2HTNA

E. coli bacterioferritin in its as-isolated form
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
158
structure length
158
Chain Sequence
MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDWLETELDLIQKMGLQNYLQAQIREEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterioferritin
publication title Fortuitous structure determination of 'as-isolated' Escherichia coli bacterioferritin in a novel crystal form.
pubmed doi rcsb
molecule tags Metal binding protein, oxidoreductase
total genus 71
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2006-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2htnA00
5GU0X 4PGIA 1LKOA 3SH6A 2V15A 2VXXA 4QUWA 1LKPA 4TOGA 5ERKA 4CMYA 2ITBA 3O7RA 4ETRA 1DATA 3PW1A 1FHAA 2D5KA 4RC7A 1JI4A 3O7SA 1O9RA 2ZA7A 4TO9A 1IESA 4PGKA 1JI5A 5K52A 2Y3QA 2JD70 5GU3X 5GN8A 4ZJKA 4Z5SA 3F36A 3E1LA 3HIUA 3PWQA 2BKCA 1DVBA 1MOJA 2OC5A 4AM4A 3U90A 5ERJA 3NP0X 5J93A 3R2HA 4ZL5A 1UMNA 4R42A 1L8IA 3F39A 1BFRA 4CMYV 4RC6B 4LQVA 2V2RA 4M33A 5D8SA 5LG8A 3ERZA 3PWQC 1JYBA 1R03A 1O9IA 2Z5PA 4LQJA 4DASA 2RBDA 3KXUA 4ZL6A 2WTLA 4LPMA 1NF4A 1YUZA 2XKQA 4KVRA 3BT5A 3OJ5A 3VNXA 3ISEA 3AF8X 3IQ1A 5E1UA 3WVWA 3E1PA 5GU1X 3RGDA 1TJOA 3F38A 2CEIA 2C2FA 1VEQA 2X170 2ZG8X 5FFCA 2YW7A 1RCCA 3E1JA 2WLUA 3E6SA 3PVTA 3NOZX 1UVHA 2FG8A 2CN6A 5JKLA 4YKHA 4CVRA 4TOCA 1S2ZA 3NP2X 5GU2X 5CMRA 3A9QA 3BVKA 1TK6A 4ITWA 1XZ1A 3SIDA 5J8WA 3F37A 5D8XA 3KX9A 1RCEA 5CZUA 3WVVA 3PW1B 4RC7B 5GOUA 5I4JA 2GYQA 5J8SA 3SE1A 3BVLA 1VELA 3E1NA 2Z6MA 4PG0A 1NNQA 4ISMA 4ZKWA 2V2MA 3E1QA 3IS7A 5GN8B 2JD80 3QHBA 4ZLWA 3GHQA 4KVSA 1H96A 3KA8A 1VLGA 2IU2A 4CYBA 2Z5QA 1ZS3A 3PZAA 2C2JA 4XKUA 4REUA 4DI0A 3AK8A 3GE4A 2XJNA 5D8YA 5IX6A 3PWFA 3HL1A 4ZKXA 3FI6A 5D8OA 4E6KA 2C2UA 1TKPA 3PVYA 2CIHA 5D8RA 3PVRA 4ITTA 1SOFA 2C41A 2GS4A 3UOFA 2BK6A 1RCGA 4LPNA 3KA9A 4KVQA 5J9VA 4P18A 1RCDA 2XJMA 1S30A 4LQNA 1LB3A 3WVUA 4XKTA 2VXIA 2C6RA 1KRQA 4DE6A 4LPJA 1LKMA 3PVTB 4CY9A 3IS8A 3KWOA 4CVSA 3MPSA 2CF7A 1JTSA 2FG4A 3F32A 1BCFA 2ZURX 4OYNA 4MKUA 2G4HA 3R2RA 3BVIA 4II4A 5FFDA 3RE7A 3EZ0A 2FL0A 4IWJA 3H7GA 1QGHA 4XKSA 4MUDA 4RC5A 4Y08A 4CYAA 2YJKA 2CN7A 5AXSA 4LYUA 2V2PA 3BVFA 2IY4A 4Z3BA 5JKMA 1VJXA 2IB0A 1Z6OM 4TOEA 4IWKA 3Q4QA 1HRSA 5FFAA 3BVEA 5HQOA 1ZUJA 5C6FA 1B71A 4TOBA 3Q4RA 4ERUA 5HJFA 2V2JA 4TW3A 4EVEA 3R2SA 1F33A 5JKMG 4TODA 5JKLG 3PVYB 3PVRB 4ZTTA 3E1OA 3EZUA 1TKOA 3UNOA 1BG7A 4LYXA 4ML5A 2XJOA 3AF9X 2Z90A 3KA6A 2F7NA 2ZA8A 2BW1A 1Z4AA 1NFVA 3FVBA 4EVDA 1JKUA 4CVTA 4DYUA 1GWGA 3GVYA 3PW8C 2ZA6A 2HTNA 3QHCA 2YJJA 4MJYA 5FEJA 2UX1A 2QQYA 3R2OA 4ISPA 4DZ0A 2ZG7X 1AEWA 2CLBA 1L8HA 1JKVA 3R2KA 3QVDA 3F34A 1MFRA 3SHXA 3RD0A 4EVBA 5HJHA 2FHAA 1Z6OA 1JGCA 4II4B 1S3QA 3WNWA 3KA3A 2FZFA 4XGSA 3Q4OA 3AJPA 1DPSA 1XZ3A 4RC5B 4AM5A 1JREA 4ZMCA 4CVPA 2FKZA 1N1QA 2CLUA 3A68A 4AM2A 3E2CA 3E1MA 5FFEA 3KA4A 4M34A 2V2OA 4DYYA 4A25A 4DYXA 4MN9A 3RAVA 4IXKA 