2MGYA

Solution structure of the mitochondrial translocator protein (tspo) in complex with its high-affinity ligand pk11195
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
169
structure length
169
Chain Sequence
MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYAGLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translocator protein
publication title Structure of the mitochondrial translocator protein in complex with a diagnostic ligand.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 50
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03073 TspO_MBR TspO/MBR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.100 Mainly Alpha Up-down Bundle Ferritin Ferritin 2mgyA01
2MGYA 2N02A
chains in the Genus database with same CATH superfamily
2CWLA 4YVZA 4YXMA 3KA6A 4DYUA 3KA4A 3C1ZA 4LPNA 1KRQA 4TOGA 3BVIA 4Z3BA 1DPSA 1XZ3A 2CHIA 5FFBA 1LKMA 2BJYA 3WVVA 1S2ZA 3LKDA 3KA3A 4KVQA 5JACA 4CVRA 2V2RA 2QQYA 3SIDA 2Z90A 3E1QA 3PWFA 5CMQA 1VELA 3AF7X 1L8IA 3H7GA 3KA8A 1JKVA 4DYZA 5FFAA 5D8YA 5D8XA 5GOUA 5LS9A 1HRSA 2VXIA 3IQ1A 4CMYV 2D5KA 5JDOB 2RBDA 3GVYA 3U90A 2V2IA 4EVCA 3FRSA 4E40A 5JDOA 2V8UA 4TOCA 4LYUA 1RCCA 1TJOA 3SHXA 1Z4AA 2FL0A 1LKOA 1RCGA 3ES3A 2FKZA 1VEQA 4RC6B 4RC8A 4WJG4 4Z5SA 3QVDA 1IERA 2ZURX 5FFCA 3RBCA 3BVFA 2OH3A 3GGZA 5LBHA 3GGYA 3EZ0A 5JKLA 3E2CA 2GYQA 3Q4RA 3E1MA 1YUXA 3C1YA 1QYBA 2FFXJ 2V2JA 3QB9A 1FHAA 4M35A 2BW1A 2N02A 4MJYA 5J93A 2CIHA 4II4B 1AEWA 5LG2A 2CLBA 2VXXA 1JYBA 5ERJA 4PG0A 4DYXA 1O9IA 2FHAA 3F34A 3UFBA 2V2MA 2HR5A 3E1JA 2C2JA 3NP0X 2AR0A 3GHQA 1H96A 2YJKA 4ZKHA 1RCDA 1VEIA 4MKUA 5LG8A 5I4JA 5GU2X 2OKCA 5HJHA 3TA8A 4ERUA 3FI6A 3M6JA 3HL1A 4TW3A 4ZKWA 3T9JA 4LQJA 3PWQC 4KVRA 4Y08A 1B71A 3AJQA 3KDQA 2WWXB 2VZBA 3V3KB 1YV1A 4KVSA 2V2SA 3F39A 5E1UA 1TK6A 1MOJA 1OTKA 2CN7A 3OJ5A 1JKUA 1BCFA 2ITBA 4MUDA 4LPMA 4W4LB 5JKLG 1N1QA 4MY7A 1EUMA 4QUWA 2G4HA 3KA9A 2V2OA 1LB3A 3JZ9A 1ZS3A 4AM2A 3F36A 