2N02A

Solution structure of the a147t variant of the mitochondrial translocator protein (tspo) in complex with pk11195
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
169
structure length
169
Chain Sequence
MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYAGLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFTTVLNYYVWRDNSGRRGGSRLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Translocator protein
publication title Structural Integrity of the A147T Polymorph of Mammalian TSPO.
pubmed doi rcsb
source organism Mus musculus
total genus 53
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2015-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03073 TspO_MBR TspO/MBR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.100 Mainly Alpha Up-down Bundle Ferritin Ferritin 2n02A01
2MGYA 2N02A
chains in the Genus database with same CATH superfamily
3E1OA 2PYBA 1J30A 4CY9A 3F32A 3FRRA 1H96A 3KWOA 3WVVA 1JYBA 1DATA 5AXSA 5HJFA 3Q4OA 3UNOA 1RCIA 3QD8A 4CMYA 3F35A 2CLUA 1R03A 3C21A 3F33A 1KRQA 3U90A 4RC7B 4IWKA 5GOUA 3N6OA 5HJHA 4R42A 4DYZA 5E2DA 4EVBA 4ZKWA 3F38A 1UVHA 3R2HA 2V2NA 2ZG7X 4X0JA 5K52A 2GYDA 2Z6MA 1VJXA 4LPMA 3AF8X 1QYBA 5CMQA 2CN7A 4REUA 3AF9X 5FEJA 2FKZA 4RC6A 3GGZA 5IX6A 3W54A 4ISMA 4II4B 4E40A 3VVAA 3AF7X 5J8WA 3R2RA 4W4KB 2VZBA 2CF7A 3BVLA 2MGYA 2V8TA 2YJKA 2BW1A 4ERUA 4LQNA 2CN6A 1RCGA 4DI0A 5JDOA 2V2RA 4ISPA 3GE4A 5GU1X 1AEWA 2C6RA 4KVQA 2C41A 2FL0A 3PVTB 5D8RA 5GU3X 1F30A 3NP2X 4TOFA 2RBDA 4WJG4 2W0OA 3KA3A 4IXKA 4TOBA 2WLAA 4QUWA 2AR0A 3PWQC 4RC5B 2ZA6A 3EZUA 3OJ5A 3F36A 3PW8A 1L8HA 5FFAA 4TOEA 2ZURX 5D8SA 5D8XA 1VEQA 5JACA 2C2FA 3KDQA 5ERKA 1NF6A 2FFXJ 3PZAA 2Z90A 4CVTA 4Z3BA 2CHPA 4MUDA 3E6SA 3ERZA 3UFBA 3AJOA 2BK6A 4E6KA 1IERA 4LQJA 4MY7A 3BKNA 3RE7A 2CLBA 1S30A 3OGHA 3IS8A 2G38B 2UX1A 5C6FA 3QB9A 3L0MA 1GWGA 3O7RA 4ZTTA 3ISFA 3KA9A 2FHAA 3KA4A 1JI4A 2HR5A 1YUZA 5J9VA 2V2MA 4MKUA 3SE1A 4DYUA 5JKLA 3KX9A 2V2PA 4TOCA 5E1UA 2FG4A 3PW1B 4KVSA 4DASA 2JD80 5LG2A 3AJPA 4TOGA 4PGIA 2HTNA 3LKDA 4DE6A 2GYQA 