2V2LA 2OH3A 2YW6A 5CMQA 4RC8A 3E6RA 3ISFA 3FSEA 1VEIA 3AK9A 1J30A 2V2SA 2FJCA 1RYTA 3RBCA 4M35A 4M32A 1JIGA 3ES3A 2CHIA 4LQHA 3QD8A 1YUXA 2PYBA 4TOHA 2V2NA 3Q4NA 4EVCA 3F35A 1NF6A 3AJOA 5LS9A 3QB9A 4ZKHA 3BKNA 2HR5A 3UOIA 3OGHA 4RC6A 2V2IA 3QZ3A 2FFXJ 5D8QA 3R2LA 1RCIA 1YV1A 3TA8A 2W0OA 5D8PA 4DYZA 2Z5RA 2ZG9X 3PW8A 3T9JA 2QF9A 4PG1A 5E2DA 1EUMA 2BJYA 1OTKA 3AF7X 1SQ3A 4TOFA 3EGMA 3AJQA 2XGWA 1IERA 1QYBA 3F33A 4MY7A 2CHPA 2GYDA 2WLAA 3R2MA 4TOAA 2JD60 2VZBA 1F30A 4U3GA 5LBHA 5JACA 5K53A 5LG2A 5FFBA
chains in the Genus database with same CATH superfamily
5GU0X 4PGIA 1LKOA 3SH6A 2V15A 2VXXA 4QUWA 2AR0A 1LKPA 4TOGA 5ERKA 4CMYA 2ITBA 3O7RA 4ETRA 1DATA 3PW1A 1FHAA 3C21A 2D5KA 4RC7A 1JI4A 3O7SA 1O9RA 2ZA7A 3C23A 4TO9A 3D19A 1IESA 4PGKA 1JI5A 5K52A 2Y3QA 2JD70 5GU3X 5GN8A 4ZJKA 4Z5SA 5JDOB 3F36A 3E1LA 3HIUA 3PWQA 2OKCA 2BKCA 1DVBA 1MOJA 2OC5A 4AM4A 3U90A 5ERJA 3NP0X 5J93A 3KHKA 3R2HA 4ZL5A 1UMNA 4R42A 1L8IA 3F39A 1BFRA 4CMYV 4RC6B 4LQVA 2V2RA 4M33A 5D8SA 5LG8A 3ERZA 3PWQC 1JYBA 1R03A 1O9IA 2Z5PA 4LQJA 4DASA 2RBDA 3KXUA 4ZL6A 2WTLA 1NF4A 1YUZA 2XKQA 4LPMA 4KVRA 3BT5A 3OJ5A 3UFBA 4MXPA 3VNXA 3ISEA 2CWLA 3AF8X 3IQ1A 3C1ZA 5E1UA 3WVWA 3E1PA 5GU1X 3RGDA 1TJOA 3F38A 2CEIA 2C2FA 1VEQA 2X170 2ZG8X 5FFCA 2YW7A 1RCCA 3E1JA 2WLUA 2V8UA 3E6SA 3PVTA 3NOZX 1UVHA 2FG8A 2CN6A 5JKLA 2N02A 4YKHA 4CVRA 4TOCA 1S2ZA 3NP2X 5GU2X 5CMRA 3A9QA 3L0MA 3BVKA 1TK6A 4ITWA 4YXJA 1XZ1A 3SIDA 5J8WA 4YVZA 3F37A 5D8XA 3KX9A 1RCEA 5CZUA 3WVVA 3PW1B 3GGZA 4RC7B 5GOUA 5I4JA 2GYQA 5J8SA 3SE1A 3BVLA 1VELA 3E1NA 2V8TA 2Z6MA 4PG0A 1NNQA 4ISMA 4ZKWA 2V2MA 3E1QA 3IS7A 5GN8B 4W4KB 2MGYA 2JD80 3QHBA 4ZLWA 3GHQA 4KVSA 1H96A 3KA8A 1VLGA 2IU2A 4CYBA 2Z5QA 1ZS3A 3PZAA 2C2JA 4XKUA 4REUA 4E40A 4DI0A 3AK8A 3GE4A 2XJNA 5D8YA 5IX6A 3PWFA 3HL1A 4ZKXA 3FI6A 5D8OA 4E6KA 2C2UA 1TKPA 3PVYA 2CIHA 5D8RA 3PVRA 4ITTA 1SOFA 2C41A 2GS4A 3UOFA 2BK6A 1RCGA 4LPNA 3KA9A 4KVQA 5J9VA 4P18A 1RCDA 3VV9A 2XJMA 1S30A 4LQNA 1LB3A 3WVUA 4XKTA 2VXIA 2C6RA 1KRQA 4DE6A 1LKMA 4LPJA 3PVTB 4CY9A 3IS8A 3KWOA 4CVSA 3MPSA 2CF7A 1JTSA 2FG4A 3F32A 1BCFA 2ZURX 4OYNA 3JZ9A 3V3KB 3DBYA 4MKUA 2G4HA 3R2RA 3BVIA 4II4A 5FFDA 3RE7A 3EZ0A 2FL0A 4IWJA 3H7GA 1QGHA 4XKSA 4MUDA 4RC5A 4Y08A 4CYAA 2YJKA 2CN7A 5AXSA 3FRSA 4LYUA 2V2PA 3BVFA 2IY4A 4WJG4 4Z3BA 5JKMA 1VJXA 2IB0A 1Z6OM 4TOEA 4IWKA 3Q4QA 2Y44A 1HRSA 5FFAA 3BVEA 5HQOA 1ZUJA 5C6FA 1B71A 4TOBA 3Q4RA 4ERUA 3M6JA 5HJFA 2G38B 2V2JA 4TW3A 4EVEA 3R2SA 1F33A 3GGYA 4TODA 5JKLG 5JKMG 3PVYB 3PVRB 4ZTTA 3E1OA 3EZUA 1TKOA 3UNOA 1BG7A 4LYXA 2XJOA 4ML5A 3AF9X 2Z90A 3KA6A 2F7NA 2ZA8A 2BW1A 1Z4AA 1NFVA 3FVBA 4EVDA 1JKUA 4CVTA 4DYUA 1GWGA 3GVYA 3PW8C 2ZA6A 3FRRA 2HTNA 3QHCA 2YJJA 4MJYA 5FEJA 2UX1A 2QQYA 3R2OA 4ISPA 4DZ0A 2ZG7X 1AEWA 2CLBA 1L8HA 1JKVA 3R2KA 3QVDA 3F34A 1MFRA 3SHXA 3RD0A 4EVBA 5HJHA 2FHAA 1Z6OA 1JGCA 4II4B 1S3QA 3WNWA 3KA3A 2FZFA 4XGSA 3Q4OA 3AJPA 1DPSA 1XZ3A 4RC5B 4KXRB 