3ES3A

Directing noble metal ion chemistry within a designed ferritin protein. the complex with gold ions. ferritin h8-h9x mutant
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
172
structure length
172
Chain Sequence
TSQVRQNYDQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEERCHAEKLMKLQNQRGGRIFLQDIQKPDRDDWESGLNAMEAALQLEKNVNQSLLELHKLATDKNDPHLSDFIETHYLNCQVCAIKCLGDHVTNLRKMGAPESGLAEYLFDKHTLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ferritin heavy chain
publication title Directing noble metal ion chemistry within a designed ferritin protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 172
sequence length 172
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2008-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3es3A00
3F35A 3PW1B 4RC7A 4OYNA 3PVRB 4CYBA 5D8OA 3F38A 4ISPA 2CLUA 4RC6A 1NFVA 1S30A 4LPMA 2YW6A 3E1PA 5D8QA 3QB9A 3E1LA 4Z3BA 2CN7A 5CZUA 5GU2X 4QUWA 4ZLWA 3R2OA 3QHBA 1GWGA 1ZUJA 2Z5QA 2FG4A 4TODA 4TOCA 2Z6MA 2V15A 2XGWA 2V2MA 1RYTA 3E1QA 3UOIA 2V2OA 1JIGA 2V2NA 2CEIA 5ERJA 5GU1X 5K52A 3E6RA 1QYBA 3BT5A 4ZTTA 1DPSA 1JGCA 2V2JA 3WNWA 2ZG8X 2FL0A 4II4B 4DE6A 4MJYA 4ITWA 3KA6A 1VLGA 4RC5A 3VNXA 1NNQA 3KA4A 2BW1A 4TOHA 5CMRA 4EVDA 3RAVA 3NOZX 3ISEA 2BJYA 3Q4QA 2ZURX 3NP0X 1SOFA 5JKLA 4IWJA 2XJNA 2VXIA 4ZKXA 3Q4RA 1ZS3A 4M33A 1F30A 4LPNA 2WTLA 1B71A 4LYUA 4TOFA 3MPSA 3WVUA 4CYAA 3FSEA 4EVCA 1JI5A 2JD60 3PVYB 5GU3X 2FKZA 1LKPA 1AEWA 1RCGA 4DI0A 5JKMG 3SE1A 1L8HA 4CMYV 4LQHA 5D8RA 4PG1A 2GS4A 5CMQA 4ZJKA 3SIDA 2XJOA 3A9QA 4TOAA 1TKOA 3R2MA 1QGHA 3PVTA 3EZ0A 3Q4OA 4ML5A 2X170 3PW8C 5FFEA 3PW1A 4ZL6A 5JACA 4AM2A 1EUMA 3UOFA 1RCCA 2FFXJ 3AF9X 3PVRA 4CY9A 2QQYA 2ZA6A 2Z90A 5HJHA 2FG8A 3H7GA 4IXKA 1DATA 4KVRA 4AM4A 2V2RA 5C6FA 4M34A 2OH3A 4E6KA 4XGSA 4LYXA 5J8WA 4REUA 1DVBA 1Z6OM 4PG0A 3SH6A 3AF7X 1BFRA 4ZMCA 2FJCA 1J30A 4KVQA 2V2PA 4XKTA 3F36A 4LPJA 2WLUA 5LS9A 1KRQA 5FFAA 3O7RA 2YJJA 3NP2X 5LG8A 3BVKA 4MY7A 3BVEA 1JI4A 4R42A 3BKNA 1JKVA 3HIUA 1VELA 2FZFA 2FHAA 1N1QA 2V2IA 1R03A 4DZ0A 3PWFA 3R2LA 5D8PA 3KX9A 3GVYA 1YV1A 4LQNA 1MFRA 4II4A 3T9JA 3IQ1A 1S3QA 4A25A 4LQVA 1JKUA 1RCIA 3OGHA 1IERA 2VXXA 1BCFA 3F33A 1VEQA 2CHPA 4ZKHA 2F7NA 1LKMA 3AK9A 4ETRA 1SQ3A 5E2DA 4TW3A 4ERUA 4CVTA 3KA9A 2GYQA 2C41A 5GN8B 4M32A 4RC8A 4PGKA 2HTNA 4MN9A 1O9IA 3PVYA 2ZG7X 2Z5PA 1IESA 2IB0A 1BG7A 1L8IA 5HQOA 5FFDA 2C2FA 2C2JA 4XKUA 3TA8A 5FEJA 1NF4A 2Z5RA 3AJOA 4ISMA 4ITTA 2XKQA 2VZBA 2C6RA 5AXSA 3KXUA 4ZKWA 3OJ5A 3QVDA 2IY4A 3AK8A 3ISFA 3F34A 4CVPA 1VEIA 5J9VA 1UMNA 4TOBA 3O7SA 4LQJA 4KVSA 2CN6A 1VJXA 4TOEA 4TO9A 3ES3A 1TJOA 4CMYA 3PZAA 2UX1A 5ERKA 4RC7B 5E1UA 4YKHA 3KWOA 3RBCA 1TKPA 2JD70 3A68A 5JKMA 5J93A 1JYBA 4RC6B 3KA3A 1S2ZA 3BVLA 2ITBA 5IX6A 4TOGA 3PW8A 2CHIA 3PWQC 2W0OA 1RCEA 2CIHA 5HJFA 4XKSA 4CVSA 2XJMA 3R2HA 2CLBA 2Y3QA 3EZUA 1UVHA 2BKCA 1LB3A 1HRSA 1H96A 5FFBA 2C2UA 5JKLG 1RCDA 1XZ3A 2ZG9X 5D8XA 1LKOA 3AJPA 3QHCA 