1XZ3A 1DPSA 5LBHA 5JKLG 2BKCA 1BCFA 4KVRA 5J8SA 3V3KB 3GHQA 3BVKA 3GVYA 1DVBA 1ZUJA 5GN8A 3PWQA 5FFCA 2WLUA 3BT5A 1YUXA 2ZA7A 1Z6OA 4A25A 1RCEA 3AJQA 1IESA 4CYBA 5JDOB 4TOAA 1F33A 2Y44A 1TKOA 3IQ1A 4LPJA 4TW3A 2IY4A 3FI6A 5LS9A 3R2LA 5HQOA 2OC5A 2CHIA 3R2SA 2V2SA 3WVUA 3A9QA 5D8PA 3R2OA 5J93A 3UOIA 4ZKHA 3RBCA 4PG1A 4RC7A 3H7GA 4CVRA 3NP0X 5K53A 2YJJA 3SHXA 1O9RA 1RYTA 3HL1A 1SOFA 4U3GA 2VXXA 3EZ0A 1YV1A 3DBYA 1RCDA 4LQVA 4M35A 2CIHA 3QHBA 1JREA 5GU0X 2V2OA 1BFRA 3E2CA 3A68A 2N02A 1JGCA 2XJMA 4AM2A 3E1MA 4ITWA 3GGYA 1LKMA 4XKUA 3SH6A 4Y08A 3AK9A 3ISEA 1Z4AA 1TKPA 3BVIA 3D19A 1VEIA 4LYXA 3RD0A 1SQ3A 2XJNA 4CMYV 2V2LA 3O7SA 3E1JA 5GU2X 1ZS3A 3PWFA 4M32A 3F37A 1NFVA 4TODA 2V2IA 3PVRA 2V8UA 4PG0A 4EVCA 5FFBA 3WNWA 2XKQA 4XKTA 1RCCA 4KXRB 4W4LB 2Y3QA 5LG8A 2JD60 4RC5A 4AM5A 1VELA 4EVDA 1MFRA 3T9JA 2Z5RA 4AM4A 5JKMA 3QHCA 3UOFA 2Z5PA 4ZMCA 3E1QA 2C2UA 3QZ3A 3EGMA 4ZL5A 1TK6A 3Q4NA 5GN8B 3KHKA 4Z5SA 3E6RA 1VLGA 2OH3A 2IB0A 3C1YA 3PVYA 2V15A 4RC6B 1JKVA 1JTSA 5D8QA 4XGSA 4YVZA 4LPNA 3R2MA 4LQHA 1TJOA 2FG8A 5CMRA 4RC8A 1NNQA 1UMNA 2XGWA 3SIDA 1O9IA 1LKOA 4XKSA 3Q4QA 3VNXA 4TO9A 4ETRA 2XJOA 3PW1A 1MOJA 3HIUA 3MPSA 2JD70 4ITTA 4ZKXA 4CYAA 2FJCA 2OKCA 3F39A 5ERJA 4PGKA 2QF9A 2Z5QA 4YKHA 3FVBA 3ES3A 4ML5A 4IWJA 3M6JA 4CVPA 3JZAB 4EVEA 2V2JA 1JKUA 4DZ0A 2YW7A 1FHAA 4CVSA 4LYUA 1BG7A 2ZG9X 3WVWA 1NF4A 3BVEA 4M33A 3E1NA 1S2ZA 1EUMA 3IS7A 2IU2A 4YXJA 2CWLA 5CZUA 1OTKA 4M34A 2YW6A 3Q4RA 2FZFA 4DYXA 3E1LA 3C23A 2QQYA 2WWXB 4OYNA 2VXIA 3PVRB 2D5KA 3C1ZA 1S3QA 4II4A 4DYYA 4TOHA 5D8OA 3R2KA 3QVDA 1QGHA 4MXPA 3FSEA 3AK8A 5FFDA 5I4JA 1JIGA 1HRSA 4ZL6A 3FRSA 2BJYA 3F34A 3E1PA 5D8YA 2F7NA 4P18A 1LB3A 3KA8A 3PVTA 1Z6OM 2C2JA 3BVFA 3VV9A 2ZG8X 3TA8A 3JZ9A 1B71A 2ZA8A 2WTLA 3RGDA 2G4HA 1N1QA 2GS4A 3PVYB 3KA6A 2ITBA 3RAVA 4ZJKA 1L8IA 1LKPA 4MN9A 1JI5A 2X170 4YXMA 4ZLWA 1XZ1A 2CEIA 3KXUA 5HU6D 5FFEA 3NOZX 3PW8C 4MJYA 5JKMG
chains in the Genus database with same CATH topology