1GWGA 2OC5A 3R2RA 3RD0A 3W54A 3SH6A 5E2DA 1VLGA 3PWQA 4LQVA 4DASA 2IB0A 4LQHA 5J8SA 3F38A 4TODA 2C2FA 3PW1A 4EVDA 4ZL5A 3R2HA 3RGDA 1O9RA 2QF9A 1JREA 3E1PA 2V15A 3R2KA 1XZ1A 2W0OA 3F32A 4EVBA 3GE4A 4KXRB 5ERKA 2CN6A 3KX9A 1SOFA 3BT5A 3L0MA 3PZAA 5J9VA 1JIGA 4CY9A 5JKMA 2JD60 2ZG9X 4ISPA 1Z6OA 2V2LA 5K52A 3O7RA 4ITTA 3PVYA 2CF7A 2FJCA 2GYDA 3UOIA 1YUZA 4MXPA 2FG4A 4LQNA 2Z5PA 3O7SA 3PW8C 2G38B 2C41A 3UNOA 3F37A 1NFVA 3KWOA 3OGHA 5GU3X 3BVLA 3E6RA 4R42A 1S30A 4TOEA 3ERZA 2FZFA 3PVTB 5D8SA 1DATA 1UMNA 2XJMA 3PVTA 1MFRA 2CLUA 4CVTA 4PGIA 1RCEA 3A9QA 3IS7A 3QD8A 4LYXA 3F35A 4YXJA 2BKCA 3R2LA 2ZG7X 5D8QA 4IXKA 2C2UA 3PW8A 1UVHA 4ETRA 4ML5A 1F33A 3BVKA 4RC5B 5JKMG 4ISMA 2IU2A 4IWKA 2BK6A 2ZG8X 3WVWA 3KHKA 2IY4A 1TKOA 4RC5A 3RE7A 2CEIA 1QGHA 5K53A 3AK8A 3EZUA 4W4KB 3D19A 3DBYA 4CVPA 1F30A 4X0JA 2C6RA 2YW6A 4DE6A 3WNWA 3PVRA 2XJOA 3VNXA 1RYTA 1VJXA 4REUA 4TOHA 4TOBA 1NF6A 2Z5RA 2Y44A 3AJPA 5HQOA 4ITWA 4E6KA 5GU1X 3ISFA 3AF9X 3VV9A 4TOFA 2Z6MA 2PYBA 1R03A 4M33A 4DI0A 3A68A 2XGWA 3FRRA 3MPSA 3RAVA 1L8HA 3QZ3A 1JTSA 3PW1B 4XKSA 4U3GA 4TOAA 1Z6OM 3Q4NA 1BG7A 1BFRA 4PG1A 2JD70 4M32A 4CVSA 3BVEA 3KXUA 4CYBA 1RCIA 2Z5QA 2X170 2F7NA 4AM4A 1TKPA 2XKQA 3AK9A 5GU0X 5FEJA 5D8RA 3C21A 2GS4A 2XJNA 4XKTA 3PVYB 4AM5A 2JD80 4ZMCA 5AXSA 4ZL6A 4A25A 4OYNA 5HU6D 3R2MA 3JZAB 5D8PA 2V2NA 1LKPA 3WVUA 5J8WA 2V8TA 4DZ0A 5FFEA 3SE1A 1JI4A 3Q4OA 1J30A 4EVEA 5FFDA 3EGMA 4TO9A 5C6FA 3ISEA 2UX1A 3HIUA 3FSEA 3Q4QA 4PGKA 3FVBA 2V2PA 3NOZX 5GN8B 5IX6A 4RC6A 3R2OA 1ZUJA 3IS8A 4CMYA 4ZLWA 4RC7B 5GN8A 2CHPA 4DYYA 4IWJA 2WTLA 2YW7A 3VVAA 2WLUA 3E1NA 4RC7A 2Y3QA 1S3QA 3N6OA 3NP2X 4M34A 2MGYA 2FG8A 2ZA6A 5HJFA 2YJJA 1DVBA 5D8OA 3C23A 4ZJKA 4LPJA 4XGSA 3AF8X 2ZA7A 2ZA8A 4II4A 4CYAA 3E1OA 4P18A 3UOFA 2HTNA 3F33A 4YKHA 3QHBA 1NF4A 3R2SA 1NNQA 3PVRB 1SQ3A 4MN9A 4ZTTA 1JI5A 1IESA 2WLAA 3E6SA 3BKNA 4XKUA 4ZKXA 5CZUA 5CMRA 3E1LA 3AJOA 3QHCA 1JGCA
chains in the Genus database with same CATH topology