1MOJA 3PWQA 1YUZA 4U3GA 3F32A 1NF6A 3RE7A 3R2KA 3U90A 3SHXA 3GHQA 5D8SA 5GOUA 3HL1A 3R2SA 4RC5B 3E6SA 1OTKA 2G4HA 2QF9A 3E1OA 2HR5A 3WVVA 3BVFA 3QD8A 4DASA 1JREA 4MUDA 4PGIA 5D8YA 3KA8A 3ERZA 4P18A 2V2LA 4DYYA 5GN8A 3IS7A 2OC5A 2RBDA 4AM5A 1F33A 2WLAA 3GE4A 4DYXA 2D5KA 5LG2A 3E1MA 2CF7A 2PYBA 5FFCA 2IU2A 3FI6A 4ZL5A 3FVBA 5GU0X 1FHAA 4Y08A 4EVEA 2ZA8A 3Q4NA 2JD80 4MKUA 1JTSA 2YW7A 3AJQA 4DYZA 3F37A 2V2SA 1TK6A 2ZA7A 3WVWA 2YJKA 1O9RA 4DYUA 5I4JA 1YUXA 5LBHA 3IS8A 3EGMA 3F39A 2GYDA 3E1NA 5K53A 3RGDA 3E2CA 3UNOA 1Z4AA 3R2RA 5J8SA 4EVBA 4CVRA 1Z6OA 2BK6A 3BVIA 3E1JA 4M35A 4Z5SA 3AF8X 1XZ1A 3RD0A 3PVTB 3QZ3A 4IWKA
chains in the Genus database with same CATH superfamily
3F35A 3PW1B 4RC7A 4OYNA 3PVRB 4CYBA 5D8OA 3F38A 4ISPA 2CLUA 4RC6A 1NFVA 1S30A 4LPMA 2YW6A 3E1PA 3UFBA 5D8QA 3QB9A 3E1LA 4Z3BA 2CN7A 4MXPA 5CZUA 5GU2X 4QUWA 4ZLWA 3R2OA 3N6OA 3QHBA 1GWGA 1ZUJA 2Z5QA 3C1ZA 3C21A 2FG4A 4TODA 4TOCA 2Z6MA 3C1YA 2V15A 2XGWA 2V2MA 1RYTA 3M6JA 3E1QA 3UOIA 2V2OA 1JIGA 2V2NA 2CEIA 5ERJA 5GU1X 5K52A 3E6RA 1QYBA 3BT5A 4ZTTA 1DPSA 1JGCA 2V2JA 3WNWA 2ZG8X 2FL0A 4II4B 4DE6A 4MJYA 4ITWA 3KA6A 1VLGA 2OKCA 4RC5A 3VNXA 1NNQA 2AR0A 3KA4A 2BW1A 4TOHA 5CMRA 4EVDA 3FRSA 3RAVA 3NOZX 3ISEA 2BJYA 3Q4QA 2ZURX 3NP0X 3W54A 1SOFA 5JKLA 4IWJA 2XJNA 2VXIA 4ZKXA 3Q4RA 1ZS3A 4M33A 4X0JA 1F30A 4LPNA 4E40A 2WTLA 1B71A 4LYUA 4TOFA 3MPSA 3WVUA 4CYAA 3FSEA 4EVCA 1JI5A 2JD60 3PVYB 5GU3X 2FKZA 1LKPA 1AEWA 3GGYA 1RCGA 4DI0A 5JKMG 2G38B 3SE1A 1L8HA 4CMYV 4LQHA 5D8RA 4PG1A 2GS4A 5CMQA 4ZJKA 3SIDA 2XJOA 3A9QA 4TOAA 1TKOA 3R2MA 1QGHA 3KDQA 3PVTA 3EZ0A 3Q4OA 4ML5A 2CWLA 2X170 3PW8C 5FFEA 3PW1A 4ZL6A 5JACA 4AM2A 1EUMA 3UOFA 1RCCA 3KHKA 2FFXJ 3AF9X 3PVRA 4CY9A 2QQYA 2ZA6A 2Z90A 3GGZA 2FG8A 5HJHA 4W4LB 3H7GA 4IXKA 1DATA 4KVRA 4AM4A 2V2RA 5C6FA 4M34A 2OH3A 4E6KA 4XGSA 4LYXA 5J8WA 4REUA 1DVBA 1Z6OM 4PG0A 3SH6A 3AF7X 3JZAB 1BFRA 4ZMCA 2FJCA 1J30A 2N02A 4KVQA 2V2PA 4XKTA 3F36A 4LPJA 2WLUA 5LS9A 3JZ9A 1KRQA 5FFAA 3O7RA 2YJJA 3NP2X 5LG8A 3BVKA 4MY7A 3BVEA 1JI4A 4R42A 3BKNA 4YXJA 1JKVA 3HIUA 1VELA 2FZFA 2FHAA 1N1QA 4WJG4 2V2IA 1R03A 4DZ0A 3PWFA 3R2LA 5D8PA 3KX9A 3GVYA 1YV1A 4LQNA 1MFRA 4II4A 3T9JA 3IQ1A 1S3QA 4A25A 4LQVA 1JKUA 1RCIA 3OGHA 1IERA 2VXXA 1BCFA 4YXMA 2WWXB 3F33A 1VEQA 2CHPA 4ZKHA 2F7NA 1LKMA 3AK9A 4ETRA 1SQ3A 5E2DA 4TW3A 5JDOB 4ERUA 4CVTA 3DBYA 3KA9A 2GYQA 2C41A 5GN8B 4M32A 4RC8A 4PGKA 2HTNA 4MN9A 1O9IA 3PVYA 4W4KB 2ZG7X 2MGYA 2Z5PA 1IESA 2IB0A 1BG7A 1L8IA 5HQOA 5FFDA 2C2FA 2C2JA 4XKUA 3TA8A 5FEJA 1NF4A 2Z5RA 2V8UA 3AJOA 5HU6D 4ISMA 4ITTA 2XKQA 2VZBA 2C6RA 5AXSA 3KXUA 4ZKWA 3OJ5A 3QVDA 2IY4A 3AK8A 3ISFA 3F34A 3L0MA 3VVAA 4CVPA 1VEIA 5J9VA 1UMNA 4TOBA 3O7SA 4LQJA 4KVSA 2CN6A 1VJXA 4TOEA 4TO9A 3ES3A 1TJOA 4CMYA 3PZAA 2UX1A 5ERKA 4RC7B 5E1UA 4YKHA 3KWOA 3RBCA 4YVZA 1TKPA 2JD70 3A68A 5JKMA 5J93A 1JYBA 4RC6B 3KA3A 1S2ZA 3BVLA 2ITBA 5IX6A 4TOGA 3PW8A 2CHIA 3PWQC 2W0OA 1RCEA 2CIHA 5HJFA 4XKSA 