2N02A

Solution structure of the a147t variant of the mitochondrial translocator protein (tspo) in complex with pk11195
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
169
structure length
169
Chain Sequence
b'MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYAGLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFTTVLNYYVWRDNSGRRGGSRLAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translocator protein
publication title Structural Integrity of the A147T Polymorph of Mammalian TSPO.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 53
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2015-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03073 TspO_MBR TspO/MBR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.100 Mainly Alpha Up-down Bundle Ferritin Ferritin 2n02A01
2N02A 2MGYA
chains in the Genus database with same CATH superfamily
3PVYB 3HIUA 4CVPA 4PGKA 3IS8A 3E1LA 3F36A 2FKZA 1S3QA 4ZKXA 1FHAA 1TKOA 3BT5A 3QHBA 3UOFA 1JKVA 2GYDA 4W4LB 2BKCA 4ISMA 2ZA8A 3AK8A 3NP0X 3VVAA 3BKNA 4TOGA 2C41A 4ITTA 4Z5SA 1EUMA 3F34A 1O9RA 3WVVA 4ERUA 3F38A 4II4A 3GGYA 3SHXA 3BVFA 4EVEA 1JREA 3AF8X 1RCDA 4ISPA 1XZ1A 3RAVA 1JGCA 2GS4A 1R03A 4EVCA 4ZL5A 3KA9A 3AK9A 4PG0A 2ZURX 4MY7A 5GU2X 4RC5A 2XKQA 5J8SA 1DATA 3ES3A 1F33A 3C23A 2V2LA 5FFCA 4IWKA 2C2UA 4AM5A 3PW1B 3SH6A 3UNOA 2ZA7A 4ITWA 4YVZA 4W4KB 1NFVA 2ZA6A 2XJOA 3KX9A 2C2FA 2V8TA 2YJKA 1SQ3A 4II4B 4MN9A 2G4HA 1TJOA 2FJCA 4ZL6A 2V2RA 4ETRA 1GWGA 4CYAA 5FEJA 3E1QA 5GU0X 5CZUA 4XKSA 1SOFA 3PWQA 2CLBA 4RC8A 4LYXA 3MPSA 5D8PA 4RC5B 3QHCA 1YUXA 3R2RA 4MUDA 1RYTA 4Y08A 4KVSA 5HQOA 2ZG7X 4DYUA 3NOZX 1VELA 5E1UA 2CHIA 2BJYA 2Y3QA 1S2ZA 4DI0A 2CHPA 2C6RA 3FSEA 2Z6MA 3TA8A 2C2JA 3PWQC 3KA4A 2MGYA 5IX6A 4QUWA 4X0JA 3A68A 1L8HA 5JACA 5GN8A 4REUA 1LKOA 2OH3A 2UX1A 4CY9A 3FRSA 4ZTTA 3PVTA 3C21A 1XZ3A 3PWFA 3Q4QA 1AEWA 5J93A 4CMYA 3PZAA 4LPMA 1JI5A 1RCGA 1Z6OA 3NP2X 3C1ZA 2Z90A 1F30A 4LYUA 2QQYA 3F32A 1BCFA 3ISEA 2IB0A 2CF7A 3N6OA 2CLUA 4EVBA 1JKUA 4CVSA 4RC6A 4CYBA 5LBHA 2IU2A 3R2MA 