4AM5A 1JREA 4ZMCA 4CVPA 2FKZA 1N1QA 2CLUA 3A68A 4AM2A 3E2CA 3E1MA 5FFEA 3KA4A 4M34A 3LKDA 2V2OA 4DYYA 4A25A 4DYXA 4MN9A 3RAVA 4IXKA 2V2LA 2OH3A 2YW6A 3C1YA 5CMQA 5HU6D 4RC8A 4YXMA 3E6RA 3ISFA 3FSEA 1VEIA 4W4LB 3AK9A 1J30A 2V2SA 2FJCA 1RYTA 3RBCA 4M35A 2WWXB 4M32A 3JZAB 3VVAA 5JDOA 1JIGA 3ES3A 2CHIA 3N6OA 4LQHA 3QD8A 1YUXA 2PYBA 4TOHA 3KDQA 2V2NA 3Q4NA 4EVCA 3F35A 1NF6A 3AJOA 5LS9A 3QB9A 4ZKHA 3BKNA 2HR5A 3UOIA 3OGHA 4RC6A 2V2IA 3QZ3A 2FFXJ 5D8QA 3R2LA 1RCIA 1YV1A 3TA8A 2W0OA 5D8PA 4DYZA 2Z5RA 2ZG9X 4X0JA 3PW8A 3T9JA 2QF9A 4PG1A 5E2DA 1EUMA 2BJYA 1OTKA 3AF7X 1SQ3A 4TOFA 3EGMA 3AJQA 2XGWA 1IERA 1QYBA 3F33A 4MY7A 2CHPA 3W54A 2GYDA 2WLAA 3R2MA 4TOAA 2JD60 2VZBA 1F30A 4U3GA 5LBHA 5JACA 5K53A 5LG2A 5FFBA
chains in the Genus database with same CATH topology
5GU0X 4PGIA 1LKOA 3SH6A 2V15A 2VXXA 4QUWA 2AR0A 1LKPA 4TOGA 5ERKA 4CMYA 2ITBA 3O7RA 4ETRA 1DATA 3PW1A 1FHAA 3C21A 2D5KA 4RC7A 1JI4A 3O7SA 1O9RA 2ZA7A 3C23A 4TO9A 3D19A 1IESA 4PGKA 1JI5A 5K52A 2Y3QA 2JD70 5GU3X 5GN8A 4ZJKA 4Z5SA 5JDOB 3F36A 3E1LA 3HIUA 3PWQA 2OKCA 2BKCA 1DVBA 1MOJA 2OC5A 4AM4A 3U90A 5ERJA 3NP0X 5J93A 3KHKA 3R2HA 4ZL5A 1UMNA 4R42A 1L8IA 3F39A 1BFRA 4CMYV 4RC6B 4LQVA 2V2RA 4M33A 5D8SA 5LG8A 3ERZA 3PWQC 1JYBA 1R03A 1O9IA 2Z5PA 4LQJA 4DASA 2RBDA 3KXUA 4ZL6A 2WTLA 1NF4A 1YUZA 2XKQA 4LPMA 4KVRA 3BT5A 3OJ5A 3UFBA 4MXPA 3VNXA 3ISEA 2CWLA 3AF8X 3IQ1A 3C1ZA 5E1UA 3WVWA 3E1PA 5GU1X 3RGDA 1TJOA 3F38A 2CEIA 2C2FA 1VEQA 2X170 2ZG8X 5FFCA 2YW7A 1RCCA 3E1JA 2WLUA 2V8UA 3E6SA 3PVTA 3NOZX 1UVHA 2FG8A 2CN6A 5JKLA 2N02A 4YKHA 4CVRA 4TOCA 1S2ZA 3NP2X 5GU2X 5CMRA 3A9QA 3L0MA 3BVKA 1TK6A 4ITWA 4YXJA 1XZ1A 3SIDA 5J8WA 4YVZA 3F37A 5D8XA 3KX9A 1RCEA 5CZUA 3WVVA 3PW1B 3GGZA 4RC7B 5GOUA 5I4JA 2GYQA 5J8SA 3SE1A 3BVLA 1VELA 3E1NA 2V8TA 2Z6MA 4PG0A 1NNQA 4ISMA 4ZKWA 2V2MA 3E1QA 3IS7A 5GN8B 4W4KB 2MGYA 2JD80 3QHBA 4ZLWA 3GHQA 4KVSA 1H96A 3KA8A 1VLGA 2IU2A 4CYBA 2Z5QA 1ZS3A 3PZAA 2C2JA 4XKUA 4REUA 4E40A 4DI0A 3AK8A 3GE4A 2XJNA 5D8YA 5IX6A 3PWFA 3HL1A 4ZKXA 3FI6A 5D8OA 4E6KA 2C2UA 1TKPA 3PVYA 2CIHA 5D8RA 3PVRA 4ITTA 1SOFA 2C41A 2GS4A 3UOFA 2BK6A 1RCGA 4LPNA 3KA9A 4KVQA 5J9VA 4P18A 1RCDA 3VV9A 2XJMA 1S30A 4LQNA 1LB3A 3WVUA 4XKTA 2VXIA 2C6RA 1KRQA 4DE6A 1LKMA 4LPJA 3PVTB 4CY9A 3IS8A 3KWOA 4CVSA 3MPSA 2CF7A 1JTSA 2FG4A 3F32A 1BCFA 2ZURX 4OYNA 3JZ9A 3V3KB 3DBYA 4MKUA 2G4HA 3R2RA 3BVIA 4II4A 5FFDA 3RE7A 3EZ0A 2FL0A 4IWJA 3H7GA 1QGHA 4XKSA 4MUDA 4RC5A 4Y08A 4CYAA 2YJKA 2CN7A 5AXSA 3FRSA 4LYUA 2V2PA 3BVFA 2IY4A 4WJG4 4Z3BA 5JKMA 1VJXA 2IB0A 1Z6OM 4TOEA 4IWKA 3Q4QA 2Y44A 1HRSA 5FFAA 3BVEA 5HQOA 1ZUJA 5C6FA 1B71A 4TOBA 3Q4RA 4ERUA 3M6JA 5HJFA 2G38B 2V2JA 4TW3A 4EVEA 3R2SA 1F33A 3GGYA 4TODA 5JKLG 5JKMG 3PVYB 3PVRB 4ZTTA 3E1OA 3EZUA 1TKOA 3UNOA 1BG7A 4LYXA 2XJOA 4ML5A 3AF9X 2Z90A 3KA6A 2F7NA 2ZA8A 2BW1A 1Z4AA 1NFVA 3FVBA 4EVDA 1JKUA 4CVTA 4DYUA 1GWGA 3GVYA 3PW8C 2ZA6A 3FRRA 2HTNA 3QHCA 2YJJA 4MJYA 