4CVSA 2XJMA 3R2HA 2CLBA 2Y3QA 3EZUA 1UVHA 2BKCA 1LB3A 3V3KB 1HRSA 1H96A 3C23A 5FFBA 2C2UA 5JKLG 1RCDA 1XZ3A 2ZG9X 5D8XA 3FRRA 1LKOA 3AJPA 3QHCA 1MOJA 3PWQA 1YUZA 4U3GA 3F32A 1NF6A 3RE7A 4KXRB 3R2KA 3U90A 3SHXA 3GHQA 5D8SA 5GOUA 3HL1A 3R2SA 4RC5B 3VV9A 3E6SA 1OTKA 2G4HA 2QF9A 3E1OA 2HR5A 3WVVA 3BVFA 3QD8A 4DASA 1JREA 4MUDA 4PGIA 5D8YA 3KA8A 3ERZA 5JDOA 4P18A 2V2LA 4DYYA 5GN8A 3IS7A 2OC5A 2RBDA 4AM5A 1F33A 2Y44A 2WLAA 3GE4A 4DYXA 2D5KA 5LG2A 3E1MA 2CF7A 2PYBA 5FFCA 2IU2A 3FI6A 4ZL5A 3FVBA 5GU0X 1FHAA 4Y08A 4EVEA 2ZA8A 3Q4NA 2JD80 4MKUA 1JTSA 2YW7A 3AJQA 4DYZA 3F37A 3D19A 3LKDA 2V2SA 1TK6A 2V8TA 2ZA7A 2YJKA 1O9RA 3WVWA 4DYUA 5I4JA 1YUXA 5LBHA 3IS8A 3EGMA 3F39A 2GYDA 3E1NA 5K53A 3RGDA 3E2CA 3UNOA 1Z4AA 3R2RA 5J8SA 4EVBA 4CVRA 1Z6OA 2BK6A 3BVIA 3E1JA 4M35A 4Z5SA 3AF8X 1XZ1A 3RD0A 3PVTB 3QZ3A 4IWKA
chains in the Genus database with same CATH topology
3F35A 3PW1B 4RC7A 4OYNA 3PVRB 4CYBA 5D8OA 3F38A 4ISPA 2CLUA 4RC6A 1NFVA 1S30A 4LPMA 2YW6A 3E1PA 3UFBA 5D8QA 3QB9A 3E1LA 4Z3BA 2CN7A 4MXPA 5CZUA 5GU2X 4QUWA 4ZLWA 3R2OA 3N6OA 3QHBA 1GWGA 1ZUJA 2Z5QA 3C1ZA 3C21A 2FG4A 4TODA 4TOCA 2Z6MA 3C1YA 2V15A 2XGWA 2V2MA 1RYTA 3M6JA 3E1QA 3UOIA 2V2OA 1JIGA 2V2NA 2CEIA 5ERJA 5GU1X 5K52A 3E6RA 1QYBA 3BT5A 4ZTTA 1DPSA 1JGCA 2V2JA 3WNWA 2ZG8X 2FL0A 4II4B 4DE6A 4MJYA 4ITWA 3KA6A 1VLGA 2OKCA 4RC5A 3VNXA 1NNQA 2AR0A 3KA4A 2BW1A 4TOHA 5CMRA 4EVDA 3FRSA 3RAVA 3NOZX 3ISEA 2BJYA 3Q4QA 2ZURX 3NP0X 3W54A 1SOFA 5JKLA 4IWJA 2XJNA 2VXIA 4ZKXA 3Q4RA 1ZS3A 4M33A 4X0JA 1F30A 4LPNA 4E40A 2WTLA 1B71A 4LYUA 4TOFA 3MPSA 3WVUA 4CYAA 3FSEA 4EVCA 1JI5A 2JD60 3PVYB 5GU3X 2FKZA 1LKPA 1AEWA 3GGYA 1RCGA 4DI0A 5JKMG 2G38B 3SE1A 1L8HA 4CMYV 4LQHA 5D8RA 4PG1A 2GS4A 5CMQA 4ZJKA 3SIDA 2XJOA 3A9QA 4TOAA 1TKOA 3R2MA 1QGHA 3KDQA 3PVTA 3EZ0A 3Q4OA 4ML5A 2CWLA 2X170 3PW8C 5FFEA 3PW1A 4ZL6A 5JACA 4AM2A 1EUMA 3UOFA 1RCCA 3KHKA 2FFXJ 3AF9X 3PVRA 4CY9A 2QQYA 2ZA6A 2Z90A 3GGZA 2FG8A 5HJHA 4W4LB 3H7GA 4IXKA 1DATA 4KVRA 4AM4A 2V2RA 5C6FA 4M34A 2OH3A 4E6KA 4XGSA 4LYXA 5J8WA 4REUA 1DVBA 1Z6OM 4PG0A 3SH6A 3AF7X 3JZAB 1BFRA 4ZMCA 2FJCA 1J30A 2N02A 4KVQA 2V2PA 4XKTA 3F36A 4LPJA 2WLUA 5LS9A 3JZ9A 1KRQA 5FFAA 3O7RA 2YJJA 3NP2X 5LG8A 3BVKA 4MY7A 3BVEA 1JI4A 4R42A 3BKNA 4YXJA 1JKVA 3HIUA 1VELA 2FZFA 2FHAA 1N1QA 4WJG4 2V2IA 1R03A 4DZ0A 3PWFA 3R2LA 5D8PA 3KX9A 3GVYA 1YV1A 4LQNA 1MFRA 4II4A 3T9JA 3IQ1A 1S3QA 4A25A 4LQVA 1JKUA 1RCIA 3OGHA 1IERA 2VXXA 1BCFA 4YXMA 2WWXB 3F33A 1VEQA 2CHPA 4ZKHA 2F7NA 1LKMA 3AK9A 4ETRA 1SQ3A 5E2DA 4TW3A 5JDOB 4ERUA 4CVTA 3DBYA 3KA9A 2GYQA 2C41A 5GN8B 4M32A 4RC8A 4PGKA 2HTNA 4MN9A 1O9IA 3PVYA 4W4KB 2ZG7X 2MGYA 2Z5PA 1IESA 2IB0A 1BG7A 1L8IA 5HQOA 5FFDA 2C2FA 2C2JA 4XKUA 3TA8A 5FEJA 1NF4A 2Z5RA 2V8UA 3AJOA 5HU6D 4ISMA 4ITTA 2XKQA 2VZBA 2C6RA 5AXSA 3KXUA 4ZKWA 3OJ5A 3QVDA 2IY4A 3AK8A 3ISFA 3F34A 3L0MA 3VVAA 4CVPA 1VEIA 5J9VA 1UMNA 4TOBA 3O7SA 4LQJA 4KVSA 2CN6A 1VJXA 4TOEA 4TO9A 3ES3A 1TJOA 4CMYA 3PZAA 2UX1A 5ERKA 4RC7B 5E1UA 4YKHA 3KWOA 3RBCA 4YVZA 1TKPA 2JD70 3A68A 5JKMA 5J93A 1JYBA 4RC6B 3KA3A 1S2ZA 3BVLA 2ITBA 5IX6A 4TOGA 3PW8A 2CHIA 3PWQC 2W0OA 1RCEA 2CIHA 5HJFA 4XKSA 4CVSA 2XJMA 3R2HA 2CLBA 2Y3QA 3EZUA 1UVHA 2BKCA 1LB3A 3V3KB 1HRSA 1H96A 3C23A 5FFBA 2C2UA 5JKLG 1RCDA 1XZ3A 2ZG9X 5D8XA 3FRRA 1LKOA 3AJPA 3QHCA 1MOJA 3PWQA 1YUZA 4U3GA 3F32A 1NF6A 3RE7A 4KXRB 3R2KA 3U90A 3SHXA 3GHQA 5D8SA 5GOUA 3HL1A 3R2SA 4RC5B 3VV9A 3E6SA 1OTKA 2G4HA 2QF9A 3E1OA 2HR5A 3WVVA 3BVFA 3QD8A 4DASA 1JREA 4MUDA 4PGIA 5D8YA 3KA8A 3ERZA 5JDOA 4P18A 2V2LA 4DYYA 5GN8A 3IS7A 2OC5A 2RBDA 4AM5A 1F33A 2Y44A 2WLAA 3GE4A 4DYXA 2D5KA 5LG2A 3E1MA 2CF7A 2PYBA 5FFCA 2IU2A 3FI6A 4ZL5A 3FVBA 5GU0X 1FHAA 4Y08A 4EVEA 2ZA8A 3Q4NA 2JD80 4MKUA 1JTSA 2YW7A 3AJQA 4DYZA 3F37A 3D19A 3LKDA 2V2SA 1TK6A 2V8TA 2ZA7A 2YJKA 1O9RA 3WVWA 4DYUA 5I4JA 1YUXA 5LBHA 3IS8A 3EGMA 3F39A 2GYDA 3E1NA 5K53A 3RGDA 3E2CA 3UNOA 1Z4AA 3R2RA 5J8SA 4EVBA 4CVRA 1Z6OA 2BK6A 3BVIA 3E1JA 4M35A 4Z5SA 3AF8X 1XZ1A 3RD0A 3PVTB 3QZ3A 4IWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F35 A;  3PW1 B;  4RC7 A;  4OYN A;  3PVR B;  4CYB A;  5D8O A;  3F38 A;  4ISP A;  2CLU A;  4RC6 A;  1NFV A;  1S30 A;  4LPM A;  2YW6 A;  3E1P A;  5D8Q A;  3QB9 A;  3E1L A;  4Z3B A;  2CN7 A;  5CZU A;  5GU2 X;  4QUW A;  4ZLW A;  3R2O A;  3QHB A;  1GWG A;  1ZUJ A;  2Z5Q A;  2FG4 A;  4TOD A;  4TOC A;  2Z6M A;  2V15 A;  2XGW A;  2V2M A;  1RYT A;  3E1Q A;  3UOI A;  2V2O A;  1JIG A;  2V2N A;  2CEI A;  5ERJ A;  5GU1 X;  5K52 A;  3E6R A;  1QYB A;  3BT5 A;  4ZTT A;  1DPS A;  1JGC A;  2V2J A;  3WNW A;  2ZG8 X;  2FL0 A;  4II4 B;  4DE6 A;  4MJY A;  4ITW A;  3KA6 A;  1VLG A;  4RC5 A;  3VNX A;  1NNQ A;  3KA4 A;  2BW1 A;  4TOH A;  5CMR A;  4EVD A;  3RAV A;  3NOZ X;  3ISE A;  2BJY A;  3Q4Q A;  2ZUR X;  3NP0 X;  1SOF A;  5JKL A;  4IWJ A;  2XJN A;  2VXI A;  4ZKX A;  3Q4R A;  1ZS3 A;  4M33 A;  1F30 A;  4LPN A;  2WTL A;  1B71 A;  4LYU A;  4TOF A;  3MPS A;  3WVU A;  4CYA A;  3FSE A;  4EVC A;  1JI5 A;  2JD6 0;  3PVY B;  5GU3 X;  2FKZ A;  1LKP A;  1AEW A;  1RCG A;  4DI0 A;  5JKM G;  3SE1 A;  1L8H A;  4CMY V;  4LQH A;  5D8R A;  4PG1 A;  2GS4 A;  5CMQ A;  4ZJK A;  3SID A;  2XJO A;  3A9Q A;  4TOA A;  1TKO A;  3R2M A;  1QGH A;  3PVT A;  3EZ0 A;  3Q4O A;  4ML5 A;  2X17 0;  3PW8 C;  5FFE A;  3PW1 A;  4ZL6 A;  5JAC A;  4AM2 A;  1EUM A;  3UOF A;  1RCC A;  2FFX J;  3AF9 X;  3PVR A;  4CY9 A;  2QQY A;  2ZA6 A;  2Z90 A;  5HJH A;  2FG8 A;  3H7G A;  4IXK A;  1DAT A;  4KVR A;  4AM4 A;  2V2R A;  5C6F A;  4M34 A;  2OH3 A;  4E6K A;  4XGS A;  4LYX A;  5J8W A;  4REU A;  1DVB A;  1Z6O M;  4PG0 A;  3SH6 A;  3AF7 X;  1BFR A;  4ZMC A;  2FJC A;  1J30 A;  4KVQ A;  2V2P A;  4XKT A;  3F36 A;  4LPJ A;  2WLU A;  5LS9 A;  1KRQ A;  5FFA A;  3O7R A;  2YJJ A;  3NP2 X;  5LG8 A;  3BVK A;  4MY7 A;  3BVE A;  1JI4 A;  4R42 A;  3BKN A;  1JKV A;  3HIU A;  1VEL A;  2FZF A;  2FHA