2N02A

Solution structure of the a147t variant of the mitochondrial translocator protein (tspo) in complex with pk11195
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
169
structure length
169
Chain Sequence
MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYAGLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFTTVLNYYVWRDNSGRRGGSRLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translocator protein
publication title Structural Integrity of the A147T Polymorph of Mammalian TSPO.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 53
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2015-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03073 TspO_MBR TspO/MBR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.100 Mainly Alpha Up-down Bundle Ferritin Ferritin 2n02A01
2MGYA 2N02A
chains in the Genus database with same CATH superfamily
5LG8A 3AF8X 3WVWA 3PVYA 4YKHA 3F37A 3AJPA 5JDOB 3BKNA 5K52A 5CMQA 2BKCA 4ZLWA 3R2RA 4TODA 3RGDA 4ZMCA 4CMYA 2BK6A 1F30A 2VXIA 5FFDA 4IWKA 1BFRA 1IESA 4TOHA 3NOZX 4ZKWA 2VXXA 4KVQA 5D8XA 3F34A 2WLUA 1JKVA 3VNXA 2V2NA 3FSEA 1RCDA 3BVEA 3KA9A 5E2DA 3EGMA 1TKPA 3RAVA 4DI0A 2YW6A 3BVLA 1S2ZA 4CYAA 1JTSA 1YUZA 1FHAA 4P18A 4LYUA 4IXKA 4DYXA 4ETRA 5FFBA 1SQ3A 2JD70 4II4A 4Y08A 2XJOA 1JIGA 2WTLA 4QUWA 3SH6A 2Z5QA 3ISFA 4TOAA 1XZ3A 1BCFA 2Z90A 5GOUA 3EZ0A 4RC5B 5JDOA 3HL1A 2C2JA 3JZAB 2YJKA 3C23A 4TW3A 2FKZA 4KVRA 4CVSA 1B71A 1Z6OA 3E1OA 3BT5A 1NF6A 3C1YA 4DYZA 2ZURX 1UMNA 4LQJA 3E1NA 4M32A 3DBYA 2WWXB 3ERZA 3M6JA 1QYBA 3H7GA 4LQHA 1L8IA 2V8UA 5D8YA 4CMYV 4LPJA 3KHKA 1JI4A 3OJ5A 5LS9A 2ZG9X 2BJYA 2Z5RA 2ZA7A 4DASA 4EVCA 4YVZA 3AF9X 3O7RA 2CLUA 2CIHA 3F36A 3QHBA 3NP0X 5FFEA 2CHPA 4W4KB 3PVRB 4IWJA 5CZUA 4ITWA 5J8WA 3Q4QA 3IS8A 1VELA 1VEIA 5D8PA 1Z4AA 4ITTA 3QB9A 3SHXA 1J30A 3KA6A 4RC7B 5FFCA 3D19A 3JZ9A 3TA8A 4RC5A 5FEJA 4A25A 1OTKA 1YUXA 2Y3QA 1H96A 2OC5A 4LQVA 4DE6A 4EVEA 1ZS3A 1UVHA 3E2CA 5AXSA 4XGSA 4LYXA 3KA3A 2X170 5JKLG 5HU6D 4X0JA 3R2LA 1TKOA 1DVBA 3SIDA 2AR0A 2YW7A 2RBDA 4PGKA 