q4OA 5ERKA 2YW6A 4TOGA 1LB3A 4IWJA 4XKSA 4II4B 4TODA 3IS7A 3A9QA 3AJQA 2N02A 3F32A 5GN8B 3KA3A 4DZ0A 5D8SA 1LKPA 2V8UA 5I4JA 3KX9A 4EVEA 3F36A 1MFRA 4LQNA 4CVTA 3ISFA 5E1UA 1VELA 5D8YA 1TJOA 4LQHA 3SIDA 5CZUA 4X0JA 4RC5A 4ZMCA 2OH3A 3PZAA 2CWLA 1JKUA 5LBHA 3FRSA 4RC7A 3KXUA 5GU1X 2CHPA 3BVLA 2ITBA 3BVFA 5HJHA 3RBCA 3SHXA 2QF9A 5GOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PW8 C;  2BJY A;  2WTL A;  4R42 A;  2C2U A;  3PW1 A;  3AK9 A;  1UMN A;  1N1Q A;  2XJM A;  3PVY A;  1JI4 A;  3E2C A;  2VXI A;  5ERJ A;  3NP0 X;  2Z6M A;  1JIG A;  5C6F A;  3KA6 A;  3VNX A;  3E1P A;  4PGI A;  3R2S A;  5FEJ A;  1O9I A;  3PWQ C;  3Q4N A;  1JRE A;  3UNO A;  2YJJ A;  2XJN A;  2Z5Q A;  4LYU A;  5K53 A;  1VEQ A;  4U3G A;  4CVP A;  3WVU A;  2OC5 A;  3AF9 X;  1JI5 A;  2Z5P A;  1BFR A;  1QGH A;  1DAT A;  3F39 A;  2V2J A;  1RCI A;  3QHB A;  2CEI A;  4RC6 A;  1XZ1 A;  5IX6 A;  3KA4 A;  3Q4R A;  5J8W A;  2V2P A;  3H7G A;  4ISM A;  4TO9 A;  3RAV A;  3BVE A;  2IY4 A;  3U90 A;  4TW3 A;  3F33 A;  2FZF A;  2V2O A;  2V15 A;  1MOJ A;  4EVB A;  4ZKX A;  1L8H A;  1TK6 A;  2CF7 A;  3HL1 A;  1Z6O M;  5K52 A;  4AM5 A;  4DYZ A;  1R03 A;  1NNQ A;  4MY7 A;  3EGM A;  1BG7 A;  1NF6 A;  4ETR A;  3PW8 A;  3BKN A;  4DAS A;  4LPN A;  5J93 A;  2RBD A;  4Z5S A;  2C6R A;  2CN6 A;  1VLG A;  1RCD A;  4XKU A;  4ZJK A;  1YUZ A;  1J30 A;  2VXX A;  3BT5 A;  3WVV A;  2Y3Q A;  4ZKH A;  5FFA A;  4PG1 A;  3OJ5 A;  3R2O A;  3GHQ A;  3PWQ A;  2CLB A;  4KVS A;  1LKM A;  3KA8 A;  3QHC A;  3WNW A;  3FSE A;  1AEW A;  4M32 A;  4MJY A;  4TOF A;  2V2N A;  3PWF A;  3EZ0 A;  1S30 A;  5D8P A;  1ZUJ A;  3BVI A;  1VJX A;  2BKC A;  3FI6 A;  3F35 A;  2V2R A;  3BVK A;  1RCC A;  2V2S A;  3E1O A;  3PVT B;  4ZL6 A;  3PVR A;  1B71 A;  2ZUR X;  3T9J A;  5FFD A;  3R2R A;  3F34 A;  2JD7 0;  1F30 A;  1HRS A;  4KVR A;  5JAC A;  1LKO A;  4TOC A;  2D5K A;  5GU3 X;  5FFC A;  3QVD A;  2UX1 A;  5FFE A;  3Q4Q A;  3GE4 A;  5D8X A;  1DPS A;  2WLU