A;  1N1Q A;  2V2I A;  1R03 A;  4DZ0 A;  3PWF A;  3R2L A;  5D8P A;  3KX9 A;  3GVY A;  1YV1 A;  4LQN A;  1MFR A;  4II4 A;  3T9J A;  3IQ1 A;  1S3Q A;  4A25 A;  4LQV A;  1JKU A;  1RCI A;  3OGH A;  1IER A;  2VXX A;  1BCF A;  3F33 A;  1VEQ A;  2CHP A;  4ZKH A;  2F7N A;  1LKM A;  3AK9 A;  4ETR A;  1SQ3 A;  5E2D A;  4TW3 A;  4ERU A;  4CVT A;  3KA9 A;  2GYQ A;  2C41 A;  5GN8 B;  4M32 A;  4RC8 A;  4PGK A;  2HTN A;  4MN9 A;  1O9I A;  3PVY A;  2ZG7 X;  2Z5P A;  1IES A;  2IB0 A;  1BG7 A;  1L8I A;  5HQO A;  5FFD A;  2C2F A;  2C2J A;  4XKU A;  3TA8 A;  5FEJ A;  1NF4 A;  2Z5R A;  3AJO A;  4ISM A;  4ITT A;  2XKQ A;  2VZB A;  2C6R A;  5AXS A;  3KXU A;  4ZKW A;  3OJ5 A;  3QVD A;  2IY4 A;  3AK8 A;  3ISF A;  3F34 A;  4CVP A;  1VEI A;  5J9V A;  1UMN A;  4TOB A;  3O7S A;  4LQJ A;  4KVS A;  2CN6 A;  1VJX A;  4TOE A;  4TO9 A;  3ES3 A;  1TJO A;  4CMY A;  3PZA A;  2UX1 A;  5ERK A;  4RC7 B;  5E1U A;  4YKH A;  3KWO A;  3RBC A;  1TKP A;  2JD7 0;  3A68 A;  5JKM A;  5J93 A;  1JYB A;  4RC6 B;  3KA3 A;  1S2Z A;  3BVL A;  2ITB A;  5IX6 A;  4TOG A;  3PW8 A;  2CHI A;  3PWQ C;  2W0O A;  1RCE A;  2CIH A;  5HJF A;  4XKS A;  4CVS A;  2XJM A;  3R2H A;  2CLB A;  2Y3Q A;  3EZU A;  1UVH A;  2BKC A;  1LB3 A;  1HRS A;  1H96 A;  5FFB A;  2C2U A;  5JKL G;  1RCD A;  1XZ3 A;  2ZG9 X;  5D8X A;  1LKO A;  3AJP A;  3QHC A;  1MOJ A;  3PWQ A;  1YUZ A;  4U3G A;  3F32 A;  1NF6 A;  3RE7 A;  3R2K A;  3U90 A;  3SHX A;  3GHQ A;  5D8S A;  5GOU A;  3HL1 A;  3R2S A;  4RC5 B;  3E6S A;  1OTK A;  2G4H A;  2QF9 A;  3E1O A;  2HR5 A;  3WVV A;  3BVF A;  3QD8 A;  4DAS A;  1JRE A;  4MUD A;  4PGI A;  5D8Y A;  3KA8 A;  3ERZ A;  4P18 A;  2V2L A;  4DYY A;  5GN8 A;  3IS7 A;  2OC5 A;  2RBD A;  4AM5 A;  1F33 A;  2WLA A;  3GE4 A;  4DYX A;  2D5K A;  5LG2 A;  3E1M A;  2CF7 A;  2PYB A;  5FFC A;  2IU2 A;  3FI6 A;  4ZL5 A;  3FVB A;  5GU0 X;  1FHA A;  4Y08 A;  4EVE A;  2ZA8 A;  3Q4N A;  2JD8 0;  4MKU A;  1JTS A;  2YW7 A;  3AJQ A;  4DYZ A;  3F37 A;  2V2S A;  1TK6 A;  2ZA7 A;  3WVW A;  2YJK A;  1O9R A;  4DYU A;  5I4J A;  1YUX A;  5LBH A;  3IS8 A;  3EGM A;  3F39 A;  2GYD A;  3E1N A;  5K53 A;  3RGD A;  3E2C A;  3UNO A;  1Z4A A;  3R2R A;  5J8S A;  4EVB A;  4CVR A;  1Z6O A;  2BK6 A;  3BVI A;  3E1J A;  4M35 A;  4Z5S A;  3AF8 X;  1XZ1 A;  3RD0 A;  3PVT B;  3QZ3 A;  4IWK A; 
#chains in the Genus database with same CATH topology
 3F35 A;  3PW1 B;  4RC7 A;  4OYN A;  3PVR B;  4CYB A;  5D8O A;  3F38 A;  4ISP A;  2CLU A;  4RC6 A;  1NFV A;  1S30 A;  4LPM A;  2YW6 A;  3E1P A;  3UFB A;  5D8Q A;  3QB9 A;  3E1L A;  4Z3B A;  2CN7 A;  4MXP A;  5CZU A;  5GU2 X;  4QUW A;  4ZLW A;  3R2O A;  3N6O A;  3QHB A;  1GWG A;  1ZUJ A;  2Z5Q A;  3C1Z A;  3C21 A;  2FG4 A;  4TOD A;  4TOC A;  2Z6M A;  3C1Y A;  2V15 A;  2XGW A;  2V2M A;  1RYT A;  3M6J A;  3E1Q A;  3UOI A;  2V2O A;  1JIG A;  2V2N A;  2CEI A;  5ERJ A;  5GU1 X;  5K52 A;  3E6R A;  1QYB A;  3BT5 