1MFRA 1JKUA 3E1JA 4MUDA 4AM2A 2N02A 3ES3A 1QGHA 4TO9A 4ERUA 3KXUA 4CVPA 3R2MA 2V2LA 5GU1X 2FFXJ 2V15A 3AJQA 2FL0A 4DYUA 3PVRA 4RC6B 2C2FA 4AM5A 5D8RA 5GN8B 5JKLA 3AJOA 3HIUA 2V2JA 5ERJA 3AK9A 3E1PA 3F33A 3Q4NA 2G38B 4RC7A 1O9IA 1RCGA 1DPSA 2C6RA 4MKUA 3UOIA 5J8SA 3E1LA 2Z6MA 3RE7A 2V2RA 4E40A 4Z5SA 3EZUA 1LKOA 2XKQA 2XGWA 3FVBA 1S30A 2OKCA 3KA8A 5FFAA 4M35A 3W54A 3KWOA 4TOFA 3U90A 1JI5A 3KDQA 1NNQA 2ZG8X 3QVDA 4ML5A 4DYYA 4LQNA 1O9RA 2ZG7X 4CVRA 5E1UA 4LPNA 1RCEA 4MJYA 4CY9A 1EUMA 3C1ZA 1JREA 4XKUA 3PZAA 3RBCA 3F38A 3UOFA 1SOFA 2CN7A 2C41A 3UFBA 4DZ0A 3UNOA 4REUA 4ZL6A 4MN9A 2Z5PA 4PG0A 1S3QA 2ZA6A 3VVAA 2W0OA 2OH3A 5I4JA 3QZ3A 3O7SA 5J9VA 4XKSA 4ZKHA 2CHIA 2WLAA 4RC6A 2FJCA 5LG2A 1TK6A 5GN8A 2FZFA 3L0MA 3N6OA 3PWQA 3PWQC 4YXJA 2Y44A 2UX1A 3Q4OA 3IQ1A 2JD80 1F33A 2IB0A 3BVKA 1LKPA 3IS7A 3R2SA 1R03A 1LKMA 3QD8A 3GGZA 3A9QA 3WNWA 1IERA 2PYBA 1NFVA 2BW1A 4ISMA 2MGYA 2V2PA 2CLBA 4YXMA 3AF7X 2CF7A 3GE4A 1YV1A 5GU3X 1HRSA 3KA4A 5LBHA 2GYQA 5GU2X 4RC8A 3R2KA 5D8SA 4ZL5A 3VV9A 5GU0X 3A68A 3PW8A 3PW8C 3NP2X 4EVDA 4XKTA 2HR5A 2CN6A 4PG1A 2V8TA 1RCCA 2G4HA 1VLGA 3V3KB 1RCIA 4ISPA 3WVVA 4ZJKA 3E1QA 5JACA 4TOGA 3ISEA 3R2OA 2GYDA 3FRRA 1VEQA 2V2SA 4ZTTA 2QQYA 2ZA8A 4W4LB 4MXPA 3PW1B 4ZKXA 3E6RA 5HJHA 3C21A 4CYBA 1JGCA 4WJG4 5K53A 5JKMG 2D5KA 5ERKA 3Q4RA 3PVTB 3GGYA 5C6FA 5CMRA 2GS4A 4MY7A 4U3GA 2V2MA 2YJJA 2IY4A 3E1MA 3PWFA 2V2IA 5IX6A 2XJMA 3MPSA 3BVFA 1BG7A 1ZUJA 3PVYB 2HTNA 2V2OA 4KVSA 3T9JA 4TOBA 3LKDA 1XZ1A 4TOCA 4M33A 4EVBA 4KXRB 1JYBA 2JD60 4CVTA 2F7NA 4E6KA 4M34A 5J93A 1TJOA 2FG4A 2ITBA 5JKMA 2CEIA 3KX9A 4LPMA 1AEWA 4R42A 3GHQA 1MOJA 4AM4A 3AK8A 4TOEA 3F35A 2CWLA 3QHCA 1L8HA 1NF4A 3BVIA 1N1QA 3WVUA 3FRSA 3R2HA 4Z3BA 4OYNA 2VZBA 5HJFA 2XJNA 1VJXA 3PW1A 3SE1A 3OGHA 1GWGA 1Z6OM 5HQOA 1DATA 3F32A 2QF9A 2IU2A 5D8OA 3FI6A 4II4B 1KRQA 4PGIA 3PVTA 2FG8A 1RYTA 1LB3A 2C2UA 2FHAA 3E6SA 5D8QA 3RD0A 3F39A 3GVYA
chains in the Genus database with same CATH topology