3E1OA 2PYBA 1J30A 4CY9A 3F32A 3FRRA 1H96A 3KWOA 3WVVA 1JYBA 1DATA 5AXSA 5HJFA 3Q4OA 3UNOA 1RCIA 3QD8A 4CMYA 3F35A 2CLUA 1R03A 3C21A 3F33A 1KRQA 3U90A 4RC7B 4IWKA 5GOUA 3N6OA 5HJHA 4R42A 4DYZA 5E2DA 4EVBA 4ZKWA 3F38A 1UVHA 3R2HA 2V2NA 2ZG7X 4X0JA 5K52A 2GYDA 2Z6MA 1VJXA 4LPMA 3AF8X 1QYBA 5CMQA 2CN7A 4REUA 3AF9X 5FEJA 2FKZA 4RC6A 3GGZA 5IX6A 3W54A 4ISMA 4II4B 4E40A 3VVAA 3AF7X 5J8WA 3R2RA 4W4KB 2VZBA 2CF7A 3BVLA 2MGYA 2V8TA 2YJKA 2BW1A 4ERUA 4LQNA 2CN6A 1RCGA 4DI0A 5JDOA 2V2RA 4ISPA 3GE4A 5GU1X 1AEWA 2C6RA 4KVQA 2C41A 2FL0A 3PVTB 5D8RA 5GU3X 1F30A 3NP2X 4TOFA 2RBDA 4WJG4 2W0OA 3KA3A 4IXKA 4TOBA 2WLAA 4QUWA 2AR0A 3PWQC 4RC5B 2ZA6A 3EZUA 3OJ5A 3F36A 3PW8A 1L8HA 5FFAA 4TOEA 2ZURX 5D8SA 5D8XA 1VEQA 5JACA 2C2FA 3KDQA 5ERKA 1NF6A 2FFXJ 3PZAA 2Z90A 4CVTA 4Z3BA 2CHPA 4MUDA 3E6SA 3ERZA 3UFBA 3AJOA 2BK6A 4E6KA 1IERA 4LQJA 4MY7A 3BKNA 3RE7A 2CLBA 1S30A 3OGHA 3IS8A 2G38B 2UX1A 5C6FA 3QB9A 3L0MA 1GWGA 3O7RA 4ZTTA 3ISFA 3KA9A 2FHAA 3KA4A 1JI4A 2HR5A 1YUZA 5J9VA 2V2MA 4MKUA 3SE1A 4DYUA 5JKLA 3KX9A 2V2PA 4TOCA 5E1UA 2FG4A 3PW1B 4KVSA 4DASA 2JD80 5LG2A 3AJPA 4TOGA 4PGIA 2HTNA 3LKDA 4DE6A 2GYQA 1XZ3A 1DPSA 5LBHA 5JKLG 2BKCA 1BCFA 4KVRA 5J8SA 3V3KB 3GHQA 3BVKA 3GVYA 1DVBA 1ZUJA 5GN8A 3PWQA 5FFCA 2WLUA 3BT5A 1YUXA 2ZA7A 1Z6OA 4A25A 1RCEA 3AJQA 1IESA 4CYBA 5JDOB 4TOAA 1F33A 2Y44A 1TKOA 3IQ1A 4LPJA 4TW3A 2IY4A 3FI6A 5LS9A 3R2LA 5HQOA 2OC5A 2CHIA 3R2SA 2V2SA 3WVUA 3A9QA 5D8PA 3R2OA 5J93A 3UOIA 4ZKHA 3RBCA 4PG1A 4RC7A 3H7GA 4CVRA 3NP0X 5K53A 2YJJA 3SHXA 1O9RA 1RYTA 3HL1A 1SOFA 4U3GA 2VXXA 3EZ0A 1YV1A 3DBYA 1RCDA 4LQVA 4M35A 2CIHA 3QHBA 1JREA 5GU0X 2V2OA 1BFRA 3E2CA 3A68A 2N02A 1JGCA 2XJMA 4AM2A 3E1MA 4ITWA 3GGYA 1LKMA 4XKUA 3SH6A 4Y08A 3AK9A 3ISEA 1Z4AA 1TKPA 3BVIA 3D19A 1VEIA 4LYXA 3RD0A 1SQ3A 2XJNA 4CMYV 2V2LA 3O7SA 3E1JA 5GU2X 1ZS3A 3PWFA 4M32A 3F37A 1NFVA 4TODA 2V2IA 3PVRA 2V8UA 4PG0A 4EVCA 5FFBA 3WNWA 2XKQA 4XKTA 1RCCA 4KXRB 4W4LB 2Y3QA 5LG8A 2JD60 4RC5A 4AM5A 1VELA 4EVDA 1MFRA 3T9JA 2Z5RA 4AM4A 5JKMA 3QHCA 3UOFA 2Z5PA 4ZMCA 3E1QA 2C2UA 3QZ3A 3EGMA 4ZL5A 1TK6A 3Q4NA 5GN8B 3KHKA 4Z5SA 3E6RA 1VLGA 2OH3A 2IB0A 3C1YA 3PVYA 2V15A 4RC6B 1JKVA 1JTSA 