A;  4CVR A;  4ML5 A;  2Z5R A;  1S2Z A;  2IU2 A;  4DE6 A;  3HIU A;  1Z4A A;  3NP2 X;  1IES A;  4EVD A;  1JYB A;  4QUW A;  4ITW A;  5JKL G;  4M33 A;  5HQO A;  5D8Q A;  2XGW A;  3ES3 A;  4II4 A;  3UOI A;  3RD0 A;  1JKV A;  1TKO A;  1XZ3 A;  5GN8 A;  5FFB A;  2XKQ A;  4E6K A;  4ITT A;  3AJP A;  2CHI A;  2FG8 A;  3E6R A;  2FG4 A;  4EVC A;  4RC5 B;  1QYB A;  5E2D A;  5J8S A;  4RC7 B;  1FHA A;  1SQ3 A;  3O7S A;  3E1Q A;  2X17 0;  1F33 A;  3RGD A;  1VEI A;  2XJO A;  1ZS3 A;  3UOF A;  2FL0 A;  1YUX A;  3NOZ X;  2QQY A;  3R2M A;  2V2L A;  4M34 A;  3PW1 B;  4ZTT A;  4RC8 A;  5JKM G;  3PVY B;  2BW1 A;  4DYU A;  5LS9 A;  4CMY V;  4ERU A;  2ZA6 A;  1TKP A;  4MN9 A;  2F7N A;  4PG0 A;  2ZA8 A;  3WVW A;  1RCG A;  5LG8 A;  4TOH A;  1EUM A;  2C41 A;  1L8I A;  2C2F A;  3FVB A;  3R2H A;  4PGK A;  4A25 A;  4AM4 A;  3QB9 A;  2ZA7 A;  4CYA A;  3AJO A;  2HTN A;  1BCF A;  4ISP A;  1YV1 A;  4RC6 B;  4DYX A;  2ZG7 X;  2YJK A;  3QZ3 A;  3F38 A;  5CMQ A;  5AXS A;  4CYB A;  3F37 A;  4LPM A;  1JTS A;  2VZB A;  2ZG9 X;  5D8O A;  3EZU A;  4MKU A;  3OGH A;  1O9R A;  2JD8 0;  3E1M A;  1SOF A;  2FFX J;  4LYX A;  2V2M A;  4LQV A;  2G4H A;  4OYN A;  3IQ1 A;  4IWK A;  4CY9 A;  2CLU A;  2CN7 A;  3IS8 A;  1DVB A;  1RCE A;  3SH6 A;  4CMY A;  5JKL A;  2CIH A;  4CVS A;  4YKH A;  4ZL5 A;  5GU0 X;  2FHA A;  5J9V A;  2FJC A;  2BK6 A;  2V2I A;  3E1N A;  2JD6 0;  4M35 A;  4LPJ A;  4KVQ A;  4ZLW A;  2GYQ A;  4AM2 A;  2GYD A;  3R2L A;  3GVY A;  4XGS A;  3O7R A;  4P18 A;  2ZG8 X;  2C2J A;  1Z6O A;  3KA9 A;  3TA8 A;  5HJF A;  5CMR A;  3PVR B;  1KRQ A;  2Z90 A;  4ZKW A;  3AK8 A;  4IXK A;  4Z3B A;  2GS4 A;  3KWO A;  1JGC A;  3MPS A;  4REU A;  4TOE A;  1NF4 A;  3E6S A;  3ISE A;  4TOB A;  1OTK A;  3PVT A;  3QD8 A;  5JKM A;  2YW7 A;  3SE1 A;  3A68 A;  1UVH A;  3RE7 A;  1NFV A;  4DI0 A;  4Y08 A;  2WLA A;  4DYY A;  2PYB A;  3AF7 X;  4MUD A;  1S3Q A;  3AF8 X;  1H96 A;  1GWG A;  3E1L A;  5D8R A;  3ERZ A;  5GU2 X;  3E1J A;  