5LG8A 3AF8X 3WVWA 3PVYA 4YKHA 3F37A 3AJPA 5JDOB 3BKNA 5K52A 5CMQA 2BKCA 4ZLWA 3R2RA 4TODA 3RGDA 4ZMCA 4CMYA 2BK6A 1F30A 2VXIA 5FFDA 4IWKA 1BFRA 1IESA 4TOHA 3NOZX 4ZKWA 2VXXA 4KVQA 5D8XA 3F34A 2WLUA 1JKVA 3VNXA 2V2NA 3FSEA 1RCDA 3BVEA 3KA9A 5E2DA 3EGMA 1TKPA 3RAVA 4DI0A 2YW6A 3BVLA 1S2ZA 4CYAA 1JTSA 1YUZA 1FHAA 4P18A 4LYUA 4IXKA 4DYXA 4ETRA 5FFBA 1SQ3A 2JD70 4II4A 4Y08A 2XJOA 1JIGA 2WTLA 4QUWA 3SH6A 2Z5QA 3ISFA 4TOAA 1XZ3A 1BCFA 2Z90A 5GOUA 3EZ0A 4RC5B 5JDOA 3HL1A 2C2JA 3JZAB 2YJKA 3C23A 4TW3A 2FKZA 4KVRA 4CVSA 1B71A 1Z6OA 3E1OA 3BT5A 1NF6A 3C1YA 4DYZA 2ZURX 1UMNA 4LQJA 3E1NA 4M32A 3DBYA 2WWXB 3ERZA 3M6JA 1QYBA 3H7GA 4LQHA 1L8IA 2V8UA 5D8YA 4CMYV 4LPJA 3KHKA 1JI4A 3OJ5A 5LS9A 2ZG9X 2BJYA 2Z5RA 2ZA7A 4DASA 4EVCA 4YVZA 3AF9X 3O7RA 2CLUA 2CIHA 3F36A 3QHBA 3NP0X 5FFEA 2CHPA 4W4KB 3PVRB 4IWJA 5CZUA 4ITWA 5J8WA 3Q4QA 3IS8A 1VELA 1VEIA 5D8PA 1Z4AA 4ITTA 3QB9A 3SHXA 1J30A 3KA6A 4RC7B 5FFCA 3D19A 3JZ9A 3TA8A 4RC5A 5FEJA 4A25A 1OTKA 1YUXA 2Y3QA 1H96A 2OC5A 4LQVA 4DE6A 4EVEA 1ZS3A 1UVHA 3E2CA 5AXSA 4XGSA 4LYXA 3KA3A 2X170 5JKLG 5HU6D 4X0JA 3R2LA 1TKOA 1DVBA 3SIDA 2AR0A 2YW7A 2RBDA 4PGKA 1MFRA 1JKUA 3E1JA 4MUDA 4AM2A 2N02A 3ES3A 1QGHA 4TO9A 4ERUA 3KXUA 4CVPA 3R2MA 2V2LA 5GU1X 2FFXJ 2V15A 3AJQA 2FL0A 4DYUA 3PVRA 4RC6B 2C2FA 4AM5A 5D8RA 5GN8B 5JKLA 3AJOA 3HIUA 2V2JA 5ERJA 3AK9A 3E1PA 3F33A 3Q4NA 2G38B 4RC7A 1O9IA 1RCGA 1DPSA 2C6RA 4MKUA 3UOIA 5J8SA 3E1LA 2Z6MA 3RE7A 2V2RA 4E40A 4Z5SA 3EZUA 1LKOA 2XKQA 2XGWA 3FVBA 1S30A 2OKCA 3KA8A 5FFAA 4M35A 3W54A 3KWOA 4TOFA 3U90A 1JI5A 3KDQA 1NNQA 2ZG8X 3QVDA 4ML5A 4DYYA 4LQNA 1O9RA 2ZG7X 4CVRA 5E1UA 4LPNA 1RCEA 4MJYA 4CY9A 1EUMA 3C1ZA 1JREA 4XKUA 3PZAA 3RBCA 3F38A 3UOFA 1SOFA 2CN7A 2C41A 3UFBA 4DZ0A 3UNOA 4REUA 4ZL6A 4MN9A 2Z5PA 4PG0A 1S3QA 2ZA6A 3VVAA 2W0OA 2OH3A 5I4JA 3QZ3A 3O7SA 5J9VA 4XKSA 4ZKHA 2CHIA 2WLAA 4RC6A 2FJCA 5LG2A 1TK6A 5GN8A 2FZFA 3L0MA 3N6OA 3PWQA 3PWQC 4YXJA 2Y44A 2UX1A 3Q4OA 3IQ1A 2JD80 1F33A 2IB0A 3BVKA 1LKPA 3IS7A 3R2SA 1R03A 1LKMA 3QD8A 3GGZA 3A9QA 3WNWA 1IERA 2PYBA 1NFVA 2BW1A 4ISMA 2MGYA 2V2PA 2CLBA 4YXMA 3AF7X 2CF7A 3GE4A 1YV1A 5GU3X 1HRSA 3KA4A 5LBHA 2GYQA 5GU2X 4RC8A 3R2KA 