5D8QA 4XGSA 4YVZA 4LPNA 3R2MA 4LQHA 1TJOA 2FG8A 5CMRA 4RC8A 1NNQA 1UMNA 2XGWA 3SIDA 1O9IA 1LKOA 4XKSA 3Q4QA 3VNXA 4TO9A 4ETRA 2XJOA 3PW1A 1MOJA 3HIUA 3MPSA 2JD70 4ITTA 4ZKXA 4CYAA 2FJCA 2OKCA 3F39A 5ERJA 4PGKA 2QF9A 2Z5QA 4YKHA 3FVBA 3ES3A 4ML5A 4IWJA 3M6JA 4CVPA 3JZAB 4EVEA 2V2JA 1JKUA 4DZ0A 2YW7A 1FHAA 4CVSA 4LYUA 1BG7A 2ZG9X 3WVWA 1NF4A 3BVEA 4M33A 3E1NA 1S2ZA 1EUMA 3IS7A 2IU2A 4YXJA 2CWLA 5CZUA 1OTKA 4M34A 2YW6A 3Q4RA 2FZFA 4DYXA 3E1LA 3C23A 2QQYA 2WWXB 4OYNA 2VXIA 3PVRB 2D5KA 3C1ZA 1S3QA 4II4A 4DYYA 4TOHA 5D8OA 3R2KA 3QVDA 1QGHA 4MXPA 3FSEA 3AK8A 5FFDA 5I4JA 1JIGA 1HRSA 4ZL6A 3FRSA 2BJYA 3F34A 3E1PA 5D8YA 2F7NA 4P18A 1LB3A 3KA8A 3PVTA 1Z6OM 2C2JA 3BVFA 3VV9A 2ZG8X 3TA8A 3JZ9A 1B71A 2ZA8A 2WTLA 3RGDA 2G4HA 1N1QA 2GS4A 3PVYB 3KA6A 2ITBA 3RAVA 4ZJKA 1L8IA 1LKPA 4MN9A 1JI5A 2X170 4YXMA 4ZLWA 1XZ1A 2CEIA 3KXUA 5HU6D 5FFEA 3NOZX 3PW8C 4MJYA 5JKMG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MGY A;  2N02 A; 
#chains in the Genus database with same CATH topology
 3E1O A;  2PYB A;  1J30 A;  4CY9 A;  3F32 A;  3FRR A;  1H96 A;  3KWO A;  3WVV A;  1JYB A;  1DAT A;  5AXS A;  5HJF A;  3Q4O A;  3UNO A;  1RCI A;  3QD8 A;  4CMY A;  3F35 A;  2CLU A;  1R03 A;  3C21 A;  3F33 A;  1KRQ A;  3U90 A;  4RC7 B;  4IWK A;  5GOU A;  3N6O A;  5HJH A;  4R42 A;  4DYZ A;  5E2D A;  4EVB A;  4ZKW A;  3F38 A;  1UVH A;  3R2H A;  2V2N A;  2ZG7 X;  4X0J A;  5K52 A;  2GYD A;  2Z6M A;  1VJX A;  4LPM A;  3AF8 X;  1QYB A;  5CMQ A;  2CN7 A;  4REU A;  3AF9 X;  5FEJ A;  2FKZ A;  4RC6 A;  3GGZ A;  5IX6 A;  3W54 A;  4ISM A;  4II4 B;  4E40 A;  3VVA A;  3AF7 X;  5J8W A;  3R2R A;  4W4K B;  2VZB A;  2CF7 A;  3BVL A;  2MGY A;  2V8T A;  2YJK A;  2BW1 A;  4ERU A;  4LQN A;  2CN6 A;  1RCG A;  4DI0 A;  5JDO A;  2V2R A;  4ISP A;  3GE4 A;  5GU1 X;  1AEW A;  2C6R A;  4KVQ A;  2C41 A;  2FL0 A;  3PVT B;  5D8R A;  5GU3 X;  1F30 A;  3NP2 X;  4TOF A;  2RBD A;  4WJG 4;  2W0O A;  3KA3 A;  4IXK A;  4TOB A;  2WLA A;  4QUW A;  2AR0 A;  3PWQ C;  4RC5 B;  2ZA6 A;  3EZU A;  3OJ5 A;  3F36 A;  3PW8 