3L0MA 3VNXA 5CMRA 2QF9A 5GN8B 3A9QA 5LG8A 1ZS3A 1Z4AA 4U3GA 1L8IA 3E1OA 2GYQA 4TOEA 2Z5QA 2V2IA 3E6SA 5LG2A 3V3KB 4LQJA 5FFBA 3RBCA 2Y44A 2V15A 3EZUA 3R2HA 2AR0A 4EVDA 3EZ0A 2WLAA 1B71A 4LPJA 4YXJA 4WJG4 3AF9X 4RC6B 3GVYA 1BFRA 4YKHA 3F37A 3O7SA 4ZJKA 3IQ1A 1IERA 2CEIA 2VXIA 5JDOA 1VEIA 4DYXA 1IESA 1HRSA 1JI4A 4MXPA 4CVTA 2D5KA 3EGMA 3UFBA 4Z3BA 1UMNA 2XJMA 3PVRA 4OYNA 2N02A 3QD8A 4YXMA 1RCIA 5D8YA 3FVBA 5I4JA 3R2LA 3HL1A 3RGDA 3QVDA 4TOFA 4ZKHA 4TO9A 5D8SA 2V2OA 5AXSA 2WTLA 1ZUJA 3WNWA 1H96A 3JZ9A 1QGHA 1Z6OM 2V2JA 4DYYA 2X170 5D8OA 2YW7A 4A25A 3E1MA 3E2CA 2CN6A 1N1QA 4ML5A 4M33A 3WVWA 4KVQA 1JYBA 1LKMA 2V2SA 4AM2A 4AM4A 3KXUA 2VXXA 3R2SA 4DASA 3U90A 4RC7A 3PVRB 3AF7X 3WVUA 3E1JA 4ZKWA 3AJPA 2YW6A 1QYBA 2CIHA 4TODA 4IXKA 4ZMCA 2IY4A 3KWOA 5GOUA 2ZG8X 3LKDA 5K52A 5E2DA 5GU3X 4XKUA 1TKPA 4MJYA 4DZ0A 1YV1A 4TW3A 3KA8A 5D8QA 5FFEA 2V2PA 5D8XA 3E1NA 1MFRA 4TOCA 5K53A 5JKLG 2OKCA 3BVKA 2JD60 1NF6A 1VLGA 4KXRB 3QZ3A 5JKMG 5J9VA 5ERKA 2XJNA 4CVRA 3E6RA 4DE6A 2BK6A 4RC7B 3D19A 2V2NA 2BW1A 3Q4NA 3PVTB 1LB3A 2WLUA 3KA3A 3KA6A 1DPSA 2RBDA 1RCCA 1TK6A 3PW1A 3JZAB 4XKTA 1NF4A 3Q4OA 1JIGA 5HJHA 4IWJA 3KDQA 2OC5A 1VJXA 3UOIA 2F7NA 5GU1X 1BG7A 4ZLWA 3IS7A 3ERZA 2V2MA 4TOAA 1MOJA 3KHKA 1NNQA 2XGWA 1DVBA 1O9IA 2V8UA 3AJQA 3OGHA 5C6FA 3VV9A 5FFAA 3QB9A 3ISFA 3FRRA 3F33A 4MKUA 4XGSA 2W0OA 5J8WA 1KRQA 4PGIA 1RCEA 4DYZA 2JD80 3F39A 1UVHA 4E40A 2VZBA 3M6JA 3RE7A 3AJOA 2ITBA 3W54A 5ERJA 2FG8A 3F35A 4M35A 3SE1A 2Z5PA 4TOHA 3O7RA 4LPNA 5JKLA 2WWXB 5JKMA 3T9JA 2HTNA 2PYBA 3Q4RA 4LQVA 3GGZA 2JD70 2Z5RA 4KVRA 1LKPA 2FG4A 2HR5A 3PVYA 4R42A 3RD0A 5JDOB 3BVEA 3PW8A 2ZG9X 1YUZA 5HU6D 2FZFA 1OTKA 3C1YA 3GHQA 4CMYV 2G38B 2YJJA 2FL0A 4M34A 2FFXJ 1JTSA 5D8RA 2FHAA 3FI6A 1VEQA 3GE4A 2CN7A 2CWLA 5LS9A 4LQNA 1J30A 4P18A 3E1PA 3H7GA 1S30A 3R2KA 3PW8C 3SIDA 4M32A 5CMQA 3BVLA 4TOBA 5FFDA 3DBYA 3BVIA 4LQHA 4E6KA 3OJ5A 3R2OA 5HJFA 4PG1A
chains in the Genus database with same CATH topology