5D8SA 4ZL5A 3VV9A 5GU0X 3A68A 3PW8A 3PW8C 3NP2X 4EVDA 4XKTA 2HR5A 2CN6A 4PG1A 2V8TA 1RCCA 2G4HA 1VLGA 3V3KB 1RCIA 4ISPA 3WVVA 4ZJKA 3E1QA 5JACA 4TOGA 3ISEA 3R2OA 2GYDA 3FRRA 1VEQA 2V2SA 4ZTTA 2QQYA 2ZA8A 4W4LB 4MXPA 3PW1B 4ZKXA 3E6RA 5HJHA 3C21A 4CYBA 1JGCA 4WJG4 5K53A 5JKMG 2D5KA 5ERKA 3Q4RA 3PVTB 3GGYA 5C6FA 5CMRA 2GS4A 4MY7A 4U3GA 2V2MA 2YJJA 2IY4A 3E1MA 3PWFA 2V2IA 5IX6A 2XJMA 3MPSA 3BVFA 1BG7A 1ZUJA 3PVYB 2HTNA 2V2OA 4KVSA 3T9JA 4TOBA 3LKDA 1XZ1A 4TOCA 4M33A 4EVBA 4KXRB 1JYBA 2JD60 4CVTA 2F7NA 4E6KA 4M34A 5J93A 1TJOA 2FG4A 2ITBA 5JKMA 2CEIA 3KX9A 4LPMA 1AEWA 4R42A 3GHQA 1MOJA 4AM4A 3AK8A 4TOEA 3F35A 2CWLA 3QHCA 1L8HA 1NF4A 3BVIA 1N1QA 3WVUA 3FRSA 3R2HA 4Z3BA 4OYNA 2VZBA 5HJFA 2XJNA 1VJXA 3PW1A 3SE1A 3OGHA 1GWGA 1Z6OM 5HQOA 1DATA 3F32A 2QF9A 2IU2A 5D8OA 3FI6A 4II4B 1KRQA 4PGIA 3PVTA 2FG8A 1RYTA 1LB3A 2C2UA 2FHAA 3E6SA 5D8QA 3RD0A 3F39A 3GVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MGY A;  2N02 A; 
#chains in the Genus database with same CATH topology
 5LG8 A;  3AF8 X;  3WVW A;  3PVY A;  4YKH A;  3F37 A;  3AJP A;  5JDO B;  3BKN A;  5K52 A;  5CMQ A;  2BKC A;  4ZLW A;  3R2R A;  4TOD A;  3RGD A;  4ZMC A;  4CMY A;  2BK6 A;  1F30 A;  2VXI A;  5FFD A;  4IWK A;  1BFR A;  1IES A;  4TOH A;  3NOZ X;  4ZKW A;  2VXX A;  4KVQ A;  5D8X A;  3F34 A;  2WLU A;  1JKV A;  3VNX A;  2V2N A;  3FSE A;  1RCD A;  3BVE A;  3KA9 A;  5E2D A;  3EGM A;  1TKP A;  3RAV A;  4DI0 A;  2YW6 A;  3BVL A;  1S2Z A;  4CYA A;  1JTS A;  1YUZ A;  1FHA A;  4P18 A;  4LYU A;  4IXK A;  4DYX A;  4ETR A;  5FFB A;  1SQ3 A;  2JD7 0;  4II4 A;  4Y08 A;  2XJO A;  1JIG A;  2WTL A;  4QUW A;  3SH6 A;  2Z5Q A;  3ISF A;  4TOA A;  1XZ3 A;  1BCF A;  2Z90 A;  5GOU A;  3EZ0 A;  4RC5 B;  5JDO A;  3HL1 A;  2C2J A;  3JZA B;  2YJK A;  3C23 A;  4TW3 A;  2FKZ A;  4KVR A;  4CVS A;  1B71 A;  1Z6O A;  3E1O A;  3BT5 A;  1NF6 A;  3C1Y A;  4DYZ A;  2ZUR X;  1UMN A;  4LQJ A;  3E1N A;  4M32 A;  3DBY A;  2WWX B;  3ERZ A;  3M6J A;  1QYB A;  3H7G A;  4LQH A;  1L8I A;  2V8U A;  5D8Y A;  4CMY V;  4LPJ A;  3KHK A;  1JI4 A;  3OJ5 A;  5LS9 A;  2ZG9 X;  2BJY A;  2Z5R A;  2ZA7 A;  4DAS A;  4EVC A;  4YVZ A;  3AF9 X;  3O7R A;  2CLU A;  2CIH A;  3F36 A;  3QHB A;  3NP0 X;  5FFE A;  2CHP A;  4W4K B;  3PVR B;  4IWJ A;  5CZU A;  4ITW A;  5J8W A;  3Q4Q A;  3IS8 A;  1VEL A;  1VEI A;  5D8P A;  1Z4A A;  4ITT A;  3QB9 A;  3SHX A;  1J30 A;  3KA6 A;  4RC7 B;  5FFC A;  3D19 A;  3JZ9 A;  3TA8 A;  4RC5 A;  5FEJ A;  4A25 A;  1OTK A;  1YUX A;  2Y3Q A;  1H96 A;  2OC5 A;  4LQV A;  4DE6 A;  4EVE A;  1ZS3 A;  1UVH A;  3E2C A;  5AXS A;  4XGS A;  4LYX A;  3KA3 A;  2X17 0;  5JKL G;  5HU6 D;  4X0J A;  3R2L A;  1TKO A;  1DVB A;  3SID A;  2AR0 A;  2YW7 A;  2RBD A;  4PGK A;  1MFR A;  1JKU A;  3E1J A;  4MUD A;  4AM2 A;  2N02 A;  3ES3 A;  1QGH A;  4TO9 A;  4ERU A;  3KXU A;  4CVP A;  3R2M A;  2V2L A;  5GU1 X;  2FFX J;  2V15 A;  3AJQ A;  2FL0 A;  4DYU A;  3PVR A;  4RC6 B;  2C2F A;  4AM5 A;  5D8R A;  5GN8 B;  5JKL A;  3AJO A;  3HIU A;  2V2J A;  5ERJ A;  3AK9 A;  3E1P A;  3F33 A;  3Q4N A;  2G38 B;  4RC7 A;  1O9I A;  1RCG A;  1DPS A;  2C6R A;  4MKU A;  3UOI A;  5J8S A;  3E1L A;  2Z6M A;  3RE7 A;  2V2R A;  4E40 A;  4Z5S A;  3EZU A;  1LKO A;  2XKQ A;  2XGW A;  3FVB A;  1S30 A;  2OKC A;  3KA8 A;  5FFA A;  4M35 A;  3W54 A;  3KWO A;  4TOF A;  3U90 A;  1JI5 A;  3KDQ A;  1NNQ A;  2ZG8 X;  3QVD A;  4ML5 A;  4DYY A;  4LQN A;  1O9R A;  2ZG7 X;  4CVR A;  5E1U A;  4LPN A;  1RCE A;  4MJY A;  4CY9 A;  1EUM A;  3C1Z A;  1JRE A;  4XKU A;  3PZA A;  3RBC A;  3F38 A;  3UOF A;  1SOF A;  2CN7 A;  2C41 A;  3UFB A;  4DZ0 A;  3UNO A;  4REU A;  4ZL6 A;  4MN9 A;  2Z5P A;  4PG0 A;  1S3Q A;  2ZA6 A;  3VVA A;  2W0O A;  2OH3 A;  5I4J A;  3QZ3 A;  3O7S A;  5J9V A;  4XKS A;  4ZKH A;  2CHI A;  2WLA A;  4RC6 A;  2FJC A;  5LG2 A;  1TK6 A;  5GN8 A;  2FZF A;  3L0M A;  3N6O A;  3PWQ A;  3PWQ C;  4YXJ A;  2Y44 A;  2UX1 A;  3Q4O A;  3IQ1 A;  2JD8 0;  1F33 A;  2IB0 A;  3BVK A;  1LKP A;  3IS7 A;  3R2S A;  1R03 A;  1LKM A;  3QD8 A;  3GGZ A;  3A9Q A;  3WNW A;  1IER A;  2PYB A;  1NFV A;  2BW1 A;  4ISM A;  2MGY A;  