5FEJA 2UX1A 2QQYA 3R2OA 4ISPA 4DZ0A 2ZG7X 1AEWA 2CLBA 1L8HA 1JKVA 3R2KA 3QVDA 3F34A 1MFRA 3SHXA 3RD0A 4EVBA 5HJHA 2FHAA 1Z6OA 1JGCA 4II4B 1S3QA 3WNWA 3KA3A 2FZFA 4XGSA 3Q4OA 3AJPA 1DPSA 1XZ3A 4RC5B 4KXRB 4AM5A 1JREA 4ZMCA 4CVPA 2FKZA 1N1QA 2CLUA 3A68A 4AM2A 3E2CA 3E1MA 5FFEA 3KA4A 4M34A 3LKDA 2V2OA 4DYYA 4A25A 4DYXA 4MN9A 3RAVA 4IXKA 2V2LA 2OH3A 2YW6A 3C1YA 5CMQA 5HU6D 4RC8A 4YXMA 3E6RA 3ISFA 3FSEA 1VEIA 4W4LB 3AK9A 1J30A 2V2SA 2FJCA 1RYTA 3RBCA 4M35A 2WWXB 4M32A 3JZAB 3VVAA 5JDOA 1JIGA 3ES3A 2CHIA 3N6OA 4LQHA 3QD8A 1YUXA 2PYBA 4TOHA 3KDQA 2V2NA 3Q4NA 4EVCA 3F35A 1NF6A 3AJOA 5LS9A 3QB9A 4ZKHA 3BKNA 2HR5A 3UOIA 3OGHA 4RC6A 2V2IA 3QZ3A 2FFXJ 5D8QA 3R2LA 1RCIA 1YV1A 3TA8A 2W0OA 5D8PA 4DYZA 2Z5RA 2ZG9X 4X0JA 3PW8A 3T9JA 2QF9A 4PG1A 5E2DA 1EUMA 2BJYA 1OTKA 3AF7X 1SQ3A 4TOFA 3EGMA 3AJQA 2XGWA 1IERA 1QYBA 3F33A 4MY7A 2CHPA 3W54A 2GYDA 2WLAA 3R2MA 4TOAA 2JD60 2VZBA 1F30A 4U3GA 5LBHA 5JACA 5K53A 5LG2A 5FFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GU0 X;  4PGI A;  1LKO A;  3SH6 A;  2V15 A;  2VXX A;  4QUW A;  1LKP A;  4TOG A;  5ERK A;  4CMY A;  2ITB A;  3O7R A;  4ETR A;  1DAT A;  3PW1 A;  1FHA A;  2D5K A;  4RC7 A;  1JI4 A;  3O7S A;  1O9R A;  2ZA7 A;  4TO9 A;  1IES A;  4PGK A;  1JI5 A;  5K52 A;  2Y3Q A;  2JD7 0;  5GU3 X;  5GN8 A;  4ZJK A;  4Z5S A;  3F36 A;  3E1L A;  3HIU A;  3PWQ A;  2BKC A;  1DVB A;  1MOJ A;  2OC5 A;  4AM4 A;  3U90 A;  5ERJ A;  3NP0 X;  5J93 A;  3R2H A;  4ZL5 A;  1UMN A;  4R42 A;  1L8I A;  3F39 A;  1BFR A;  4CMY V;  4RC6 B;  4LQV A;  2V2R A;  4M33 A;  5D8S A;  5LG8 A;  3ERZ A;  3PWQ C;  1JYB A;  1R03 A;  1O9I A;  2Z5P A;  4LQJ A;  4DAS A;  2RBD A;  3KXU A;  4ZL6 A;  2WTL A;  4LPM A;  1NF4 A;  1YUZ A;  2XKQ A;  4KVR A;  3BT5 A;  3OJ5 A;  3VNX A;  3ISE A;  3AF8 X;  3IQ1 A;  5E1U A;  3WVW A;  3E1P A;  5GU1 X;  3RGD A;  1TJO A;  3F38 A;  2CEI A;  2C2F A;  1VEQ A;  2X17 0;  2ZG8 X;  5FFC A;  2YW7 A;  1RCC A;  3E1J A;  2WLU A;  3E6S A;  3PVT A;  3NOZ X;  1UVH A;  2FG8 A;  2CN6 A;  5JKL A;  4YKH A;  4CVR A;  4TOC A;  1S2Z A;  3NP2 X;  5GU2 X;  5CMR A;  3A9Q A;  3BVK A;  1TK6 A;  4ITW A;  1XZ1 A;  3SID A;  5J8W A;  3F37 A;  5D8X A;  3KX9 A;  1RCE A;  5CZU A;  3WVV A;  3PW1 B;  4RC7 B;  5GOU A;  5I4J A;  2GYQ A;  5J8S A;  3SE1 A;  3BVL A;  1VEL A;  3E1N A;  2Z6M A;  4PG0 A;  1NNQ A;  4ISM A;  4ZKW A;  2V2M A;  3E1Q A;  3IS7 A;  5GN8 B;  2JD8 0;  3QHB A;  4ZLW A;  3GHQ A;  4KVS A;  1H96 A;  3KA8 A;  1VLG A;  2IU2 A;  4CYB A;  2Z5Q A;  1ZS3 A;  3PZA A;  2C2J A;  4XKU A;  4REU A;  4DI0 A;  3AK8 A;  3GE4 A;  2XJN A;  5D8Y A;  5IX6 A;  3PWF A;  3HL1 A;  4ZKX A;  3FI6 A;  5D8O A;  4E6K A;  2C2U A;  1TKP A;  3PVY A;  2CIH A;  5D8R A;  3PVR A;  4ITT A;  1SOF A;  2C41 A;  2GS4 A;  3UOF A;  2BK6 A;  1RCG A;  4LPN A;  3KA9 A;  4KVQ A;  5J9V A;  4P18 A;  1RCD A;  2XJM A;  1S30 A;  4LQN A;  1LB3 A;  3WVU A;  4XKT A;  2VXI