2CWLA 4YVZA 4YXMA 3KA6A 4DYUA 3KA4A 3C1ZA 4LPNA 1KRQA 4TOGA 3BVIA 4Z3BA 1DPSA 1XZ3A 2CHIA 5FFBA 1LKMA 2BJYA 3WVVA 1S2ZA 3LKDA 3KA3A 4KVQA 5JACA 4CVRA 2V2RA 2QQYA 3SIDA 2Z90A 3E1QA 3PWFA 5CMQA 1VELA 3AF7X 1L8IA 3H7GA 3KA8A 1JKVA 4DYZA 5FFAA 5D8YA 5D8XA 5GOUA 5LS9A 1HRSA 2VXIA 3IQ1A 4CMYV 2D5KA 5JDOB 2RBDA 3GVYA 3U90A 2V2IA 4EVCA 3FRSA 4E40A 5JDOA 2V8UA 4TOCA 4LYUA 1RCCA 1TJOA 3SHXA 1Z4AA 2FL0A 1LKOA 1RCGA 3ES3A 2FKZA 1VEQA 4RC6B 4RC8A 4WJG4 4Z5SA 3QVDA 1IERA 2ZURX 5FFCA 3RBCA 3BVFA 2OH3A 3GGZA 5LBHA 3GGYA 3EZ0A 5JKLA 3E2CA 2GYQA 3Q4RA 3E1MA 1YUXA 3C1YA 1QYBA 2FFXJ 2V2JA 3QB9A 1FHAA 4M35A 2BW1A 2N02A 4MJYA 5J93A 2CIHA 4II4B 1AEWA 5LG2A 2CLBA 2VXXA 1JYBA 5ERJA 4PG0A 4DYXA 1O9IA 2FHAA 3F34A 3UFBA 2V2MA 2HR5A 3E1JA 2C2JA 3NP0X 2AR0A 3GHQA 1H96A 2YJKA 4ZKHA 1RCDA 1VEIA 4MKUA 5LG8A 5I4JA 5GU2X 2OKCA 5HJHA 3TA8A 4ERUA 3FI6A 3M6JA 3HL1A 4TW3A 4ZKWA 3T9JA 4LQJA 3PWQC 4KVRA 4Y08A 1B71A 3AJQA 3KDQA 2WWXB 2VZBA 3V3KB 1YV1A 4KVSA 2V2SA 3F39A 5E1UA 1TK6A 1MOJA 1OTKA 2CN7A 3OJ5A 1JKUA 1BCFA 2ITBA 4MUDA 4LPMA 4W4LB 5JKLG 1N1QA 4MY7A 1EUMA 4QUWA 2G4HA 3KA9A 2V2OA 1LB3A 3JZ9A 1ZS3A 4AM2A 3F36A 1GWGA 2OC5A 3R2RA 3RD0A 3W54A 3SH6A 5E2DA 1VLGA 3PWQA 4LQVA 4DASA 2IB0A 4LQHA 5J8SA 3F38A 4TODA 2C2FA 3PW1A 4EVDA 4ZL5A 3R2HA 3RGDA 1O9RA 2QF9A 1JREA 3E1PA 2V15A 3R2KA 1XZ1A 2W0OA 3F32A 4EVBA 3GE4A 4KXRB 5ERKA 2CN6A 3KX9A 1SOFA 3BT5A 3L0MA 3PZAA 5J9VA 1JIGA 4CY9A 5JKMA 2JD60 2ZG9X 4ISPA 1Z6OA 2V2LA 5K52A 3O7RA 4ITTA 3PVYA 2CF7A 2FJCA 2GYDA 3UOIA 1YUZA 4MXPA 2FG4A 4LQNA 2Z5PA 3O7SA 3PW8C 2G38B 2C41A 3UNOA 3F37A 1NFVA 3KWOA 3OGHA 5GU3X 3BVLA 3E6RA 4R42A 1S30A 4TOEA 3ERZA 2FZFA 3PVTB 5D8SA 1DATA 1UMNA 2XJMA 3PVTA 1MFRA 2CLUA 4CVTA 4PGIA 1RCEA 3A9QA 3IS7A 3QD8A 4LYXA 3F35A 4YXJA 2BKCA 3R2LA 2ZG7X 5D8QA 4IXKA 2C2UA 3PW8A 1UVHA 4ETRA 4ML5A 1F33A 3BVKA 4RC5B 5JKMG 4ISMA 2IU2A 4IWKA 2BK6A 2ZG8X 3WVWA 3KHKA 2IY4A 1TKOA 4RC5A 3RE7A 2CEIA 1QGHA 5K53A 