A;  4ZTT A;  1DPS A;  1JGC A;  2V2J A;  3WNW A;  2ZG8 X;  2FL0 A;  4II4 B;  4DE6 A;  4MJY A;  4ITW A;  3KA6 A;  1VLG A;  2OKC A;  4RC5 A;  3VNX A;  1NNQ A;  2AR0 A;  3KA4 A;  2BW1 A;  4TOH A;  5CMR A;  4EVD A;  3FRS A;  3RAV A;  3NOZ X;  3ISE A;  2BJY A;  3Q4Q A;  2ZUR X;  3NP0 X;  3W54 A;  1SOF A;  5JKL A;  4IWJ A;  2XJN A;  2VXI A;  4ZKX A;  3Q4R A;  1ZS3 A;  4M33 A;  4X0J A;  1F30 A;  4LPN A;  4E40 A;  2WTL A;  1B71 A;  4LYU A;  4TOF A;  3MPS A;  3WVU A;  4CYA A;  3FSE A;  4EVC A;  1JI5 A;  2JD6 0;  3PVY B;  5GU3 X;  2FKZ A;  1LKP A;  1AEW A;  3GGY A;  1RCG A;  4DI0 A;  5JKM G;  2G38 B;  3SE1 A;  1L8H A;  4CMY V;  4LQH A;  5D8R A;  4PG1 A;  2GS4 A;  5CMQ A;  4ZJK A;  3SID A;  2XJO A;  3A9Q A;  4TOA A;  1TKO A;  3R2M A;  1QGH A;  3KDQ A;  3PVT A;  3EZ0 A;  3Q4O A;  4ML5 A;  2CWL A;  2X17 0;  3PW8 C;  5FFE A;  3PW1 A;  4ZL6 A;  5JAC A;  4AM2 A;  1EUM A;  3UOF A;  1RCC A;  3KHK A;  2FFX J;  3AF9 X;  3PVR A;  4CY9 A;  2QQY A;  2ZA6 A;  2Z90 A;  3GGZ A;  2FG8 A;  5HJH A;  4W4L B;  3H7G A;  4IXK A;  1DAT A;  4KVR A;  4AM4 A;  2V2R A;  5C6F A;  4M34 A;  2OH3 A;  4E6K A;  4XGS A;  4LYX A;  5J8W A;  4REU A;  1DVB A;  1Z6O M;  4PG0 A;  3SH6 A;  3AF7 X;  3JZA B;  1BFR A;  4ZMC A;  2FJC A;  1J30 A;  2N02 A;  4KVQ A;  2V2P A;  4XKT A;  3F36 A;  4LPJ A;  2WLU A;  5LS9 A;  3JZ9 A;  1KRQ A;  5FFA A;  3O7R A;  2YJJ A;  3NP2 X;  5LG8 A;  3BVK A;  4MY7 A;  3BVE A;  1JI4 A;  4R42 A;  3BKN A;  4YXJ A;  1JKV A;  3HIU A;  1VEL A;  2FZF A;  2FHA A;  1N1Q A;  4WJG 4;  2V2I A;  1R03 A;  4DZ0 A;  3PWF A;  3R2L A;  5D8P A;  3KX9 A;  3GVY A;  1YV1 A;  4LQN A;  1MFR A;  4II4 A;  3T9J A;  3IQ1 A;  1S3Q A;  4A25 A;  4LQV A;  1JKU A;  1RCI A;  3OGH A;  1IER A;  2VXX A;  1BCF A;  4YXM A;  2WWX B;  3F33 A;  1VEQ A;  2CHP A;  4ZKH A;  2F7N A;  1LKM A;  3AK9 A;  4ETR A;  1SQ3 A;  5E2D A;  4TW3 A;  5JDO B;  4ERU A;  4CVT A;  3DBY A;  3KA9 A;  2GYQ A;  2C41 A;  5GN8 B;  4M32 A;  4RC8 A;  4PGK A;  2HTN A;  4MN9 A;  1O9I A;  3PVY A;  4W4K B;  2ZG7 X;  2MGY A;  2Z5P A;  1IES A;  2IB0 A;  1BG7 A;  1L8I A;  5HQO A;  5FFD A;  2C2F A;  2C2J A;  4XKU A;  3TA8 A;  5FEJ A;  1NF4 A;  2Z5R A;  2V8U A;  3AJO A;  5HU6 D;  4ISM A;  4ITT A;  2XKQ A;  2VZB A;  2C6R A;  5AXS A;  3KXU A;  4ZKW A;  3OJ5 A;  3QVD A;  2IY4 A;  3AK8 A;  3ISF A;  3F34 A;  3L0M A;  3VVA A;  4CVP A;  1VEI A;  5J9V A;  1UMN A;  4TOB A;  3O7S A;  4LQJ A;  4KVS A;  2CN6 A;  1VJX A;  4TOE A;  4TO9 A;  3ES3 A;  1TJO A;  4CMY A;  3PZA A;  2UX1 A;  5ERK A;  4RC7 B;  5E1U A;  4YKH A;  3KWO A;  3RBC A;  4YVZ A;  1TKP A;  2JD7 0;  3A68 A;  5JKM A;  5J93 A;  1JYB A;  4RC6 B;  3KA3 A;  1S2Z A;  3BVL A;  2ITB A;  5IX6 A;  4TOG A;  3PW8 A;  2CHI A;  3PWQ C;  2W0O A;  1RCE A;  2CIH A;  5HJF A;  4XKS A;  4CVS A;  2XJM A;  3R2H A;  2CLB A;  2Y3Q A;  3EZU A;  1UVH A;  2BKC A;  1LB3 A;  3V3K B;  1HRS A;  1H96 A;  3C23 A;  5FFB