A;  2C6R A;  1KRQ A;  4DE6 A;  4LPJ A;  1LKM A;  3PVT B;  4CY9 A;  3IS8 A;  3KWO A;  4CVS A;  3MPS A;  2CF7 A;  1JTS A;  2FG4 A;  3F32 A;  1BCF A;  2ZUR X;  4OYN A;  4MKU A;  2G4H A;  3R2R A;  3BVI A;  4II4 A;  5FFD A;  3RE7 A;  3EZ0 A;  2FL0 A;  4IWJ A;  3H7G A;  1QGH A;  4XKS A;  4MUD A;  4RC5 A;  4Y08 A;  4CYA A;  2YJK A;  2CN7 A;  5AXS A;  4LYU A;  2V2P A;  3BVF A;  2IY4 A;  4Z3B A;  5JKM A;  1VJX A;  2IB0 A;  1Z6O M;  4TOE A;  4IWK A;  3Q4Q A;  1HRS A;  5FFA A;  3BVE A;  5HQO A;  1ZUJ A;  5C6F A;  1B71 A;  4TOB A;  3Q4R A;  4ERU A;  5HJF A;  2V2J A;  4TW3 A;  4EVE A;  3R2S A;  1F33 A;  5JKM G;  4TOD A;  5JKL G;  3PVY B;  3PVR B;  4ZTT A;  3E1O A;  3EZU A;  1TKO A;  3UNO A;  1BG7 A;  4LYX A;  4ML5 A;  2XJO A;  3AF9 X;  2Z90 A;  3KA6 A;  2F7N A;  2ZA8 A;  2BW1 A;  1Z4A A;  1NFV A;  3FVB A;  4EVD A;  1JKU A;  4CVT A;  4DYU A;  1GWG A;  3GVY A;  3PW8 C;  2ZA6 A;  2HTN A;  3QHC A;  2YJJ A;  4MJY A;  5FEJ A;  2UX1 A;  2QQY A;  3R2O A;  4ISP A;  4DZ0 A;  2ZG7 X;  1AEW A;  2CLB A;  1L8H A;  1JKV A;  3R2K A;  3QVD A;  3F34 A;  1MFR A;  3SHX A;  3RD0 A;  4EVB A;  5HJH A;  2FHA A;  1Z6O A;  1JGC A;  4II4 B;  1S3Q A;  3WNW A;  3KA3 A;  2FZF A;  4XGS A;  3Q4O A;  3AJP A;  1DPS A;  1XZ3 A;  4RC5 B;  4AM5 A;  1JRE A;  4ZMC A;  4CVP A;  2FKZ A;  1N1Q A;  2CLU A;  3A68 A;  4AM2 A;  3E2C A;  3E1M A;  5FFE A;  3KA4 A;  4M34 A;  2V2O A;  4DYY A;  4A25 A;  4DYX A;  4MN9 A;  3RAV A;  4IXK A;  2V2L A;  2OH3 A;  2YW6 A;  5CMQ A;  4RC8 A;  3E6R A;  3ISF A;  3FSE A;  1VEI A;  3AK9 A;  1J30 A;  2V2S A;  2FJC A;  1RYT A;  3RBC A;  4M35 A;  4M32 A;  1JIG A;  3ES3 A;  2CHI A;  4LQH A;  3QD8 A;  1YUX A;  2PYB A;  4TOH A;  2V2N A;  3Q4N A;  4EVC A;  3F35 A;  1NF6 A;  3AJO A;  5LS9 A;  3QB9 A;  4ZKH A;  3BKN A;  2HR5 A;  3UOI A;  3OGH A;  4RC6 A;  2V2I A;  3QZ3 A;  2FFX J;  5D8Q A;  3R2L A;  1RCI A;  1YV1 A;  3TA8 A;  2W0O A;  5D8P A;  4DYZ A;  2Z5R A;  2ZG9 X;  3PW8 A;  3T9J A;  2QF9 A;  4PG1 A;  5E2D A;  1EUM A;  2BJY A;  1OTK A;  3AF7 X;  1SQ3 A;  4TOF A;  3EGM A;  3AJQ A;  2XGW A;  1IER A;  1QYB A;  3F33 A;  4MY7 A;  2CHP A;  2GYD A;  2WLA A;  3R2M A;  4TOA A;  2JD6 0;  2VZB A;  1F30 A;  4U3G A;  5LBH A;  5JAC A;  5K53 A;  5LG2 A;  5FFB A; 
#chains in the Genus database with same CATH topology
 5GU0 X;  4PGI A;  1LKO A;  3SH6 A;  2V15 A;  2VXX A;  4QUW A;  2AR0 A;  1LKP A;  4TOG A;  5ERK A;  4CMY A;  2ITB A;  3O7R A;  4ETR A;  1DAT A;  3PW1 A;  1FHA A;  3C21 A;  2D5K A;  4RC7 A;  1JI4 A;  3O7S A;  1O9R A;  2ZA7 A;  3C23 A;  4TO9 A;  3D19 A;  1IES A;  4PGK A;  1JI5 A;  5K52 A;  2Y3Q A;  2JD7 0;  5GU3 X;  5GN8 A;  4ZJK A;  4Z5S A;  5JDO B;  3F36 A;  3E1L A;  3HIU A;  3PWQ A;  2OKC A;  2BKC A;  1DVB A;  1MOJ A;  2OC5 A;  4AM4 A;  3U90 A;  5ERJ A;  3NP0 X;  5J93 A;  3KHK A;  3R2H A;  4ZL5 A;  1UMN A;  4R42 A;  1L8I A;  3F39 A;  1BFR A;  4CMY