3AK8A 3EZUA 4W4KB 3D19A 3DBYA 4CVPA 1F30A 4X0JA 2C6RA 2YW6A 4DE6A 3WNWA 3PVRA 2XJOA 3VNXA 1RYTA 1VJXA 4REUA 4TOHA 4TOBA 1NF6A 2Z5RA 2Y44A 3AJPA 5HQOA 4ITWA 4E6KA 5GU1X 3ISFA 3AF9X 3VV9A 4TOFA 2Z6MA 2PYBA 1R03A 4M33A 4DI0A 3A68A 2XGWA 3FRRA 3MPSA 3RAVA 1L8HA 3QZ3A 1JTSA 3PW1B 4XKSA 4U3GA 4TOAA 1Z6OM 3Q4NA 1BG7A 1BFRA 4PG1A 2JD70 4M32A 4CVSA 3BVEA 3KXUA 4CYBA 1RCIA 2Z5QA 2X170 2F7NA 4AM4A 1TKPA 2XKQA 3AK9A 5GU0X 5FEJA 5D8RA 3C21A 2GS4A 2XJNA 4XKTA 3PVYB 4AM5A 2JD80 4ZMCA 5AXSA 4ZL6A 4A25A 4OYNA 5HU6D 3R2MA 3JZAB 5D8PA 2V2NA 1LKPA 3WVUA 5J8WA 2V8TA 4DZ0A 5FFEA 3SE1A 1JI4A 3Q4OA 1J30A 4EVEA 5FFDA 3EGMA 4TO9A 5C6FA 3ISEA 2UX1A 3HIUA 3FSEA 3Q4QA 4PGKA 3FVBA 2V2PA 3NOZX 5GN8B 5IX6A 4RC6A 3R2OA 1ZUJA 3IS8A 4CMYA 4ZLWA 4RC7B 5GN8A 2CHPA 4DYYA 4IWJA 2WTLA 2YW7A 3VVAA 2WLUA 3E1NA 4RC7A 2Y3QA 1S3QA 3N6OA 3NP2X 4M34A 2MGYA 2FG8A 2ZA6A 5HJFA 2YJJA 1DVBA 5D8OA 3C23A 4ZJKA 4LPJA 4XGSA 3AF8X 2ZA7A 2ZA8A 4II4A 4CYAA 3E1OA 4P18A 3UOFA 2HTNA 3F33A 4YKHA 3QHBA 1NF4A 3R2SA 1NNQA 3PVRB 1SQ3A 4MN9A 4ZTTA 1JI5A 1IESA 2WLAA 3E6SA 3BKNA 4XKUA 4ZKXA 5CZUA 5CMRA 3E1LA 3AJOA 3QHCA 1JGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MGY A;  2N02 A; 
#chains in the Genus database with same CATH topology
 2CWL A;  4YVZ A;  4YXM A;  3KA6 A;  4DYU A;  3KA4 A;  3C1Z A;  4LPN A;  1KRQ A;  4TOG A;  3BVI A;  4Z3B A;  1DPS A;  1XZ3 A;  2CHI A;  5FFB A;  1LKM A;  2BJY A;  3WVV A;  1S2Z A;  3LKD A;  3KA3 A;  4KVQ A;  5JAC A;  4CVR A;  2V2R A;  2QQY A;  3SID A;  2Z90 A;  3E1Q A;  3PWF A;  5CMQ A;  1VEL A;  3AF7 X;  1L8I A;  3H7G A;  3KA8 A;  1JKV A;  4DYZ A;  5FFA A;  5D8Y A;  5D8X A;  5GOU A;  5LS9 A;  1HRS A;  2VXI A;  3IQ1 A;  4CMY V;  2D5K A;  5JDO B;  2RBD A;  3GVY A;  3U90 A;  2V2I A;  4EVC A;  3FRS A;  4E40 A;  5JDO A;  2V8U A;  4TOC A;  4LYU A;  1RCC A;  1TJO A;  3SHX A;  1Z4A A;  2FL0 A;  1LKO A;  1RCG A;  3ES3 A;  2FKZ A;  1VEQ A;  4RC6 B;  4RC8 A;  4WJG 4;  