2V2P A;  2CLB A;  4YXM A;  3AF7 X;  2CF7 A;  3GE4 A;  1YV1 A;  5GU3 X;  1HRS A;  3KA4 A;  5LBH A;  2GYQ A;  5GU2 X;  4RC8 A;  3R2K A;  5D8S A;  4ZL5 A;  3VV9 A;  5GU0 X;  3A68 A;  3PW8 A;  3PW8 C;  3NP2 X;  4EVD A;  4XKT A;  2HR5 A;  2CN6 A;  4PG1 A;  2V8T A;  1RCC A;  2G4H A;  1VLG A;  3V3K B;  1RCI A;  4ISP A;  3WVV A;  4ZJK A;  3E1Q A;  5JAC A;  4TOG A;  3ISE A;  3R2O A;  2GYD A;  3FRR A;  1VEQ A;  2V2S A;  4ZTT A;  2QQY A;  2ZA8 A;  4W4L B;  4MXP A;  3PW1 B;  4ZKX A;  3E6R A;  5HJH A;  3C21 A;  4CYB A;  1JGC A;  4WJG 4;  5K53 A;  5JKM G;  2D5K A;  5ERK A;  3Q4R A;  3PVT B;  3GGY A;  5C6F A;  5CMR A;  2GS4 A;  4MY7 A;  4U3G A;  2V2M A;  2YJJ A;  2IY4 A;  3E1M A;  3PWF A;  2V2I A;  5IX6 A;  2XJM A;  3MPS A;  3BVF A;  1BG7 A;  1ZUJ A;  3PVY B;  2HTN A;  2V2O A;  4KVS A;  3T9J A;  4TOB A;  3LKD A;  1XZ1 A;  4TOC A;  4M33 A;  4EVB A;  4KXR B;  1JYB A;  2JD6 0;  4CVT A;  2F7N A;  4E6K A;  4M34 A;  5J93 A;  1TJO A;  2FG4 A;  2ITB A;  5JKM A;  2CEI A;  3KX9 A;  4LPM A;  1AEW A;  4R42 A;  3GHQ A;  1MOJ A;  4AM4 A;  3AK8 A;  4TOE A;  3F35 A;  2CWL A;  3QHC A;  1L8H A;  1NF4 A;  3BVI A;  1N1Q A;  3WVU A;  3FRS A;  3R2H A;  4Z3B A;  4OYN A;  2VZB A;  5HJF A;  2XJN A;  1VJX A;  3PW1 A;  3SE1 A;  3OGH A;  1GWG A;  1Z6O M;  5HQO A;  1DAT A;  3F32 A;  2QF9 A;  2IU2 A;  5D8O A;  3FI6 A;  4II4 B;  1KRQ A;  4PGI A;  3PVT A;  2FG8 A;  1RYT A;  1LB3 A;  2C2U A;  2FHA A;  3E6S A;  5D8Q A;  3RD0 A;  3F39 A;  3GVY A; 
#chains in the Genus database with same CATH homology
 5LG8 A;  3AF8 X;  3WVW A;  3PVY A;  4YKH A;  3F37 A;  3AJP A;  5JDO B;  3BKN A;  5K52 A;  5CMQ A;  2BKC A;  4ZLW A;  3R2R A;  4TOD A;  3RGD A;  4ZMC A;  4CMY A;  2BK6 A;  1F30 A;  2VXI A;  5FFD A;  4IWK A;  1BFR A;  1IES A;  4TOH A;  3NOZ X;  4ZKW A;  2VXX A;  4KVQ A;  5D8X A;  3F34 A;  2WLU A;  1JKV A;  3VNX A;  2V2N A;  3FSE A;  1RCD A;  3BVE A;  3KA9 A;  5E2D A;  3EGM A;  1TKP A;  3RAV A;  4DI0 A;  2YW6 A;  3BVL A;  1S2Z A;  4CYA A;  1JTS A;  1YUZ A;  1FHA A;  4P18 A;  4LYU A;  4IXK