V;  4RC6 B;  4LQV A;  2V2R A;  4M33 A;  5D8S A;  5LG8 A;  3ERZ A;  3PWQ C;  1JYB A;  1R03 A;  1O9I A;  2Z5P A;  4LQJ A;  4DAS A;  2RBD A;  3KXU A;  4ZL6 A;  2WTL A;  1NF4 A;  1YUZ A;  2XKQ A;  4LPM A;  4KVR A;  3BT5 A;  3OJ5 A;  3UFB A;  4MXP A;  3VNX A;  3ISE A;  2CWL A;  3AF8 X;  3IQ1 A;  3C1Z A;  5E1U A;  3WVW A;  3E1P A;  5GU1 X;  3RGD A;  1TJO A;  3F38 A;  2CEI A;  2C2F A;  1VEQ A;  2X17 0;  2ZG8 X;  5FFC A;  2YW7 A;  1RCC A;  3E1J A;  2WLU A;  2V8U A;  3E6S A;  3PVT A;  3NOZ X;  1UVH A;  2FG8 A;  2CN6 A;  5JKL A;  2N02 A;  4YKH A;  4CVR A;  4TOC A;  1S2Z A;  3NP2 X;  5GU2 X;  5CMR A;  3A9Q A;  3L0M A;  3BVK A;  1TK6 A;  4ITW A;  4YXJ A;  1XZ1 A;  3SID A;  5J8W A;  4YVZ A;  3F37 A;  5D8X A;  3KX9 A;  1RCE A;  5CZU A;  3WVV A;  3PW1 B;  3GGZ A;  4RC7 B;  5GOU A;  5I4J A;  2GYQ A;  5J8S A;  3SE1 A;  3BVL A;  1VEL A;  3E1N A;  2V8T A;  2Z6M A;  4PG0 A;  1NNQ A;  4ISM A;  4ZKW A;  2V2M A;  3E1Q A;  3IS7 A;  5GN8 B;  4W4K B;  2MGY A;  2JD8 0;  3QHB A;  4ZLW A;  3GHQ A;  4KVS A;  1H96 A;  3KA8 A;  1VLG A;  2IU2 A;  4CYB A;  2Z5Q A;  1ZS3 A;  3PZA A;  2C2J A;  4XKU A;  4REU A;  4E40 A;  4DI0 A;  3AK8 A;  3GE4 A;  2XJN A;  5D8Y A;  5IX6 A;  3PWF A;  3HL1 A;  4ZKX A;  3FI6 A;  5D8O A;  4E6K A;  2C2U A;  1TKP A;  3PVY A;  2CIH A;  5D8R A;  3PVR A;  4ITT A;  1SOF A;  2C41 A;  2GS4 A;  3UOF A;  2BK6 A;  1RCG A;  4LPN A;  3KA9 A;  4KVQ A;  5J9V A;  4P18 A;  1RCD A;  3VV9 A;  2XJM A;  1S30 A;  4LQN A;  1LB3 A;  3WVU A;  4XKT A;  2VXI A;  2C6R A;  1KRQ A;  4DE6 A;  1LKM A;  4LPJ A;  3PVT B;  4CY9 A;  3IS8 A;  3KWO A;  4CVS A;  3MPS A;  2CF7 A;  1JTS A;  2FG4 A;  3F32 A;  1BCF A;  2ZUR X;  4OYN A;  3JZ9 A;  3V3K B;  3DBY A;  4MKU A;  2G4H A;  3R2R A;  3BVI A;  4II4 A;  5FFD A;  3RE7 A;  3EZ0 A;  2FL0 A;  4IWJ A;  3H7G A;  1QGH A;  4XKS A;  4MUD A;  4RC5 A;  4Y08 A;  4CYA A;  2YJK A;  2CN7 A;  5AXS A;  3FRS A;  4LYU A;  2V2P A;  3BVF A;  2IY4 A;  4WJG 4;  4Z3B A;  5JKM A;  1VJX A;  2IB0 A;  1Z6O M;  4TOE A;  4IWK A;  3Q4Q A;  2Y44 A;  1HRS A;  5FFA A;  3BVE A;  5HQO A;  1ZUJ A;  5C6F A;  1B71 A;  4TOB A;  3Q4R A;  4ERU A;  3M6J A;  5HJF A;  2G38 B;  2V2J A;  4TW3 A;  4EVE A;  3R2S A;  1F33 A;  3GGY A;  4TOD A;  5JKL G;  5JKM G;  3PVY B;  3PVR B;  4ZTT A;  3E1O A;  3EZU A;  1TKO A;  3UNO A;  1BG7 A;  4LYX A;  2XJO A;  4ML5 A;  3AF9 X;  2Z90 A;  3KA6 A;  2F7N A;  2ZA8 A;  2BW1 A;  1Z4A A;  1NFV A;  3FVB A;  4EVD A;  1JKU A;  4CVT A;  4DYU A;  1GWG A;  3GVY A;  3PW8 C;  2ZA6 A;  3FRR A;  2HTN A;  3QHC A;  2YJJ A;  4MJY A;  5FEJ A;  2UX1 A;  2QQY A;  3R2O A;  4ISP A;  4DZ0 A;  2ZG7 X;  1AEW A;  2CLB A;  1L8H A;  1JKV A;  3R2K A;  3QVD A;  3F34 A;  1MFR A;  3SHX A;  3RD0 A;  4EVB A;  5HJH A;  2FHA A;  1Z6O A;  1JGC A;  4II4 B;  1S3Q A;  3WNW A;  3KA3 A;  2FZF A;  4XGS A;  3Q4O A;  3AJP A;  1DPS A;  1XZ3 A;  4RC5 B;  4KXR B;  4AM5 A;  