A;  2C2U A;  5JKL G;  1RCD A;  1XZ3 A;  2ZG9 X;  5D8X A;  3FRR A;  1LKO A;  3AJP A;  3QHC A;  1MOJ A;  3PWQ A;  1YUZ A;  4U3G A;  3F32 A;  1NF6 A;  3RE7 A;  4KXR B;  3R2K A;  3U90 A;  3SHX A;  3GHQ A;  5D8S A;  5GOU A;  3HL1 A;  3R2S A;  4RC5 B;  3VV9 A;  3E6S A;  1OTK A;  2G4H A;  2QF9 A;  3E1O A;  2HR5 A;  3WVV A;  3BVF A;  3QD8 A;  4DAS A;  1JRE A;  4MUD A;  4PGI A;  5D8Y A;  3KA8 A;  3ERZ A;  5JDO A;  4P18 A;  2V2L A;  4DYY A;  5GN8 A;  3IS7 A;  2OC5 A;  2RBD A;  4AM5 A;  1F33 A;  2Y44 A;  2WLA A;  3GE4 A;  4DYX A;  2D5K A;  5LG2 A;  3E1M A;  2CF7 A;  2PYB A;  5FFC A;  2IU2 A;  3FI6 A;  4ZL5 A;  3FVB A;  5GU0 X;  1FHA A;  4Y08 A;  4EVE A;  2ZA8 A;  3Q4N A;  2JD8 0;  4MKU A;  1JTS A;  2YW7 A;  3AJQ A;  4DYZ A;  3F37 A;  3D19 A;  3LKD A;  2V2S A;  1TK6 A;  2V8T A;  2ZA7 A;  2YJK A;  1O9R A;  3WVW A;  4DYU A;  5I4J A;  1YUX A;  5LBH A;  3IS8 A;  3EGM A;  3F39 A;  2GYD A;  3E1N A;  5K53 A;  3RGD A;  3E2C A;  3UNO A;  1Z4A A;  3R2R A;  5J8S A;  4EVB A;  4CVR A;  1Z6O A;  2BK6 A;  3BVI A;  3E1J A;  4M35 A;  4Z5S A;  3AF8 X;  1XZ1 A;  3RD0 A;  3PVT B;  3QZ3 A;  4IWK A; 
#chains in the Genus database with same CATH homology
 3F35 A;  3PW1 B;  4RC7 A;  4OYN A;  3PVR B;  4CYB A;  5D8O A;  3F38 A;  4ISP A;  2CLU A;  4RC6 A;  1NFV A;  1S30 A;  4LPM A;  2YW6 A;  3E1P A;  3UFB A;  5D8Q A;  3QB9 A;  3E1L A;  4Z3B A;  2CN7 A;  4MXP A;  5CZU A;  5GU2 X;  4QUW A;  4ZLW A;  3R2O A;  3N6O A;  3QHB A;  1GWG A;  1ZUJ A;  2Z5Q A;  3C1Z A;  3C21 A;  2FG4 A;  4TOD A;  4TOC A;  2Z6M A;  3C1Y A;  2V15 A;  2XGW A;  2V2M A;  1RYT A;  3M6J A;  3E1Q A;  3UOI A;  2V2O A;  1JIG A;  2V2N A;  2CEI A;  5ERJ A;  5GU1 X;  5K52 A;  3E6R A;  1QYB A;  3BT5 A;  4ZTT A;  1DPS A;  1JGC A;  2V2J A;  3WNW A;  2ZG8 X;  2FL0 A;  4II4 B;  4DE6 A;  4MJY A;  4ITW A;  3KA6 A;  1VLG A;  2OKC A;  4RC5 A;  3VNX A;  1NNQ A;  2AR0 A;  3KA4 A;  2BW1 A;  4TOH A;  5CMR A;  4EVD A;  3FRS A;  3RAV A;  3NOZ X;  3ISE A;  2BJY A;  3Q4Q A;  2ZUR X;  3NP0 X;  3W54 A;  1SOF A;  5JKL A;  4IWJ A;  2XJN A;  2VXI A;  4ZKX A;  3Q4R A;  1ZS3 A;  4M33 A;  4X0J A;  1F30 A;  4LPN A;  4E40 A;  2WTL A;  1B71 A;  4LYU A;  4TOF A;  3MPS A;  3WVU A;  4CYA A;  3FSE A;  4EVC A;  1JI5 A;  2JD6 0;  3PVY B;  5GU3 X;  2FKZ A;  1LKP A;  1AEW A;  3GGY A;  1RCG A;  4DI0 A;  5JKM G;  2G38 B;  3SE1 A;  1L8H A;  4CMY V;  4LQH A;  5D8R A;  4PG1 A;  2GS4 A;  5CMQ A;  4ZJK A;  3SID A;  2XJO A;  3A9Q A;  4TOA A;  1TKO A;  3R2M A;  1QGH A;  3KDQ A;  3PVT A;  3EZ0 A;  3Q4O A;  4ML5 A;  2CWL A;  2X17 0;  3PW8 C;  5FFE A;  3PW1 A;  4ZL6 A;  5JAC A;  4AM2 A;  1EUM A;  3UOF A;  1RCC A;  3KHK A;  2FFX J;  3AF9 X;  3PVR A;  4CY9 A;  2QQY A;  2ZA6 A;  2Z90 A;  3GGZ A;  2FG8 A;  5HJH A;  4W4L B;  3H7G A;  4IXK A;  1DAT A;  4KVR A;  4AM4 A;  2V2R A;  5C6F A;  4M34 A;  2OH3 A;  4E6K A;  4XGS A;  4LYX A;  5J8W A;  4REU A;  1DVB A;  1Z6O