A;  4DYX A;  4ETR A;  5FFB A;  1SQ3 A;  2JD7 0;  4II4 A;  4Y08 A;  2XJO A;  1JIG A;  2WTL A;  4QUW A;  3SH6 A;  2Z5Q A;  3ISF A;  4TOA A;  1XZ3 A;  1BCF A;  2Z90 A;  5GOU A;  3EZ0 A;  4RC5 B;  5JDO A;  3HL1 A;  2C2J A;  3JZA B;  2YJK A;  3C23 A;  4TW3 A;  2FKZ A;  4KVR A;  4CVS A;  1B71 A;  1Z6O A;  3E1O A;  3BT5 A;  1NF6 A;  3C1Y A;  4DYZ A;  2ZUR X;  1UMN A;  4LQJ A;  3E1N A;  4M32 A;  3DBY A;  2WWX B;  3ERZ A;  3M6J A;  1QYB A;  3H7G A;  4LQH A;  1L8I A;  2V8U A;  5D8Y A;  4CMY V;  4LPJ A;  3KHK A;  1JI4 A;  3OJ5 A;  5LS9 A;  2ZG9 X;  2BJY A;  2Z5R A;  2ZA7 A;  4DAS A;  4EVC A;  4YVZ A;  3AF9 X;  3O7R A;  2CLU A;  2CIH A;  3F36 A;  3QHB A;  3NP0 X;  5FFE A;  2CHP A;  4W4K B;  3PVR B;  4IWJ A;  5CZU A;  4ITW A;  5J8W A;  3Q4Q A;  3IS8 A;  1VEL A;  1VEI A;  5D8P A;  1Z4A A;  4ITT A;  3QB9 A;  3SHX A;  1J30 A;  3KA6 A;  4RC7 B;  5FFC A;  3D19 A;  3JZ9 A;  3TA8 A;  4RC5 A;  5FEJ A;  4A25 A;  1OTK A;  1YUX A;  2Y3Q A;  1H96 A;  2OC5 A;  4LQV A;  4DE6 A;  4EVE A;  1ZS3 A;  1UVH A;  3E2C A;  5AXS A;  4XGS A;  4LYX A;  3KA3 A;  2X17 0;  5JKL G;  5HU6 D;  4X0J A;  3R2L A;  1TKO A;  1DVB A;  3SID A;  2AR0 A;  2YW7 A;  2RBD A;  4PGK A;  1MFR A;  1JKU A;  3E1J A;  4MUD A;  4AM2 A;  2N02 A;  3ES3 A;  1QGH A;  4TO9 A;  4ERU A;  3KXU A;  4CVP A;  3R2M A;  2V2L A;  5GU1 X;  2FFX J;  2V15 A;  3AJQ A;  2FL0 A;  4DYU A;  3PVR A;  4RC6 B;  2C2F A;  4AM5 A;  5D8R A;  5GN8 B;  5JKL A;  3AJO A;  3HIU A;  2V2J A;  5ERJ A;  3AK9 A;  3E1P A;  3F33 A;  3Q4N A;  2G38 B;  4RC7 A;  1O9I A;  1RCG A;  1DPS A;  2C6R A;  4MKU A;  3UOI A;  5J8S A;  3E1L A;  2Z6M A;  3RE7 A;  2V2R A;  4E40 A;  4Z5S A;  3EZU A;  1LKO A;  2XKQ A;  2XGW A;  3FVB A;  1S30 A;  2OKC A;  3KA8 A;  5FFA A;  4M35 A;  3W54 A;  3KWO A;  4TOF A;  3U90 A;  1JI5 A;  3KDQ A;  1NNQ A;  2ZG8 X;  3QVD A;  4ML5 A;  4DYY A;  4LQN A;  1O9R A;  2ZG7 X;  4CVR A;  5E1U A;  4LPN A;  1RCE A;  4MJY A;  4CY9 A;  1EUM A;  3C1Z A;  1JRE A;  4XKU A;  3PZA A;  3RBC A;  3F38 A;  3UOF A;  1SOF A;  2CN7 A;  2C41 A;  