A;  1L8H A;  5FFA A;  4TOE A;  2ZUR X;  5D8S A;  5D8X A;  1VEQ A;  5JAC A;  2C2F A;  3KDQ A;  5ERK A;  1NF6 A;  2FFX J;  3PZA A;  2Z90 A;  4CVT A;  4Z3B A;  2CHP A;  4MUD A;  3E6S A;  3ERZ A;  3UFB A;  3AJO A;  2BK6 A;  4E6K A;  1IER A;  4LQJ A;  4MY7 A;  3BKN A;  3RE7 A;  2CLB A;  1S30 A;  3OGH A;  3IS8 A;  2G38 B;  2UX1 A;  5C6F A;  3QB9 A;  3L0M A;  1GWG A;  3O7R A;  4ZTT A;  3ISF A;  3KA9 A;  2FHA A;  3KA4 A;  1JI4 A;  2HR5 A;  1YUZ A;  5J9V A;  2V2M A;  4MKU A;  3SE1 A;  4DYU A;  5JKL A;  3KX9 A;  2V2P A;  4TOC A;  5E1U A;  2FG4 A;  3PW1 B;  4KVS A;  4DAS A;  2JD8 0;  5LG2 A;  3AJP A;  4TOG A;  4PGI A;  2HTN A;  3LKD A;  4DE6 A;  2GYQ A;  1XZ3 A;  1DPS A;  5LBH A;  5JKL G;  2BKC A;  1BCF A;  4KVR A;  5J8S A;  3V3K B;  3GHQ A;  3BVK A;  3GVY A;  1DVB A;  1ZUJ A;  5GN8 A;  3PWQ A;  5FFC A;  2WLU A;  3BT5 A;  1YUX A;  2ZA7 A;  1Z6O A;  4A25 A;  1RCE A;  3AJQ A;  1IES A;  4CYB A;  5JDO B;  4TOA A;  1F33 A;  2Y44 A;  1TKO A;  3IQ1 A;  4LPJ A;  4TW3 A;  2IY4 A;  3FI6 A;  5LS9 A;  3R2L A;  5HQO A;  2OC5 A;  2CHI A;  3R2S A;  2V2S A;  3WVU A;  3A9Q A;  5D8P A;  3R2O A;  5J93 A;  3UOI A;  4ZKH A;  3RBC A;  4PG1 A;  4RC7 A;  3H7G A;  4CVR A;  3NP0 X;  5K53 A;  2YJJ A;  3SHX A;  1O9R A;  1RYT A;  3HL1 A;  1SOF A;  4U3G A;  2VXX A;  3EZ0 A;  1YV1 A;  3DBY A;  1RCD A;  4LQV A;  4M35 A;  2CIH A;  3QHB A;  1JRE A;  5GU0 X;  2V2O A;  1BFR A;  3E2C A;  3A68 A;  2N02 A;  1JGC A;  2XJM A;  4AM2 A;  3E1M A;  4ITW A;  3GGY A;  1LKM A;  4XKU A;  3SH6 A;  4Y08 A;  3AK9 A;  3ISE A;  1Z4A A;  1TKP A;  3BVI A;  3D19 A;  1VEI A;  4LYX A;  3RD0 A;  1SQ3 A;  2XJN A;  4CMY V;  2V2L A;  3O7S A;  3E1J A;  5GU2 X;  1ZS3 A;  3PWF A;  4M32 A;  3F37 A;  1NFV A;  4TOD A;  2V2I A;  3PVR A;  2V8U A;  4PG0 A;  4EVC A;  5FFB A;  3WNW A;  2XKQ A;  4XKT A;  1RCC A;  4KXR B;  4W4L B;  2Y3Q A;  5LG8 A;  2JD6 0;  4RC5 A;  4AM5 A;  1VEL A;  4EVD A;  1MFR A;  3T9J A;  2Z5R A;  4AM4 A;  5JKM A;  3QHC A;  3UOF A;  2Z5P A;  4ZMC A;  3E1Q A;  2C2U A;  3QZ3 A;  3EGM A;  4ZL5 A;  