M;  4PG0 A;  3SH6 A;  3AF7 X;  3JZA B;  1BFR A;  4ZMC A;  2FJC A;  1J30 A;  2N02 A;  4KVQ A;  2V2P A;  4XKT A;  3F36 A;  4LPJ A;  2WLU A;  5LS9 A;  3JZ9 A;  1KRQ A;  5FFA A;  3O7R A;  2YJJ A;  3NP2 X;  5LG8 A;  3BVK A;  4MY7 A;  3BVE A;  1JI4 A;  4R42 A;  3BKN A;  4YXJ A;  1JKV A;  3HIU A;  1VEL A;  2FZF A;  2FHA A;  1N1Q A;  4WJG 4;  2V2I A;  1R03 A;  4DZ0 A;  3PWF A;  3R2L A;  5D8P A;  3KX9 A;  3GVY A;  1YV1 A;  4LQN A;  1MFR A;  4II4 A;  3T9J A;  3IQ1 A;  1S3Q A;  4A25 A;  4LQV A;  1JKU A;  1RCI A;  3OGH A;  1IER A;  2VXX A;  1BCF A;  4YXM A;  2WWX B;  3F33 A;  1VEQ A;  2CHP A;  4ZKH A;  2F7N A;  1LKM A;  3AK9 A;  4ETR A;  1SQ3 A;  5E2D A;  4TW3 A;  5JDO B;  4ERU A;  4CVT A;  3DBY A;  3KA9 A;  2GYQ A;  2C41 A;  5GN8 B;  4M32 A;  4RC8 A;  4PGK A;  2HTN A;  4MN9 A;  1O9I A;  3PVY A;  4W4K B;  2ZG7 X;  2MGY A;  2Z5P A;  1IES A;  2IB0 A;  1BG7 A;  1L8I A;  5HQO A;  5FFD A;  2C2F A;  2C2J A;  4XKU A;  3TA8 A;  5FEJ A;  1NF4 A;  2Z5R A;  2V8U A;  3AJO A;  5HU6 D;  4ISM A;  4ITT A;  2XKQ A;  2VZB A;  2C6R A;  5AXS A;  3KXU A;  4ZKW A;  3OJ5 A;  3QVD A;  2IY4 A;  3AK8 A;  3ISF A;  3F34 A;  3L0M A;  3VVA A;  4CVP A;  1VEI A;  5J9V A;  1UMN A;  4TOB A;  3O7S A;  4LQJ A;  4KVS A;  2CN6 A;  1VJX A;  4TOE A;  4TO9 A;  3ES3 A;  1TJO A;  4CMY A;  3PZA A;  2UX1 A;  5ERK A;  4RC7 B;  5E1U A;  4YKH A;  3KWO A;  3RBC A;  4YVZ A;  1TKP A;  2JD7 0;  3A68 A;  5JKM A;  5J93 A;  1JYB A;  4RC6 B;  3KA3 A;  1S2Z A;  3BVL A;  2ITB A;  5IX6 A;  4TOG A;  3PW8 A;  2CHI A;  3PWQ C;  2W0O A;  1RCE A;  2CIH A;  5HJF A;  4XKS A;  4CVS A;  2XJM A;  3R2H A;  2CLB A;  2Y3Q A;  3EZU A;  1UVH A;  2BKC A;  1LB3 A;  3V3K B;  1HRS A;  1H96 A;  3C23 A;  5FFB A;  2C2U A;  5JKL G;  1RCD A;  1XZ3 A;  2ZG9 X;  5D8X A;  3FRR A;  1LKO A;  3AJP A;  3QHC A;  1MOJ A;  3PWQ A;  1YUZ A;  4U3G A;  3F32 A;  1NF6 A;  3RE7 A;  4KXR B;  3R2K A;  3U90 A;  3SHX A;  3GHQ A;  5D8S A;  5GOU A;  3HL1 A;  3R2S A;  4RC5 B;  3VV9 A;  3E6S A;  1OTK A;  2G4H A;  2QF9 A;  3E1O A;  2HR5 A;  3WVV A;  3BVF A;  3QD8 A;  4DAS A;  1JRE A;  4MUD A;  4PGI A;  5D8Y A;  3KA8 A;  3ERZ A;  5JDO A;  4P18 A;  2V2L A;  4DYY A;  5GN8 A;  3IS7 A;  2OC5 A;  2RBD A;  4AM5 A;  1F33 A;  2Y44 A;  2WLA A;  3GE4 A;  4DYX A;  2D5K A;  5LG2 A;  3E1M A;  2CF7 A;  2PYB A;  5FFC A;  2IU2 A;  3FI6 A;  4ZL5 A;  3FVB A;  5GU0 X;  1FHA A;  4Y08 A;  4EVE A;  2ZA8 A;  3Q4N A;  2JD8 0;  4MKU A;  1JTS A;  2YW7 A;  3AJQ A;  4DYZ A;  3F37 A;  3D19 A;  3LKD A;  2V2S A;  1TK6 A;  2V8T A;  2ZA7 A;  2YJK A;  1O9R A;  3WVW A;  4DYU A;  5I4J A;  1YUX A;  5LBH A;  3IS8 A;  3EGM A;  3F39 A;  2GYD A;  3E1N A;  5K53 A;  3RGD A;  3E2C A;  3UNO A;  1Z4A A;  3R2R A;  5J8S A;  4EVB A;  4CVR A;  1Z6O A;  2BK6 A;  3BVI A;  3E1J A;  4M35 A;  4Z5S A;  3AF8 X;  1XZ1 A;  3RD0 A;  3PVT B;  3QZ3 A;  4IWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...