3UFB A;  4DZ0 A;  3UNO A;  4REU A;  4ZL6 A;  4MN9 A;  2Z5P A;  4PG0 A;  1S3Q A;  2ZA6 A;  3VVA A;  2W0O A;  2OH3 A;  5I4J A;  3QZ3 A;  3O7S A;  5J9V A;  4XKS A;  4ZKH A;  2CHI A;  2WLA A;  4RC6 A;  2FJC A;  5LG2 A;  1TK6 A;  5GN8 A;  2FZF A;  3L0M A;  3N6O A;  3PWQ A;  3PWQ C;  4YXJ A;  2Y44 A;  2UX1 A;  3Q4O A;  3IQ1 A;  2JD8 0;  1F33 A;  2IB0 A;  3BVK A;  1LKP A;  3IS7 A;  3R2S A;  1R03 A;  1LKM A;  3QD8 A;  3GGZ A;  3A9Q A;  3WNW A;  1IER A;  2PYB A;  1NFV A;  2BW1 A;  4ISM A;  2MGY A;  2V2P A;  2CLB A;  4YXM A;  3AF7 X;  2CF7 A;  3GE4 A;  1YV1 A;  5GU3 X;  1HRS A;  3KA4 A;  5LBH A;  2GYQ A;  5GU2 X;  4RC8 A;  3R2K A;  5D8S A;  4ZL5 A;  3VV9 A;  5GU0 X;  3A68 A;  3PW8 A;  3PW8 C;  3NP2 X;  4EVD A;  4XKT A;  2HR5 A;  2CN6 A;  4PG1 A;  2V8T A;  1RCC A;  2G4H A;  1VLG A;  3V3K B;  1RCI A;  4ISP A;  3WVV A;  4ZJK A;  3E1Q A;  5JAC A;  4TOG A;  3ISE A;  3R2O A;  2GYD A;  3FRR A;  1VEQ A;  2V2S A;  4ZTT A;  2QQY A;  2ZA8 A;  4W4L B;  4MXP A;  3PW1 B;  4ZKX A;  3E6R A;  5HJH A;  3C21 A;  4CYB A;  1JGC A;  4WJG 4;  5K53 A;  5JKM G;  2D5K A;  5ERK A;  3Q4R A;  3PVT B;  3GGY A;  5C6F A;  5CMR A;  2GS4 A;  4MY7 A;  4U3G A;  2V2M A;  2YJJ A;  2IY4 A;  3E1M A;  3PWF A;  2V2I A;  5IX6 A;  2XJM A;  3MPS A;  3BVF A;  1BG7 A;  1ZUJ A;  3PVY B;  2HTN A;  2V2O A;  4KVS A;  3T9J A;  4TOB A;  3LKD A;  1XZ1 A;  4TOC A;  4M33 A;  4EVB A;  4KXR B;  1JYB A;  2JD6 0;  4CVT A;  2F7N A;  4E6K A;  4M34 A;  5J93 A;  1TJO A;  2FG4 A;  2ITB A;  5JKM A;  2CEI A;  3KX9 A;  4LPM A;  1AEW A;  4R42 A;  3GHQ A;  1MOJ A;  4AM4 A;  3AK8 A;  4TOE A;  3F35 A;  2CWL A;  3QHC A;  1L8H A;  1NF4 A;  3BVI A;  1N1Q A;  3WVU A;  3FRS A;  3R2H A;  4Z3B A;  4OYN A;  2VZB A;  5HJF A;  2XJN A;  1VJX A;  3PW1 A;  3SE1 A;  3OGH A;  1GWG A;  1Z6O M;  5HQO A;  1DAT A;  3F32 A;  2QF9 A;  2IU2 A;  5D8O A;  3FI6 A;  4II4 B;  1KRQ A;  4PGI A;  3PVT A;  2FG8 A;  1RYT A;  1LB3 A;  2C2U A;  2FHA A;  3E6S A;  5D8Q A;  3RD0 A;  3F39 A;  3GVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...