1TK6 A;  3Q4N A;  5GN8 B;  3KHK A;  4Z5S A;  3E6R A;  1VLG A;  2OH3 A;  2IB0 A;  3C1Y A;  3PVY A;  2V15 A;  4RC6 B;  1JKV A;  1JTS A;  5D8Q A;  4XGS A;  4YVZ A;  4LPN A;  3R2M A;  4LQH A;  1TJO A;  2FG8 A;  5CMR A;  4RC8 A;  1NNQ A;  1UMN A;  2XGW A;  3SID A;  1O9I A;  1LKO A;  4XKS A;  3Q4Q A;  3VNX A;  4TO9 A;  4ETR A;  2XJO A;  3PW1 A;  1MOJ A;  3HIU A;  3MPS A;  2JD7 0;  4ITT A;  4ZKX A;  4CYA A;  2FJC A;  2OKC A;  3F39 A;  5ERJ A;  4PGK A;  2QF9 A;  2Z5Q A;  4YKH A;  3FVB A;  3ES3 A;  4ML5 A;  4IWJ A;  3M6J A;  4CVP A;  3JZA B;  4EVE A;  2V2J A;  1JKU A;  4DZ0 A;  2YW7 A;  1FHA A;  4CVS A;  4LYU A;  1BG7 A;  2ZG9 X;  3WVW A;  1NF4 A;  3BVE A;  4M33 A;  3E1N A;  1S2Z A;  1EUM A;  3IS7 A;  2IU2 A;  4YXJ A;  2CWL A;  5CZU A;  1OTK A;  4M34 A;  2YW6 A;  3Q4R A;  2FZF A;  4DYX A;  3E1L A;  3C23 A;  2QQY A;  2WWX B;  4OYN A;  2VXI A;  3PVR B;  2D5K A;  3C1Z A;  1S3Q A;  4II4 A;  4DYY A;  4TOH A;  5D8O A;  3R2K A;  3QVD A;  1QGH A;  4MXP A;  3FSE A;  3AK8 A;  5FFD A;  5I4J A;  1JIG A;  1HRS A;  4ZL6 A;  3FRS A;  2BJY A;  3F34 A;  3E1P A;  5D8Y A;  2F7N A;  4P18 A;  1LB3 A;  3KA8 A;  3PVT A;  1Z6O M;  2C2J A;  3BVF A;  3VV9 A;  2ZG8 X;  3TA8 A;  3JZ9 A;  1B71 A;  2ZA8 A;  2WTL A;  3RGD A;  2G4H A;  1N1Q A;  2GS4 A;  3PVY B;  3KA6 A;  2ITB A;  3RAV A;  4ZJK A;  1L8I A;  1LKP A;  4MN9 A;  1JI5 A;  2X17 0;  4YXM A;  4ZLW A;  1XZ1 A;  2CEI A;  3KXU A;  5HU6 D;  5FFE A;  3NOZ X;  3PW8 C;  4MJY A;  5JKM G; 
#chains in the Genus database with same CATH homology
 3E1O A;  2PYB A;  1J30 A;  4CY9 A;  3F32 A;  3FRR A;  1H96 A;  3KWO A;  3WVV A;  1JYB A;  1DAT A;  5AXS A;  5HJF A;  3Q4O A;  3UNO A;  1RCI A;  3QD8 A;  4CMY A;  3F35 A;  2CLU A;  1R03 A;  3C21 A;  3F33 A;  1KRQ A;  3U90 A;  4RC7 B;  4IWK A;  5GOU A;  3N6O A;  5HJH A;  4R42 A;  4DYZ A;  5E2D A;  4EVB A;  4ZKW A;  3F38 A;  1UVH A;  3R2H A;  2V2N A;  2ZG7 X;  4X0J A;  5K52 A;  2GYD A;  2Z6M A;  1VJX A;  4LPM A;  3AF8 X;  1QYB A;  5CMQ A;  2CN7 A;  4REU A;  3AF9 X;  5FEJ A;  2FKZ A;  4RC6 