1JRE A;  4ZMC A;  4CVP A;  2FKZ A;  1N1Q A;  2CLU A;  3A68 A;  4AM2 A;  3E2C A;  3E1M A;  5FFE A;  3KA4 A;  4M34 A;  3LKD A;  2V2O A;  4DYY A;  4A25 A;  4DYX A;  4MN9 A;  3RAV A;  4IXK A;  2V2L A;  2OH3 A;  2YW6 A;  3C1Y A;  5CMQ A;  5HU6 D;  4RC8 A;  4YXM A;  3E6R A;  3ISF A;  3FSE A;  1VEI A;  4W4L B;  3AK9 A;  1J30 A;  2V2S A;  2FJC A;  1RYT A;  3RBC A;  4M35 A;  2WWX B;  4M32 A;  3JZA B;  3VVA A;  5JDO A;  1JIG A;  3ES3 A;  2CHI A;  3N6O A;  4LQH A;  3QD8 A;  1YUX A;  2PYB A;  4TOH A;  3KDQ A;  2V2N A;  3Q4N A;  4EVC A;  3F35 A;  1NF6 A;  3AJO A;  5LS9 A;  3QB9 A;  4ZKH A;  3BKN A;  2HR5 A;  3UOI A;  3OGH A;  4RC6 A;  2V2I A;  3QZ3 A;  2FFX J;  5D8Q A;  3R2L A;  1RCI A;  1YV1 A;  3TA8 A;  2W0O A;  5D8P A;  4DYZ A;  2Z5R A;  2ZG9 X;  4X0J A;  3PW8 A;  3T9J A;  2QF9 A;  4PG1 A;  5E2D A;  1EUM A;  2BJY A;  1OTK A;  3AF7 X;  1SQ3 A;  4TOF A;  3EGM A;  3AJQ A;  2XGW A;  1IER A;  1QYB A;  3F33 A;  4MY7 A;  2CHP A;  3W54 A;  2GYD A;  2WLA A;  3R2M A;  4TOA A;  2JD6 0;  2VZB A;  1F30 A;  4U3G A;  5LBH A;  5JAC A;  5K53 A;  5LG2 A;  5FFB A; 
#chains in the Genus database with same CATH homology
 5GU0 X;  4PGI A;  1LKO A;  3SH6 A;  2V15 A;  2VXX A;  4QUW A;  2AR0 A;  1LKP A;  4TOG A;  5ERK A;  4CMY A;  2ITB A;  3O7R A;  4ETR A;  1DAT A;  3PW1 A;  1FHA A;  3C21 A;  2D5K A;  4RC7 A;  1JI4 A;  3O7S A;  1O9R A;  2ZA7 A;  3C23 A;  4TO9 A;  3D19 A;  1IES A;  4PGK A;  1JI5 A;  5K52 A;  2Y3Q A;  2JD7 0;  5GU3 X;  5GN8 A;  4ZJK A;  4Z5S A;  5JDO B;  3F36 A;  3E1L A;  3HIU A;  3PWQ A;  2OKC A;  2BKC A;  1DVB A;  1MOJ A;  2OC5 A;  4AM4 A;  3U90 A;  5ERJ A;  3NP0 X;  5J93 A;  3KHK A;  3R2H A;  4ZL5 A;  1UMN A;  4R42 A;  1L8I A;  3F39 A;  1BFR A;  4CMY V;  4RC6 B;  4LQV A;  2V2R A;  4M33 A;  5D8S A;  5LG8 A;  3ERZ A;  3PWQ C;  1JYB A;  1R03 A;  1O9I A;  2Z5P A;  4LQJ A;  4DAS A;  2RBD A;  3KXU A;  4ZL6 A;  2WTL A;  1NF4 A;  1YUZ A;  2XKQ A;  4LPM A;  4KVR A;  3BT5 A;  3OJ5 A;  3UFB A;  4MXP A;  3VNX A;  3ISE A;  2CWL A;  3AF8 X;  3IQ1 A;  3C1Z A;  5E1U A;  3WVW A;  3E1P A;  5GU1 X;  3RGD A;  1TJO A;  3F38 A;  2CEI A;  2C2F A;  1VEQ A;  2X17 0;  2ZG8 X;  5FFC A;  2YW7 A;  1RCC A;  3E1J A;  2WLU A;  2V8U A;  3E6S A;  3PVT A;  3NOZ X;  1UVH A;  2FG8 A;  2CN6 A;  5JKL A;  2N02 A;  4YKH A;  4CVR A;  4TOC A;  1S2Z A;  3NP2 X;  5GU2 X;  5CMR A;  3A9Q A;  3L0M A;  3BVK A;  1TK6 A;  4ITW A;  4YXJ A;  1XZ1 A;  3SID A;  5J8W A;  4YVZ A;  3F37 A;  5D8X A;  3KX9 A;  1RCE A;  5CZU A;  3WVV A;  3PW1 B;  3GGZ A;  4RC7 B;  5GOU A;  5I4J A;  2GYQ A;  5J8S A;  3SE1 A;  3BVL A;  1VEL A;  3E1N A;  2V8T A;  2Z6M A;  4PG0 A;  1NNQ A;  4ISM A;  4ZKW A;  2V2M A;  3E1Q A;  3IS7 A;  5GN8 B;  4W4K B;  2MGY A;  2JD8 0;  3QHB A;  4ZLW A;  3GHQ A;  4KVS A;  1H96 A;  3KA8 A;  1VLG A;  2IU2 A;  4CYB A;  2Z5Q A;  1ZS3 A;  3PZA A;  2C2J A;  4XKU A;  4REU A;  4E40 A;  