4Z5S A;  3QVD A;  1IER A;  2ZUR X;  5FFC A;  3RBC A;  3BVF A;  2OH3 A;  3GGZ A;  5LBH A;  3GGY A;  3EZ0 A;  5JKL A;  3E2C A;  2GYQ A;  3Q4R A;  3E1M A;  1YUX A;  3C1Y A;  1QYB A;  2FFX J;  2V2J A;  3QB9 A;  1FHA A;  4M35 A;  2BW1 A;  2N02 A;  4MJY A;  5J93 A;  2CIH A;  4II4 B;  1AEW A;  5LG2 A;  2CLB A;  2VXX A;  1JYB A;  5ERJ A;  4PG0 A;  4DYX A;  1O9I A;  2FHA A;  3F34 A;  3UFB A;  2V2M A;  2HR5 A;  3E1J A;  2C2J A;  3NP0 X;  2AR0 A;  3GHQ A;  1H96 A;  2YJK A;  4ZKH A;  1RCD A;  1VEI A;  4MKU A;  5LG8 A;  5I4J A;  5GU2 X;  2OKC A;  5HJH A;  3TA8 A;  4ERU A;  3FI6 A;  3M6J A;  3HL1 A;  4TW3 A;  4ZKW A;  3T9J A;  4LQJ A;  3PWQ C;  4KVR A;  4Y08 A;  1B71 A;  3AJQ A;  3KDQ A;  2WWX B;  2VZB A;  3V3K B;  1YV1 A;  4KVS A;  2V2S A;  3F39 A;  5E1U A;  1TK6 A;  1MOJ A;  1OTK A;  2CN7 A;  3OJ5 A;  1JKU A;  1BCF A;  2ITB A;  4MUD A;  4LPM A;  4W4L B;  5JKL G;  1N1Q A;  4MY7 A;  1EUM A;  4QUW A;  2G4H A;  3KA9 A;  2V2O A;  1LB3 A;  3JZ9 A;  1ZS3 A;  4AM2 A;  3F36 A;  1GWG A;  2OC5 A;  3R2R A;  3RD0 A;  3W54 A;  3SH6 A;  5E2D A;  1VLG A;  3PWQ A;  4LQV A;  4DAS A;  2IB0 A;  4LQH A;  5J8S A;  3F38 A;  4TOD A;  2C2F A;  3PW1 A;  4EVD A;  4ZL5 A;  3R2H A;  3RGD A;  1O9R A;  2QF9 A;  1JRE A;  3E1P A;  2V15 A;  3R2K A;  1XZ1 A;  2W0O A;  3F32 A;  4EVB A;  3GE4 A;  4KXR B;  5ERK A;  2CN6 A;  3KX9 A;  1SOF A;  3BT5 A;  3L0M A;  3PZA A;  5J9V A;  1JIG A;  4CY9 A;  5JKM A;  2JD6 0;  2ZG9 X;  4ISP A;  1Z6O A;  2V2L A;  5K52 A;  3O7R A;  4ITT A;  3PVY A;  2CF7 A;  2FJC A;  2GYD A;  3UOI A;  1YUZ A;  4MXP A;  2FG4 A;  4LQN A;  2Z5P A;  3O7S A;  3PW8 C;  2G38 B;  2C41 A;  3UNO A;  3F37 A;  1NFV A;  3KWO A;  3OGH A;  5GU3 X;  3BVL A;  3E6R A;  4R42 A;  1S30 A;  4TOE A;  3ERZ A;  2FZF A;  3PVT B;  5D8S A;  1DAT A;  1UMN A;  2XJM A;  3PVT A;  1MFR A;  2CLU A;  4CVT A;  4PGI A;  1RCE A;  3A9Q A;  3IS7 A;  3QD8 A;  4LYX A;  3F35 A;  4YXJ A;  2BKC A;  3R2L A;  