A;  3GGZ A;  5IX6 A;  3W54 A;  4ISM A;  4II4 B;  4E40 A;  3VVA A;  3AF7 X;  5J8W A;  3R2R A;  4W4K B;  2VZB A;  2CF7 A;  3BVL A;  2MGY A;  2V8T A;  2YJK A;  2BW1 A;  4ERU A;  4LQN A;  2CN6 A;  1RCG A;  4DI0 A;  5JDO A;  2V2R A;  4ISP A;  3GE4 A;  5GU1 X;  1AEW A;  2C6R A;  4KVQ A;  2C41 A;  2FL0 A;  3PVT B;  5D8R A;  5GU3 X;  1F30 A;  3NP2 X;  4TOF A;  2RBD A;  4WJG 4;  2W0O A;  3KA3 A;  4IXK A;  4TOB A;  2WLA A;  4QUW A;  2AR0 A;  3PWQ C;  4RC5 B;  2ZA6 A;  3EZU A;  3OJ5 A;  3F36 A;  3PW8 A;  1L8H A;  5FFA A;  4TOE A;  2ZUR X;  5D8S A;  5D8X A;  1VEQ A;  5JAC A;  2C2F A;  3KDQ A;  5ERK A;  1NF6 A;  2FFX J;  3PZA A;  2Z90 A;  4CVT A;  4Z3B A;  2CHP A;  4MUD A;  3E6S A;  3ERZ A;  3UFB A;  3AJO A;  2BK6 A;  4E6K A;  1IER A;  4LQJ A;  4MY7 A;  3BKN A;  3RE7 A;  2CLB A;  1S30 A;  3OGH A;  3IS8 A;  2G38 B;  2UX1 A;  5C6F A;  3QB9 A;  3L0M A;  1GWG A;  3O7R A;  4ZTT A;  3ISF A;  3KA9 A;  2FHA A;  3KA4 A;  1JI4 A;  2HR5 A;  1YUZ A;  5J9V A;  2V2M A;  4MKU A;  3SE1 A;  4DYU A;  5JKL A;  3KX9 A;  2V2P A;  4TOC A;  5E1U A;  2FG4 A;  3PW1 B;  4KVS A;  4DAS A;  2JD8 0;  5LG2 A;  3AJP A;  4TOG A;  4PGI A;  2HTN A;  3LKD A;  4DE6 A;  2GYQ A;  1XZ3 A;  1DPS A;  5LBH A;  5JKL G;  2BKC A;  1BCF A;  4KVR A;  5J8S A;  3V3K B;  3GHQ A;  3BVK A;  3GVY A;  1DVB A;  1ZUJ A;  5GN8 A;  3PWQ A;  5FFC A;  2WLU A;  3BT5 A;  1YUX A;  2ZA7 A;  1Z6O A;  4A25 A;  1RCE A;  3AJQ A;  1IES A;  4CYB A;  5JDO B;  4TOA A;  1F33 A;  2Y44 A;  1TKO A;  3IQ1 A;  4LPJ A;  4TW3 A;  2IY4 A;  3FI6 A;  5LS9 A;  3R2L A;  5HQO A;  2OC5 A;  2CHI A;  3R2S A;  2V2S A;  3WVU A;  3A9Q A;  5D8P A;  3R2O A;  5J93 A;  3UOI A;  4ZKH A;  3RBC A;  4PG1 A;  4RC7 A;  3H7G A;  4CVR A;  3NP0 X;  5K53 A;  2YJJ A;  3SHX A;  1O9R A;  1RYT A;  3HL1 A;  1SOF A;  4U3G A;  2VXX A;  3EZ0 A;  1YV1 A;  3DBY A;  1RCD A;  4LQV A;  4M35 A;  2CIH A;  3QHB A;  1JRE A;  5GU0 X;  2V2O A;  1BFR A;  3E2C A;  3A68 A;  2N02 A;  1JGC A;  2XJM A;  4AM2 A;  3E1M A;  4ITW A;  3GGY A;  1LKM A;  4XKU A;  3SH6 A;  4Y08 A;  