4DI0 A;  3AK8 A;  3GE4 A;  2XJN A;  5D8Y A;  5IX6 A;  3PWF A;  3HL1 A;  4ZKX A;  3FI6 A;  5D8O A;  4E6K A;  2C2U A;  1TKP A;  3PVY A;  2CIH A;  5D8R A;  3PVR A;  4ITT A;  1SOF A;  2C41 A;  2GS4 A;  3UOF A;  2BK6 A;  1RCG A;  4LPN A;  3KA9 A;  4KVQ A;  5J9V A;  4P18 A;  1RCD A;  3VV9 A;  2XJM A;  1S30 A;  4LQN A;  1LB3 A;  3WVU A;  4XKT A;  2VXI A;  2C6R A;  1KRQ A;  4DE6 A;  1LKM A;  4LPJ A;  3PVT B;  4CY9 A;  3IS8 A;  3KWO A;  4CVS A;  3MPS A;  2CF7 A;  1JTS A;  2FG4 A;  3F32 A;  1BCF A;  2ZUR X;  4OYN A;  3JZ9 A;  3V3K B;  3DBY A;  4MKU A;  2G4H A;  3R2R A;  3BVI A;  4II4 A;  5FFD A;  3RE7 A;  3EZ0 A;  2FL0 A;  4IWJ A;  3H7G A;  1QGH A;  4XKS A;  4MUD A;  4RC5 A;  4Y08 A;  4CYA A;  2YJK A;  2CN7 A;  5AXS A;  3FRS A;  4LYU A;  2V2P A;  3BVF A;  2IY4 A;  4WJG 4;  4Z3B A;  5JKM A;  1VJX A;  2IB0 A;  1Z6O M;  4TOE A;  4IWK A;  3Q4Q A;  2Y44 A;  1HRS A;  5FFA A;  3BVE A;  5HQO A;  1ZUJ A;  5C6F A;  1B71 A;  4TOB A;  3Q4R A;  4ERU A;  3M6J A;  5HJF A;  2G38 B;  2V2J A;  4TW3 A;  4EVE A;  3R2S A;  1F33 A;  3GGY A;  4TOD A;  5JKL G;  5JKM G;  3PVY B;  3PVR B;  4ZTT A;  3E1O A;  3EZU A;  1TKO A;  3UNO A;  1BG7 A;  4LYX A;  2XJO A;  4ML5 A;  3AF9 X;  2Z90 A;  3KA6 A;  2F7N A;  2ZA8 A;  2BW1 A;  1Z4A A;  1NFV A;  3FVB A;  4EVD A;  1JKU A;  4CVT A;  4DYU A;  1GWG A;  3GVY A;  3PW8 C;  2ZA6 A;  3FRR A;  2HTN A;  3QHC A;  2YJJ A;  4MJY A;  5FEJ A;  2UX1 A;  2QQY A;  3R2O A;  4ISP A;  4DZ0 A;  2ZG7 X;  1AEW A;  2CLB A;  1L8H A;  1JKV A;  3R2K A;  3QVD A;  3F34 A;  1MFR A;  3SHX A;  3RD0 A;  4EVB A;  5HJH A;  2FHA A;  1Z6O A;  1JGC A;  4II4 B;  1S3Q A;  3WNW A;  3KA3 A;  2FZF A;  4XGS A;  3Q4O A;  3AJP A;  1DPS A;  1XZ3 A;  4RC5 B;  4KXR B;  4AM5 A;  1JRE A;  4ZMC A;  4CVP A;  2FKZ A;  1N1Q A;  2CLU A;  3A68 A;  4AM2 A;  3E2C A;  3E1M A;  5FFE A;  3KA4 A;  4M34 A;  3LKD A;  2V2O A;  4DYY A;  4A25 A;  4DYX A;  4MN9 A;  3RAV A;  4IXK A;  2V2L A;  2OH3 A;  2YW6 A;  3C1Y A;  5CMQ A;  5HU6 D;  4RC8 A;  4YXM A;  3E6R A;  3ISF A;  3FSE A;  1VEI A;  4W4L B;  3AK9 A;  1J30 A;  2V2S A;  2FJC A;  1RYT A;  3RBC A;  4M35 A;  2WWX B;  4M32 A;  3JZA B;  3VVA A;  5JDO A;  1JIG A;  3ES3 A;  2CHI A;  3N6O A;  4LQH A;  3QD8 A;  1YUX A;  2PYB A;  4TOH A;  3KDQ A;  2V2N A;  3Q4N A;  4EVC A;  3F35 A;  1NF6 A;  3AJO A;  5LS9 A;  3QB9 A;  4ZKH A;  3BKN A;  2HR5 A;  3UOI A;  3OGH A;  4RC6 A;  2V2I A;  3QZ3 A;  2FFX J;  5D8Q A;  3R2L A;  1RCI A;  1YV1 A;  3TA8 A;  2W0O A;  5D8P A;  4DYZ A;  2Z5R A;  2ZG9 X;  4X0J A;  3PW8 A;  3T9J A;  2QF9 A;  4PG1 A;  5E2D A;  1EUM A;  2BJY A;  1OTK A;  3AF7 X;  1SQ3 A;  4TOF A;  3EGM A;  3AJQ A;  2XGW A;  1IER A;  1QYB A;  3F33 A;  4MY7 A;  2CHP A;  3W54 A;  2GYD A;  2WLA A;  3R2M A;  4TOA A;  2JD6 0;  2VZB A;  1F30 A;  4U3G A;  5LBH A;  5JAC A;  5K53 A;  5LG2 A;  5FFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...