3PVYB 3HIUA 4CVPA 4PGKA 3IS8A 3E1LA 3F36A 2FKZA 1S3QA 4ZKXA 1FHAA 1TKOA 3BT5A 3QHBA 3UOFA 1JKVA 2GYDA 4W4LB 2BKCA 4ISMA 2ZA8A 3AK8A 3NP0X 3VVAA 3BKNA 4TOGA 2C41A 4ITTA 4Z5SA 1EUMA 3F34A 1O9RA 3WVVA 4ERUA 3F38A 4II4A 3GGYA 3SHXA 3BVFA 4EVEA 1JREA 3AF8X 1RCDA 4ISPA 1XZ1A 3RAVA 1JGCA 2GS4A 1R03A 4EVCA 4ZL5A 3KA9A 3AK9A 4PG0A 2ZURX 4MY7A 5GU2X 4RC5A 2XKQA 5J8SA 1DATA 3ES3A 1F33A 3C23A 2V2LA 5FFCA 4IWKA 2C2UA 4AM5A 3PW1B 3SH6A 3UNOA 2ZA7A 4ITWA 4YVZA 4W4KB 1NFVA 2ZA6A 2XJOA 3KX9A 2C2FA 2V8TA 2YJKA 1SQ3A 4II4B 4MN9A 2G4HA 1TJOA 2FJCA 4ZL6A 2V2RA 4ETRA 1GWGA 4CYAA 5FEJA 3E1QA 5GU0X 5CZUA 4XKSA 1SOFA 3PWQA 2CLBA 4RC8A 4LYXA 3MPSA 5D8PA 4RC5B 3QHCA 1YUXA 3R2RA 4MUDA 1RYTA 4Y08A 4KVSA 5HQOA 2ZG7X 4DYUA 3NOZX 1VELA 5E1UA 2CHIA 2BJYA 2Y3QA 1S2ZA 4DI0A 2CHPA 2C6RA 3FSEA 2Z6MA 3TA8A 2C2JA 3PWQC 3KA4A 2MGYA 5IX6A 4QUWA 4X0JA 3A68A 1L8HA 5JACA 5GN8A 4REUA 1LKOA 2OH3A 2UX1A 4CY9A 3FRSA 4ZTTA 3PVTA 3C21A 1XZ3A 3PWFA 3Q4QA 1AEWA 5J93A 4CMYA 3PZAA 4LPMA 1JI5A 1RCGA 1Z6OA 3NP2X 3C1ZA 2Z90A 1F30A 4LYUA 2QQYA 3F32A 1BCFA 3ISEA 2IB0A 2CF7A 3N6OA 2CLUA 4EVBA 1JKUA 4CVSA 4RC6A 4CYBA 5LBHA 2IU2A 3R2MA 3L0MA 3VNXA 5CMRA 2QF9A 5GN8B 3A9QA 5LG8A 1ZS3A 1Z4AA 4U3GA 1L8IA 3E1OA 2GYQA 4TOEA 2Z5QA 2V2IA 3E6SA 5LG2A 3V3KB 4LQJA 5FFBA 3RBCA 2Y44A 2V15A 3EZUA 3R2HA 2AR0A 4EVDA 3EZ0A 2WLAA 1B71A 4LPJA 4YXJA 4WJG4 3AF9X 4RC6B 3GVYA 1BFRA 4YKHA 3F37A 3O7SA 4ZJKA 3IQ1A 1IERA 2CEIA 2VXIA 5JDOA 1VEIA 4DYXA 1IESA 1HRSA 1JI4A 4MXPA 4CVTA 2D5KA 3EGMA 3UFBA 4Z3BA 1UMNA 2XJMA 3PVRA 4OYNA 2N02A 3QD8A 4YXMA 1RCIA 5D8YA 3FVBA 5I4JA 3R2LA 3HL1A 3RGDA 3QVDA 4TOFA 4ZKHA 4TO9A 5D8SA 2V2OA 5AXSA 2WTLA 1ZUJA 3WNWA 1H96A 3JZ9A 1QGHA 1Z6OM 2V2JA 4DYYA 2X170 5D8OA 2YW7A 4A25A 3E1MA 3E2CA 2CN6A 1N1QA 4ML5A 4M33A 3WVWA 4KVQA 1JYBA 1LKMA 2V2SA 4AM2A 4AM4A 3KXUA 2VXXA 3R2SA 4DASA 3U90A 4RC7A 3PVRB 3AF7X 3WVUA 3E1JA 4ZKWA 3AJPA 2YW6A 1QYBA 2CIHA 4TODA 4IXKA 4ZMCA 2IY4A 3KWOA 5GOUA 2ZG8X 3LKDA 5K52A 5E2DA 5GU3X 4XKUA 1TKPA 4MJYA 4DZ0A 1YV1A 4TW3A 3KA8A 5D8QA 5FFEA 2V2PA 5D8XA 3E1NA 1MFRA 4TOCA 5K53A 5JKLG 2OKCA 3BVKA 2JD60 1NF6A 1VLGA 4KXRB 3QZ3A 5JKMG 5J9VA 5ERKA 2XJNA 4CVRA 3E6RA 4DE6A 