2ZG7 X;  5D8Q A;  4IXK A;  2C2U A;  3PW8 A;  1UVH A;  4ETR A;  4ML5 A;  1F33 A;  3BVK A;  4RC5 B;  5JKM G;  4ISM A;  2IU2 A;  4IWK A;  2BK6 A;  2ZG8 X;  3WVW A;  3KHK A;  2IY4 A;  1TKO A;  4RC5 A;  3RE7 A;  2CEI A;  1QGH A;  5K53 A;  3AK8 A;  3EZU A;  4W4K B;  3D19 A;  3DBY A;  4CVP A;  1F30 A;  4X0J A;  2C6R A;  2YW6 A;  4DE6 A;  3WNW A;  3PVR A;  2XJO A;  3VNX A;  1RYT A;  1VJX A;  4REU A;  4TOH A;  4TOB A;  1NF6 A;  2Z5R A;  2Y44 A;  3AJP A;  5HQO A;  4ITW A;  4E6K A;  5GU1 X;  3ISF A;  3AF9 X;  3VV9 A;  4TOF A;  2Z6M A;  2PYB A;  1R03 A;  4M33 A;  4DI0 A;  3A68 A;  2XGW A;  3FRR A;  3MPS A;  3RAV A;  1L8H A;  3QZ3 A;  1JTS A;  3PW1 B;  4XKS A;  4U3G A;  4TOA A;  1Z6O M;  3Q4N A;  1BG7 A;  1BFR A;  4PG1 A;  2JD7 0;  4M32 A;  4CVS A;  3BVE A;  3KXU A;  4CYB A;  1RCI A;  2Z5Q A;  2X17 0;  2F7N A;  4AM4 A;  1TKP A;  2XKQ A;  3AK9 A;  5GU0 X;  5FEJ A;  5D8R A;  3C21 A;  2GS4 A;  2XJN A;  4XKT A;  3PVY B;  4AM5 A;  2JD8 0;  4ZMC A;  5AXS A;  4ZL6 A;  4A25 A;  4OYN A;  5HU6 D;  3R2M A;  3JZA B;  5D8P A;  2V2N A;  1LKP A;  3WVU A;  5J8W A;  2V8T A;  4DZ0 A;  5FFE A;  3SE1 A;  1JI4 A;  3Q4O A;  1J30 A;  4EVE A;  5FFD A;  3EGM A;  4TO9 A;  5C6F A;  3ISE A;  2UX1 A;  3HIU A;  3FSE A;  3Q4Q A;  4PGK A;  3FVB A;  2V2P A;  3NOZ X;  5GN8 B;  5IX6 A;  4RC6 A;  3R2O A;  1ZUJ A;  3IS8 A;  4CMY A;  4ZLW A;  4RC7 B;  5GN8 A;  2CHP A;  4DYY A;  4IWJ A;  2WTL A;  2YW7 A;  3VVA A;  2WLU A;  3E1N A;  4RC7 A;  2Y3Q A;  1S3Q A;  3N6O A;  3NP2 X;  4M34 A;  2MGY A;  2FG8 A;  2ZA6 A;  5HJF A;  2YJJ A;  1DVB A;  5D8O A;  3C23 A;  4ZJK A;  4LPJ A;  4XGS A;  3AF8 X;  2ZA7 A;  2ZA8 A;  4II4 A;  4CYA A;  3E1O A;  4P18 A;  3UOF A;  2HTN A;  3F33 A;  4YKH A;  3QHB A;  1NF4 A;  3R2S A;  1NNQ A;  3PVR B;  1SQ3 A;  4MN9 A;  4ZTT A;  1JI5 A;  1IES A;  2WLA A;  3E6S A;  3BKN A;  4XKU A;  4ZKX A;  5CZU A;  5CMR A;  3E1L A;  3AJO A;  3QHC A;  1JGC A; 