2FKZ A;  4TOA A;  2IB0 A;  3R2K A;  1IER A;  2HR5 A;  2W0O A;  4XKT A;  5LG2 A;  4LQJ A;  1RYT A;  3Q4O A;  5ERK A;  2YW6 A;  4TOG A;  1LB3 A;  4IWJ A;  4XKS A;  4II4 B;  4TOD A;  3IS7 A;  3A9Q A;  3AJQ A;  3F32 A;  5GN8 B;  3KA3 A;  4DZ0 A;  5D8S A;  1LKP A;  5I4J A;  3KX9 A;  4EVE A;  3F36 A;  1MFR A;  4LQN A;  4CVT A;  3ISF A;  5E1U A;  1VEL A;  5D8Y A;  1TJO A;  4LQH A;  3SID A;  5CZU A;  4RC5 A;  4ZMC A;  2OH3 A;  3PZA A;  1JKU A;  5LBH A;  4RC7 A;  3KXU A;  5GU1 X;  2CHP A;  3BVL A;  2ITB A;  3BVF A;  5HJH A;  3RBC A;  3SHX A;  2QF9 A;  5GOU A; 
#chains in the Genus database with same CATH topology
 3PW8 C;  2BJY A;  2WTL A;  4R42 A;  2C2U A;  3PW1 A;  3AK9 A;  1UMN A;  1N1Q A;  2XJM A;  3PVY A;  3W54 A;  1JI4 A;  3E2C A;  2VXI A;  5ERJ A;  3NP0 X;  2Z6M A;  1JIG A;  5C6F A;  3KA6 A;  3VNX A;  5JDO A;  3E1P A;  4PGI A;  3R2S A;  5FEJ A;  1O9I A;  3PWQ C;  3Q4N A;  1JRE A;  3UNO A;  2YJJ A;  2XJN A;  2Z5Q A;  4LYU A;  5K53 A;  1VEQ A;  3FRR A;  4U3G A;  4CVP A;  3WVU A;  2OC5 A;  3AF9 X;  4YXM A;  1JI5 A;  2Z5P A;  1BFR A;  1QGH A;  1DAT A;  3F39 A;  2V2J A;  1RCI A;  3QHB A;  2CEI A;  3GGY A;  4RC6 A;  1XZ1 A;  5IX6 A;  3KA4 A;  3Q4R A;  5J8W A;  2V2P A;  3H7G A;  4ISM A;  4TO9 A;  3RAV A;  3N6O A;  3BVE A;  2IY4 A;  3U90 A;  3C23 A;  4TW3 A;  3F33 A;  2FZF A;  2V2O A;  2V15 A;  1MOJ A;  4EVB A;  4ZKX A;  1L8H A;  1TK6 A;  2CF7 A;  3HL1 A;  1Z6O M;  5K52 A;  4AM5 A;  4DYZ A;  1R03 A;  1NNQ A;  4MY7 A;  3EGM A;  1BG7 A;  1NF6 A;  4ETR A;  3PW8 A;  3BKN A;  4DAS A;  4E40 A;  4LPN A;  5J93 A;  2RBD A;  4Z5S A;  2C6R A;  2CN6 A;  1VLG A;  1RCD A;  4XKU A;  4ZJK A;  1YUZ A;  1J30 A;  2VXX A;  3BT5 A;  3WVV A;  2Y3Q A;  4ZKH A;  5FFA A;  4PG1 A;  3OJ5 A;  3R2O A;  2WWX B;  3GHQ A;  3PWQ A;  2CLB A;  4KVS A;  1LKM A;  3KA8 A;  3QHC A;  3WNW A;  3FSE A;  1AEW A;  4M32 A;  4MJY A;  4TOF A;  2V2N A;  3PWF A;  3EZ0 A;  1S30 A;  5D8P A;  1ZUJ A;  3BVI A;  1VJX A;  