2BK6A 4RC7B 3D19A 2V2NA 2BW1A 3Q4NA 3PVTB 1LB3A 2WLUA 3KA3A 3KA6A 1DPSA 2RBDA 1RCCA 1TK6A 3PW1A 3JZAB 4XKTA 1NF4A 3Q4OA 1JIGA 5HJHA 4IWJA 3KDQA 2OC5A 1VJXA 3UOIA 2F7NA 5GU1X 1BG7A 4ZLWA 3IS7A 3ERZA 2V2MA 4TOAA 1MOJA 3KHKA 1NNQA 2XGWA 1DVBA 1O9IA 2V8UA 3AJQA 3OGHA 5C6FA 3VV9A 5FFAA 3QB9A 3ISFA 3FRRA 3F33A 4MKUA 4XGSA 2W0OA 5J8WA 1KRQA 4PGIA 1RCEA 4DYZA 2JD80 3F39A 1UVHA 4E40A 2VZBA 3M6JA 3RE7A 3AJOA 2ITBA 3W54A 5ERJA 2FG8A 3F35A 4M35A 3SE1A 2Z5PA 4TOHA 3O7RA 4LPNA 5JKLA 2WWXB 5JKMA 3T9JA 2HTNA 2PYBA 3Q4RA 4LQVA 3GGZA 2JD70 2Z5RA 4KVRA 1LKPA 2FG4A 2HR5A 3PVYA 4R42A 3RD0A 5JDOB 3BVEA 3PW8A 2ZG9X 1YUZA 5HU6D 2FZFA 1OTKA 3C1YA 3GHQA 4CMYV 2G38B 2YJJA 2FL0A 4M34A 2FFXJ 1JTSA 5D8RA 2FHAA 3FI6A 1VEQA 3GE4A 2CN7A 2CWLA 5LS9A 4LQNA 1J30A 4P18A 3E1PA 3H7GA 1S30A 3R2KA 3PW8C 3SIDA 4M32A 5CMQA 3BVLA 4TOBA 5FFDA 3DBYA 3BVIA 4LQHA 4E6KA 3OJ5A 3R2OA 5HJFA 4PG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N02 A;  2MGY A; 
#chains in the Genus database with same CATH topology
 3PVY B;  3HIU A;  4CVP A;  4PGK A;  3IS8 A;  3E1L A;  3F36 A;  2FKZ A;  1S3Q A;  4ZKX A;  1FHA A;  1TKO A;  3BT5 A;  3QHB A;  3UOF A;  1JKV A;  2GYD A;  4W4L B;  2BKC A;  4ISM A;  2ZA8 A;  3AK8 A;  3NP0 X;  3VVA A;  3BKN A;  4TOG A;  2C41 A;  4ITT A;  4Z5S A;  1EUM A;  3F34 A;  1O9R A;  3WVV A;  4ERU A;  3F38 A;  4II4 A;  3GGY A;  3SHX A;  3BVF A;  4EVE A;  1JRE A;  3AF8 X;  1RCD A;  4ISP A;  1XZ1 A;  3RAV A;  1JGC A;  2GS4 A;  1R03 A;  4EVC A;  4ZL5 A;  3KA9 A;  3AK9 A;  4PG0 A;  2ZUR X;  4MY7 A;  5GU2 X;  4RC5 A;  2XKQ A;  5J8S A;  1DAT A;  3ES3 A;  1F33 A;  3C23 A;  2V2L A;  5FFC A;  4IWK A;  2C2U A;  4AM5 A;  3PW1 B;  3SH6 A;  3UNO A;  2ZA7 A;  4ITW A;  4YVZ A;  4W4K B;  1NFV A;  2ZA6 A;  2XJO A;  3KX9 A;  2C2F A;  2V8T A;  2YJK A;  1SQ3 A;  4II4 B;  4MN9 A;  2G4H A;  1TJO A;  2FJC A;  4ZL6 A;  2V2R A;  4ETR A;  1GWG A;  4CYA A;  5FEJ A;  3E1Q A;  5GU0 X;  5CZU A;  4XKS A;  1SOF A;  3PWQ A;  2CLB A;  4RC8 A;  4LYX A;  3MPS A;  5D8P A;  4RC5 B;  3QHC A;  1YUX A;  3R2R A;  4MUD A;  1RYT A;  4Y08 A;  4KVS A;  5HQO A;  2ZG7 X;  4DYU A;  3NOZ X;  1VEL A;  5E1U A;  2CHI A;  2BJY A;  2Y3Q A;  1S2Z A;  4DI0 A;  2CHP A;  2C6R A;  3FSE A;  2Z6M A;  3TA8 A;  2C2J A;  3PWQ C;  3KA4 A;  2MGY A;  5IX6 A;  4QUW A;  4X0J A;  3A68 A;  1L8H A;  5JAC A;  5GN8 A;  4REU A;  1LKO A;  2OH3 A;  2UX1 A;  4CY9 A;  3FRS A;  4ZTT A;  3PVT A;  3C21 A;  1XZ3 A;  3PWF A;  3Q4Q A;  1AEW A;  5J93 A;  4CMY A;  3PZA A;  4LPM A;  1JI5 A;  1RCG A;  1Z6O A;  3NP2 X;  3C1Z A;  2Z90 A;  1F30 A;  4LYU A;  2QQY A;  3F32 A;  1BCF A;  3ISE A;  2IB0 A;  2CF7 A;  3N6O A;  2CLU A;  4EVB A;  1JKU A;  4CVS A;  4RC6 A;  4CYB A;  5LBH A;  2IU2 A;  3R2M A;  3L0M A;  3VNX A;  5CMR A;  2QF9 A;  5GN8 B;  3A9Q A;  5LG8 A;  1ZS3 A;  1Z4A A;  4U3G A;  1L8I A;  3E1O A;  2GYQ A;  4TOE A;  2Z5Q A;  2V2I A;  3E6S A;  5LG2 A;  3V3K B;  4LQJ A;  5FFB A;  3RBC A;  2Y44 A;  2V15 A;  3EZU A;  3R2H A;  2AR0 A;  4EVD A;  3EZ0 A;  2WLA A;  1B71 A;  4LPJ A;  4YXJ A;  4WJG 4;  3AF9 X;  4RC6 B;  3GVY A;  1BFR A;  4YKH A;  3F37 A;  3O7S A;  4ZJK A;  3IQ1 A;  1IER A;  2CEI A;  2VXI A;  5JDO A;  1VEI A;  4DYX A;  1IES A;  1HRS A;  1JI4 A;  4MXP A;  4CVT A;  2D5K A;  3EGM A;  3UFB A;  4Z3B A;  1UMN A;  2XJM A;  3PVR A;  4OYN A;  2N02 A;  3QD8 A;  4YXM A;  1RCI A;  5D8Y A;  3FVB A;  5I4J A;  3R2L A;  3HL1 A;  3RGD A;  3QVD A;  4TOF A;  4ZKH A;  4TO9 A;  5D8S A;  2V2O A;  5AXS A;  2WTL A;  1ZUJ A;  3WNW A;  1H96 A;  3JZ9 A;  1QGH A;  1Z6O M;  2V2J A;  4DYY A;  2X17 0;  5D8O A;  2YW7 A;  4A25 A;  3E1M A;  3E2C A;  2CN6 A;  1N1Q A;  4ML5 A;  4M33 A;  3WVW A;  4KVQ A;  1JYB A;  1LKM A;  2V2S A;  4AM2 A;  4AM4 A;  3KXU A;  2VXX A;  3R2S A;  4DAS A;  3U90 A;  4RC7 A;  3PVR B;  3AF7 X;  3WVU A;  3E1J A;  4ZKW A;  3AJP A;  2YW6 A;  1QYB A;  2CIH A;  4TOD A;  4IXK A;  4ZMC A;  2IY4 A;  3KWO A;  5GOU A;  2ZG8 X;  3LKD A;  5K52 A;  5E2D A;  5GU3 X;  4XKU A;  1TKP A;  4MJY A;  4DZ0 A;  1YV1 A;  4TW3 A;  3KA8 A;  5D8Q A;  5FFE A;  2V2P A;  5D8X A;  3E1N A;  1MFR A;  4TOC A;  5K53 A;  