3AK9 A;  3ISE A;  1Z4A A;  1TKP A;  3BVI A;  3D19 A;  1VEI A;  4LYX A;  3RD0 A;  1SQ3 A;  2XJN A;  4CMY V;  2V2L A;  3O7S A;  3E1J A;  5GU2 X;  1ZS3 A;  3PWF A;  4M32 A;  3F37 A;  1NFV A;  4TOD A;  2V2I A;  3PVR A;  2V8U A;  4PG0 A;  4EVC A;  5FFB A;  3WNW A;  2XKQ A;  4XKT A;  1RCC A;  4KXR B;  4W4L B;  2Y3Q A;  5LG8 A;  2JD6 0;  4RC5 A;  4AM5 A;  1VEL A;  4EVD A;  1MFR A;  3T9J A;  2Z5R A;  4AM4 A;  5JKM A;  3QHC A;  3UOF A;  2Z5P A;  4ZMC A;  3E1Q A;  2C2U A;  3QZ3 A;  3EGM A;  4ZL5 A;  1TK6 A;  3Q4N A;  5GN8 B;  3KHK A;  4Z5S A;  3E6R A;  1VLG A;  2OH3 A;  2IB0 A;  3C1Y A;  3PVY A;  2V15 A;  4RC6 B;  1JKV A;  1JTS A;  5D8Q A;  4XGS A;  4YVZ A;  4LPN A;  3R2M A;  4LQH A;  1TJO A;  2FG8 A;  5CMR A;  4RC8 A;  1NNQ A;  1UMN A;  2XGW A;  3SID A;  1O9I A;  1LKO A;  4XKS A;  3Q4Q A;  3VNX A;  4TO9 A;  4ETR A;  2XJO A;  3PW1 A;  1MOJ A;  3HIU A;  3MPS A;  2JD7 0;  4ITT A;  4ZKX A;  4CYA A;  2FJC A;  2OKC A;  3F39 A;  5ERJ A;  4PGK A;  2QF9 A;  2Z5Q A;  4YKH A;  3FVB A;  3ES3 A;  4ML5 A;  4IWJ A;  3M6J A;  4CVP A;  3JZA B;  4EVE A;  2V2J A;  1JKU A;  4DZ0 A;  2YW7 A;  1FHA A;  4CVS A;  4LYU A;  1BG7 A;  2ZG9 X;  3WVW A;  1NF4 A;  3BVE A;  4M33 A;  3E1N A;  1S2Z A;  1EUM A;  3IS7 A;  2IU2 A;  4YXJ A;  2CWL A;  5CZU A;  1OTK A;  4M34 A;  2YW6 A;  3Q4R A;  2FZF A;  4DYX A;  3E1L A;  3C23 A;  2QQY A;  2WWX B;  4OYN A;  2VXI A;  3PVR B;  2D5K A;  3C1Z A;  1S3Q A;  4II4 A;  4DYY A;  4TOH A;  5D8O A;  3R2K A;  3QVD A;  1QGH A;  4MXP A;  3FSE A;  3AK8 A;  5FFD A;  5I4J A;  1JIG A;  1HRS A;  4ZL6 A;  3FRS A;  2BJY A;  3F34 A;  3E1P A;  5D8Y A;  2F7N A;  4P18 A;  1LB3 A;  3KA8 A;  3PVT A;  1Z6O M;  2C2J A;  3BVF A;  3VV9 A;  2ZG8 X;  3TA8 A;  3JZ9 A;  1B71 A;  2ZA8 A;  2WTL A;  3RGD A;  2G4H A;  1N1Q A;  2GS4 A;  3PVY B;  3KA6 A;  2ITB A;  3RAV A;  4ZJK A;  1L8I A;  1LKP A;  4MN9 A;  1JI5 A;  2X17 0;  4YXM A;  4ZLW A;  1XZ1 A;  2CEI A;  3KXU A;  5HU6 D;  5FFE A;  3NOZ X;  3PW8 C;  4MJY A;  5JKM G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...