2BKC A;  3FI6 A;  3F35 A;  2V2R A;  3BVK A;  1RCC A;  2AR0 A;  2V2S A;  3E1O A;  3PVT B;  4ZL6 A;  3PVR A;  1B71 A;  2ZUR X;  3T9J A;  5FFD A;  3R2R A;  4WJG 4;  3F34 A;  2JD7 0;  1F30 A;  1HRS A;  4KVR A;  5JAC A;  1LKO A;  4TOC A;  2D5K A;  5GU3 X;  4W4K B;  5FFC A;  3QVD A;  4YVZ A;  2UX1 A;  3C1Y A;  5FFE A;  3Q4Q A;  3GE4 A;  4KXR B;  3C1Z A;  5D8X A;  1DPS A;  2WLU A;  4CVR A;  2G38 B;  4ML5 A;  2Z5R A;  1S2Z A;  2IU2 A;  2OKC A;  4DE6 A;  3HIU A;  1Z4A A;  3NP2 X;  1IES A;  4EVD A;  1JYB A;  3C21 A;  4QUW A;  4ITW A;  5JKL G;  4M33 A;  5HQO A;  3LKD A;  5D8Q A;  2XGW A;  3ES3 A;  4II4 A;  3UOI A;  3RD0 A;  1JKV A;  1TKO A;  1XZ3 A;  5GN8 A;  5FFB A;  2XKQ A;  4E6K A;  4ITT A;  3AJP A;  2CHI A;  2FG8 A;  3E6R A;  2FG4 A;  4EVC A;  4RC5 B;  1QYB A;  5E2D A;  5J8S A;  4RC7 B;  1FHA A;  3JZA B;  1SQ3 A;  3O7S A;  3E1Q A;  2X17 0;  1F33 A;  3RGD A;  1VEI A;  2XJO A;  1ZS3 A;  3UOF A;  2FL0 A;  4MXP A;  1YUX A;  3NOZ X;  2QQY A;  3R2M A;  3GGZ A;  2V2L A;  4M34 A;  3JZ9 A;  3PW1 B;  4ZTT A;  4RC8 A;  5JKM G;  3PVY B;  3V3K B;  2BW1 A;  4DYU A;  5LS9 A;  4CMY V;  4ERU A;  2ZA6 A;  1TKP A;  4MN9 A;  2F7N A;  4PG0 A;  2ZA8 A;  3WVW A;  5JDO B;  1RCG A;  5LG8 A;  4TOH A;  1EUM A;  2C41 A;  1L8I A;  2C2F A;  3FVB A;  3R2H A;  4PGK A;  4A25 A;  4AM4 A;  3QB9 A;  2ZA7 A;  4CYA A;  3AJO A;  2HTN A;  1BCF A;  4ISP A;  1YV1 A;  4RC6 B;  4DYX A;  2ZG7 X;  2YJK A;  3QZ3 A;  3F38 A;  5CMQ A;  5AXS A;  4CYB A;  3F37 A;  4LPM A;  1JTS A;  2VZB A;  2ZG9 X;  3D19 A;  5D8O A;  3EZU A;  4MKU A;  3OGH A;  1O9R A;  2JD8 0;  3E1M A;  1SOF A;  2FFX J;  3VV9 A;  3KHK A;  4LYX A;  2V2M A;  3M6J A;  4LQV A;  2G4H A;  4OYN A;  3IQ1 A;  4IWK A;  4CY9 A;  2CLU A;  2CN7 A;  3IS8 A;  1DVB A;  1RCE A;  3SH6 A;  4CMY A;  5JKL A;  2CIH A;  4CVS A;  4YKH A;  4ZL5 A;  2V8T A;  5GU0 X;  2FHA A;  5J9V A;  2FJC A;  2BK6 A;  2V2I A;  3E1N A;  2JD6 0;  4M35 A;  4LPJ A;  4KVQ A;  3VVA A;  4ZLW A;  2GYQ A;  4AM2 A;  3KDQ A;  2GYD A;  3R2L A;  4YXJ A;  3GVY A;  4XGS A;  3O7R A;  4P18 A;  2ZG8 X;  2C2J A;  1Z6O A;  3KA9 A;  3TA8 A;  5HJF A;  5CMR A;  3PVR B;  1KRQ A;  2Z90 A;  4ZKW A;  5HU6 D;  3AK8 A;  4IXK A;  4Z3B A;  2GS4 A;  3KWO A;  1JGC A;  3MPS A;  4REU A;  4TOE A;  1NF4 A;  3E6S A;  3ISE A;  4TOB A;  1OTK A;  3PVT A;  3QD8 A;  5JKM A;  2YW7 A;  3SE1 A;  3A68 A;  1UVH A;  3RE7 A;  1NFV A;  4DI0 A;  4Y08 A;  2WLA A;  4DYY A;  4W4L B;  2PYB A;  3L0M A;  3AF7 X;  4MUD A;  1S3Q A;  3AF8 X;  1H96 A;  1GWG A;  3E1L A;  5D8R A;  3ERZ A;  5GU2 X;  3E1J A;  2FKZ A;  4TOA A;  2MGY A;  3UFB A;  2IB0 A;  2Y44 A;  3R2K A;  1IER A;  2HR5 A;  2W0O A;  4XKT A;  5LG2 A;  4LQJ A;  1RYT A;  3DBY A;  3Q4O A;  5ERK A;  2YW6 A;  4TOG A;  1LB3 A;  4IWJ A;  4XKS A;  4II4 B;  4TOD A;  3IS7 A;  3A9Q A;  3AJQ A;  2N02 A;  3F32 A;  5GN8 B;  3KA3 A;  4DZ0 A;  5D8S A;  1LKP A;  2V8U A;  5I4J A;  3KX9 A;  4EVE A;  3F36 A;  1MFR A;  4LQN A;  4CVT A;  3ISF A;  5E1U A;  1VEL A;  5D8Y A;  1TJO A;  4LQH A;  3SID A;  5CZU A;  4X0J A;  4RC5 A;  4ZMC A;  2OH3 A;  3PZA A;  2CWL A;  1JKU A;  5LBH A;  3FRS A;  4RC7 A;  3KXU A;  5GU1 X;  2CHP A;  3BVL A;  2ITB A;  3BVF A;  5HJH A;  3RBC A;  3SHX A;  2QF9 A;  5GOU A; 
#chains in the Genus database with same CATH homology
 3PW8 C;  2BJY A;  2WTL A;  4R42 A;  2C2U A;  3PW1 A;  3AK9 A;  1UMN A;  1N1Q A;  2XJM A;  3PVY A;  3W54 A;  1JI4 A;  3E2C A;  2VXI A;  5ERJ A;  3NP0 X;  2Z6M A;  1JIG A;  5C6F A;  3KA6 A;  3VNX A;  5JDO A;  3E1P A;  4PGI A;  3R2S A;  5FEJ A;  1O9I A;  3PWQ C;  3Q4N A;  1JRE A;  3UNO A;  2YJJ A;  2XJN A;  2Z5Q A;  4LYU A;  5K53 A;  1VEQ A;  3FRR A;  4U3G A;  4CVP A;  3WVU A;  2OC5 A;  3AF9 X;  4YXM A;  1JI5 A;  2Z5P A;  1BFR A;  1QGH A;  1DAT A;  3F39 A;  2V2J A;  1RCI A;  3QHB A;  2CEI A;  3GGY A;  4RC6 A;  1XZ1 A;  5IX6 A;  3KA4 A;  3Q4R A;  5J8W A;  2V2P A;  3H7G A;  4ISM A;  4TO9 A;  3RAV A;  3N6O A;  3BVE A;  2IY4 A;  3U90 A;  