5JKL G;  2OKC A;  3BVK A;  2JD6 0;  1NF6 A;  1VLG A;  4KXR B;  3QZ3 A;  5JKM G;  5J9V A;  5ERK A;  2XJN A;  4CVR A;  3E6R A;  4DE6 A;  2BK6 A;  4RC7 B;  3D19 A;  2V2N A;  2BW1 A;  3Q4N A;  3PVT B;  1LB3 A;  2WLU A;  3KA3 A;  3KA6 A;  1DPS A;  2RBD A;  1RCC A;  1TK6 A;  3PW1 A;  3JZA B;  4XKT A;  1NF4 A;  3Q4O A;  1JIG A;  5HJH A;  4IWJ A;  3KDQ A;  2OC5 A;  1VJX A;  3UOI A;  2F7N A;  5GU1 X;  1BG7 A;  4ZLW A;  3IS7 A;  3ERZ A;  2V2M A;  4TOA A;  1MOJ A;  3KHK A;  1NNQ A;  2XGW A;  1DVB A;  1O9I A;  2V8U A;  3AJQ A;  3OGH A;  5C6F A;  3VV9 A;  5FFA A;  3QB9 A;  3ISF A;  3FRR A;  3F33 A;  4MKU A;  4XGS A;  2W0O A;  5J8W A;  1KRQ A;  4PGI A;  1RCE A;  4DYZ A;  2JD8 0;  3F39 A;  1UVH A;  4E40 A;  2VZB A;  3M6J A;  3RE7 A;  3AJO A;  2ITB A;  3W54 A;  5ERJ A;  2FG8 A;  3F35 A;  4M35 A;  3SE1 A;  2Z5P A;  4TOH A;  3O7R A;  4LPN A;  5JKL A;  2WWX B;  5JKM A;  3T9J A;  2HTN A;  2PYB A;  3Q4R A;  4LQV A;  3GGZ A;  2JD7 0;  2Z5R A;  4KVR A;  1LKP A;  2FG4 A;  2HR5 A;  3PVY A;  4R42 A;  3RD0 A;  5JDO B;  3BVE A;  3PW8 A;  2ZG9 X;  1YUZ A;  5HU6 D;  2FZF A;  1OTK A;  3C1Y A;  3GHQ A;  4CMY V;  2G38 B;  2YJJ A;  2FL0 A;  4M34 A;  2FFX J;  1JTS A;  5D8R A;  2FHA A;  3FI6 A;  1VEQ A;  3GE4 A;  2CN7 A;  2CWL A;  5LS9 A;  4LQN A;  1J30 A;  4P18 A;  3E1P A;  3H7G A;  1S30 A;  3R2K A;  3PW8 C;  3SID A;  4M32 A;  5CMQ A;  3BVL A;  4TOB A;  5FFD A;  3DBY A;  3BVI A;  4LQH A;  4E6K A;  3OJ5 A;  3R2O A;  5HJF A;  4PG1 A; 
#chains in the Genus database with same CATH homology
 3PVY B;  3HIU A;  4CVP A;  4PGK A;  3IS8 A;  3E1L A;  3F36 A;  2FKZ A;  1S3Q A;  4ZKX A;  1FHA A;  1TKO A;  3BT5 A;  3QHB A;  3UOF A;  1JKV A;  2GYD A;  4W4L B;  2BKC A;  4ISM A;  2ZA8 A;  3AK8 A;  3NP0 X;  3VVA A;  3BKN A;  4TOG A;  2C41 A;  4ITT A;  4Z5S A;  1EUM A;  3F34 A;  1O9R A;  3WVV A;  4ERU A;  3F38 A;  4II4 A;  3GGY A;  3SHX A;  3BVF A;  4EVE A;  1JRE A;  3AF8 X;  1RCD A;  4ISP A;  1XZ1 A;  3RAV A;  1JGC A;  2GS4 A;  1R03 A;  4EVC A;  4ZL5 A;  3KA9 A;  3AK9 A;  4PG0 A;  2ZUR