3C23 A;  4TW3 A;  3F33 A;  2FZF A;  2V2O A;  2V15 A;  1MOJ A;  4EVB A;  4ZKX A;  1L8H A;  1TK6 A;  2CF7 A;  3HL1 A;  1Z6O M;  5K52 A;  4AM5 A;  4DYZ A;  1R03 A;  1NNQ A;  4MY7 A;  3EGM A;  1BG7 A;  1NF6 A;  4ETR A;  3PW8 A;  3BKN A;  4DAS A;  4E40 A;  4LPN A;  5J93 A;  2RBD A;  4Z5S A;  2C6R A;  2CN6 A;  1VLG A;  1RCD A;  4XKU A;  4ZJK A;  1YUZ A;  1J30 A;  2VXX A;  3BT5 A;  3WVV A;  2Y3Q A;  4ZKH A;  5FFA A;  4PG1 A;  3OJ5 A;  3R2O A;  2WWX B;  3GHQ A;  3PWQ A;  2CLB A;  4KVS A;  1LKM A;  3KA8 A;  3QHC A;  3WNW A;  3FSE A;  1AEW A;  4M32 A;  4MJY A;  4TOF A;  2V2N A;  3PWF A;  3EZ0 A;  1S30 A;  5D8P A;  1ZUJ A;  3BVI A;  1VJX A;  2BKC A;  3FI6 A;  3F35 A;  2V2R A;  3BVK A;  1RCC A;  2AR0 A;  2V2S A;  3E1O A;  3PVT B;  4ZL6 A;  3PVR A;  1B71 A;  2ZUR X;  3T9J A;  5FFD A;  3R2R A;  4WJG 4;  3F34 A;  2JD7 0;  1F30 A;  1HRS A;  4KVR A;  5JAC A;  1LKO A;  4TOC A;  2D5K A;  5GU3 X;  4W4K B;  5FFC A;  3QVD A;  4YVZ A;  2UX1 A;  3C1Y A;  5FFE A;  3Q4Q A;  3GE4 A;  4KXR B;  3C1Z A;  5D8X A;  1DPS A;  2WLU A;  4CVR A;  2G38 B;  4ML5 A;  2Z5R A;  1S2Z A;  2IU2 A;  2OKC A;  4DE6 A;  3HIU A;  1Z4A A;  3NP2 X;  1IES A;  4EVD A;  1JYB A;  3C21 A;  4QUW A;  4ITW A;  5JKL G;  4M33 A;  5HQO A;  3LKD A;  5D8Q A;  2XGW A;  3ES3 A;  4II4 A;  3UOI A;  3RD0 A;  1JKV A;  1TKO A;  1XZ3 A;  5GN8 A;  5FFB A;  2XKQ A;  4E6K A;  4ITT A;  3AJP A;  2CHI A;  2FG8 A;  3E6R A;  2FG4 A;  4EVC A;  4RC5 B;  1QYB A;  5E2D A;  5J8S A;  4RC7 B;  1FHA A;  3JZA B;  1SQ3 A;  3O7S A;  3E1Q A;  2X17 0;  1F33 A;  3RGD A;  1VEI A;  2XJO A;  1ZS3 A;  3UOF A;  2FL0 A;  4MXP A;  1YUX A;  3NOZ X;  2QQY A;  3R2M A;  3GGZ A;  2V2L A;  4M34 A;  3JZ9 A;  3PW1 B;  4ZTT A;  4RC8 A;  5JKM G;  3PVY B;  3V3K B;  2BW1 A;  4DYU A;  5LS9 A;  4CMY V;  4ERU A;  2ZA6 A;  1TKP A;  4MN9 A;  2F7N A;  4PG0 A;  2ZA8 A;  3WVW A;  5JDO B;  1RCG A;  5LG8 A;  4TOH A;  1EUM A;  2C41 A;  1L8I A;  2C2F A;  3FVB A;  3R2H A;  4PGK A;  