X;  4MY7 A;  5GU2 X;  4RC5 A;  2XKQ A;  5J8S A;  1DAT A;  3ES3 A;  1F33 A;  3C23 A;  2V2L A;  5FFC A;  4IWK A;  2C2U A;  4AM5 A;  3PW1 B;  3SH6 A;  3UNO A;  2ZA7 A;  4ITW A;  4YVZ A;  4W4K B;  1NFV A;  2ZA6 A;  2XJO A;  3KX9 A;  2C2F A;  2V8T A;  2YJK A;  1SQ3 A;  4II4 B;  4MN9 A;  2G4H A;  1TJO A;  2FJC A;  4ZL6 A;  2V2R A;  4ETR A;  1GWG A;  4CYA A;  5FEJ A;  3E1Q A;  5GU0 X;  5CZU A;  4XKS A;  1SOF A;  3PWQ A;  2CLB A;  4RC8 A;  4LYX A;  3MPS A;  5D8P A;  4RC5 B;  3QHC A;  1YUX A;  3R2R A;  4MUD A;  1RYT A;  4Y08 A;  4KVS A;  5HQO A;  2ZG7 X;  4DYU A;  3NOZ X;  1VEL A;  5E1U A;  2CHI A;  2BJY A;  2Y3Q A;  1S2Z A;  4DI0 A;  2CHP A;  2C6R A;  3FSE A;  2Z6M A;  3TA8 A;  2C2J A;  3PWQ C;  3KA4 A;  2MGY A;  5IX6 A;  4QUW A;  4X0J A;  3A68 A;  1L8H A;  5JAC A;  5GN8 A;  4REU A;  1LKO A;  2OH3 A;  2UX1 A;  4CY9 A;  3FRS A;  4ZTT A;  3PVT A;  3C21 A;  1XZ3 A;  3PWF A;  3Q4Q A;  1AEW A;  5J93 A;  4CMY A;  3PZA A;  4LPM A;  1JI5 A;  1RCG A;  1Z6O A;  3NP2 X;  3C1Z A;  2Z90 A;  1F30 A;  4LYU A;  2QQY A;  3F32 A;  1BCF A;  3ISE A;  2IB0 A;  2CF7 A;  3N6O A;  2CLU A;  4EVB A;  1JKU A;  4CVS A;  4RC6 A;  4CYB A;  5LBH A;  2IU2 A;  3R2M A;  3L0M A;  3VNX A;  5CMR A;  2QF9 A;  5GN8 B;  3A9Q A;  5LG8 A;  1ZS3 A;  1Z4A A;  4U3G A;  1L8I A;  3E1O A;  2GYQ A;  4TOE A;  2Z5Q A;  2V2I A;  3E6S A;  5LG2 A;  3V3K B;  4LQJ A;  5FFB A;  3RBC A;  2Y44 A;  2V15 A;  3EZU A;  3R2H A;  2AR0 A;  4EVD A;  3EZ0 A;  2WLA A;  1B71 A;  4LPJ A;  4YXJ A;  4WJG 4;  3AF9 X;  4RC6 B;  3GVY A;  1BFR A;  4YKH A;  3F37 A;  3O7S A;  4ZJK A;  3IQ1 A;  1IER A;  2CEI A;  2VXI A;  5JDO A;  1VEI A;  4DYX A;  1IES A;  1HRS A;  1JI4 A;  4MXP A;  4CVT A;  2D5K A;  3EGM A;  3UFB A;  4Z3B A;  1UMN A;  2XJM A;  3PVR A;  4OYN A;  2N02 A;  3QD8 A;  4YXM A;  1RCI A;  5D8Y A;  3FVB A;  5I4J A;  3R2L A;  3HL1 A;  3RGD A;  3QVD A;  4TOF A;  4ZKH A;  4TO9 A;  5D8S A;  2V2O A;  5AXS A;  2WTL A;  1ZUJ A;  3WNW A;  1H96 A;  3JZ9 A;  1QGH A;  1Z6O M;  2V2J A;  4DYY A;  2X17 0;  5D8O A;  2YW7 A;  