4A25 A;  4AM4 A;  3QB9 A;  2ZA7 A;  4CYA A;  3AJO A;  2HTN A;  1BCF A;  4ISP A;  1YV1 A;  4RC6 B;  4DYX A;  2ZG7 X;  2YJK A;  3QZ3 A;  3F38 A;  5CMQ A;  5AXS A;  4CYB A;  3F37 A;  4LPM A;  1JTS A;  2VZB A;  2ZG9 X;  3D19 A;  5D8O A;  3EZU A;  4MKU A;  3OGH A;  1O9R A;  2JD8 0;  3E1M A;  1SOF A;  2FFX J;  3VV9 A;  3KHK A;  4LYX A;  2V2M A;  3M6J A;  4LQV A;  2G4H A;  4OYN A;  3IQ1 A;  4IWK A;  4CY9 A;  2CLU A;  2CN7 A;  3IS8 A;  1DVB A;  1RCE A;  3SH6 A;  4CMY A;  5JKL A;  2CIH A;  4CVS A;  4YKH A;  4ZL5 A;  2V8T A;  5GU0 X;  2FHA A;  5J9V A;  2FJC A;  2BK6 A;  2V2I A;  3E1N A;  2JD6 0;  4M35 A;  4LPJ A;  4KVQ A;  3VVA A;  4ZLW A;  2GYQ A;  4AM2 A;  3KDQ A;  2GYD A;  3R2L A;  4YXJ A;  3GVY A;  4XGS A;  3O7R A;  4P18 A;  2ZG8 X;  2C2J A;  1Z6O A;  3KA9 A;  3TA8 A;  5HJF A;  5CMR A;  3PVR B;  1KRQ A;  2Z90 A;  4ZKW A;  5HU6 D;  3AK8 A;  4IXK A;  4Z3B A;  2GS4 A;  3KWO A;  1JGC A;  3MPS A;  4REU A;  4TOE A;  1NF4 A;  3E6S A;  3ISE A;  4TOB A;  1OTK A;  3PVT A;  3QD8 A;  5JKM A;  2YW7 A;  3SE1 A;  3A68 A;  1UVH A;  3RE7 A;  1NFV A;  4DI0 A;  4Y08 A;  2WLA A;  4DYY A;  4W4L B;  2PYB A;  3L0M A;  3AF7 X;  4MUD A;  1S3Q A;  3AF8 X;  1H96 A;  1GWG A;  3E1L A;  5D8R A;  3ERZ A;  5GU2 X;  3E1J A;  2FKZ A;  4TOA A;  2MGY A;  3UFB A;  2IB0 A;  2Y44 A;  3R2K A;  1IER A;  2HR5 A;  2W0O A;  4XKT A;  5LG2 A;  4LQJ A;  1RYT A;  3DBY A;  3Q4O A;  5ERK A;  2YW6 A;  4TOG A;  1LB3 A;  4IWJ A;  4XKS A;  4II4 B;  4TOD A;  3IS7 A;  3A9Q A;  3AJQ A;  2N02 A;  3F32 A;  5GN8 B;  3KA3 A;  4DZ0 A;  5D8S A;  1LKP A;  2V8U A;  5I4J A;  3KX9 A;  4EVE A;  3F36 A;  1MFR A;  4LQN A;  4CVT A;  3ISF A;  5E1U A;  1VEL A;  5D8Y A;  1TJO A;  4LQH A;  3SID A;  5CZU A;  4X0J A;  4RC5 A;  4ZMC A;  2OH3 A;  3PZA A;  2CWL A;  1JKU A;  5LBH A;  3FRS A;  4RC7 A;  3KXU A;  5GU1 X;  2CHP A;  3BVL A;  2ITB A;  3BVF A;  5HJH A;  3RBC A;  3SHX A;  2QF9 A;  5GOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...