4A25 A;  3E1M A;  3E2C A;  2CN6 A;  1N1Q A;  4ML5 A;  4M33 A;  3WVW A;  4KVQ A;  1JYB A;  1LKM A;  2V2S A;  4AM2 A;  4AM4 A;  3KXU A;  2VXX A;  3R2S A;  4DAS A;  3U90 A;  4RC7 A;  3PVR B;  3AF7 X;  3WVU A;  3E1J A;  4ZKW A;  3AJP A;  2YW6 A;  1QYB A;  2CIH A;  4TOD A;  4IXK A;  4ZMC A;  2IY4 A;  3KWO A;  5GOU A;  2ZG8 X;  3LKD A;  5K52 A;  5E2D A;  5GU3 X;  4XKU A;  1TKP A;  4MJY A;  4DZ0 A;  1YV1 A;  4TW3 A;  3KA8 A;  5D8Q A;  5FFE A;  2V2P A;  5D8X A;  3E1N A;  1MFR A;  4TOC A;  5K53 A;  5JKL G;  2OKC A;  3BVK A;  2JD6 0;  1NF6 A;  1VLG A;  4KXR B;  3QZ3 A;  5JKM G;  5J9V A;  5ERK A;  2XJN A;  4CVR A;  3E6R A;  4DE6 A;  2BK6 A;  4RC7 B;  3D19 A;  2V2N A;  2BW1 A;  3Q4N A;  3PVT B;  1LB3 A;  2WLU A;  3KA3 A;  3KA6 A;  1DPS A;  2RBD A;  1RCC A;  1TK6 A;  3PW1 A;  3JZA B;  4XKT A;  1NF4 A;  3Q4O A;  1JIG A;  5HJH A;  4IWJ A;  3KDQ A;  2OC5 A;  1VJX A;  3UOI A;  2F7N A;  5GU1 X;  1BG7 A;  4ZLW A;  3IS7 A;  3ERZ A;  2V2M A;  4TOA A;  1MOJ A;  3KHK A;  1NNQ A;  2XGW A;  1DVB A;  1O9I A;  2V8U A;  3AJQ A;  3OGH A;  5C6F A;  3VV9 A;  5FFA A;  3QB9 A;  3ISF A;  3FRR A;  3F33 A;  4MKU A;  4XGS A;  2W0O A;  5J8W A;  1KRQ A;  4PGI A;  1RCE A;  4DYZ A;  2JD8 0;  3F39 A;  1UVH A;  4E40 A;  2VZB A;  3M6J A;  3RE7 A;  3AJO A;  2ITB A;  3W54 A;  5ERJ A;  2FG8 A;  3F35 A;  4M35 A;  3SE1 A;  2Z5P A;  4TOH A;  3O7R A;  4LPN A;  5JKL A;  2WWX B;  5JKM A;  3T9J A;  2HTN A;  2PYB A;  3Q4R A;  4LQV A;  3GGZ A;  2JD7 0;  2Z5R A;  4KVR A;  1LKP A;  2FG4 A;  2HR5 A;  3PVY A;  4R42 A;  3RD0 A;  5JDO B;  3BVE A;  3PW8 A;  2ZG9 X;  1YUZ A;  5HU6 D;  2FZF A;  1OTK A;  3C1Y A;  3GHQ A;  4CMY V;  2G38 B;  2YJJ A;  2FL0 A;  4M34 A;  2FFX J;  1JTS A;  5D8R A;  2FHA A;  3FI6 A;  1VEQ A;  3GE4 A;  2CN7 A;  2CWL A;  5LS9 A;  4LQN A;  1J30 A;  4P18 A;  3E1P A;  3H7G A;  1S30 A;  3R2K A;  3PW8 C;  3SID A;  4M32 A;  5CMQ A;  3BVL A;  4TOB A;  5FFD A;  3DBY A;  3BVI A;  4LQH A;  4E6K A;  3OJ5 A;  3R2O A;  5HJF A;  4PG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...