#chains in the Genus database with same CATH homology
 2CWL A;  4YVZ A;  4YXM A;  3KA6 A;  4DYU A;  3KA4 A;  3C1Z A;  4LPN A;  1KRQ A;  4TOG A;  3BVI A;  4Z3B A;  1DPS A;  1XZ3 A;  2CHI A;  5FFB A;  1LKM A;  2BJY A;  3WVV A;  1S2Z A;  3LKD A;  3KA3 A;  4KVQ A;  5JAC A;  4CVR A;  2V2R A;  2QQY A;  3SID A;  2Z90 A;  3E1Q A;  3PWF A;  5CMQ A;  1VEL A;  3AF7 X;  1L8I A;  3H7G A;  3KA8 A;  1JKV A;  4DYZ A;  5FFA A;  5D8Y A;  5D8X A;  5GOU A;  5LS9 A;  1HRS A;  2VXI A;  3IQ1 A;  4CMY V;  2D5K A;  5JDO B;  2RBD A;  3GVY A;  3U90 A;  2V2I A;  4EVC A;  3FRS A;  4E40 A;  5JDO A;  2V8U A;  4TOC A;  4LYU A;  1RCC A;  1TJO A;  3SHX A;  1Z4A A;  2FL0 A;  1LKO A;  1RCG A;  3ES3 A;  2FKZ A;  1VEQ A;  4RC6 B;  4RC8 A;  4WJG 4;  4Z5S A;  3QVD A;  1IER A;  2ZUR X;  5FFC A;  3RBC A;  3BVF A;  2OH3 A;  3GGZ A;  5LBH A;  3GGY A;  3EZ0 A;  5JKL A;  3E2C A;  2GYQ A;  3Q4R A;  3E1M A;  1YUX A;  3C1Y A;  1QYB A;  2FFX J;  2V2J A;  3QB9 A;  1FHA A;  4M35 A;  2BW1 A;  2N02 A;  4MJY A;  5J93 A;  2CIH A;  4II4 B;  1AEW A;  5LG2 A;  2CLB A;  2VXX A;  1JYB A;  5ERJ A;  4PG0 A;  4DYX A;  1O9I A;  2FHA A;  3F34 A;  3UFB A;  2V2M A;  2HR5 A;  3E1J A;  2C2J A;  3NP0 X;  2AR0 A;  3GHQ A;  1H96 A;  2YJK A;  4ZKH A;  1RCD A;  1VEI A;  4MKU A;  5LG8 A;  5I4J A;  5GU2 X;  2OKC A;  5HJH A;  3TA8 A;  4ERU A;  3FI6 A;  3M6J A;  3HL1 A;  4TW3 A;  4ZKW A;  3T9J A;  4LQJ A;  3PWQ C;  4KVR A;  4Y08 A;  1B71 A;  3AJQ A;  3KDQ A;  2WWX B;  2VZB A;  3V3K B;  1YV1 A;  4KVS A;  2V2S A;  3F39 A;  5E1U A;  1TK6 A;  1MOJ A;  1OTK A;  2CN7 A;  3OJ5 A;  1JKU A;  1BCF A;  2ITB A;  4MUD A;  4LPM A;  4W4L B;  5JKL G;  1N1Q A;  4MY7 A;  1EUM A;  4QUW A;  2G4H A;  3KA9 A;  2V2O A;  1LB3 A;  3JZ9 A;  1ZS3 A;  4AM2 A;  3F36 A;  1GWG A;  2OC5 A;  3R2R A;  3RD0 A;  3W54 A;  3SH6 A;  5E2D A;  1VLG A;  3PWQ A;  4LQV A;  4DAS A;  2IB0 A;  4LQH A;  5J8S A;  3F38 A;  4TOD A;  2C2F A;  3PW1 A;  4EVD A;  4ZL5 A;  3R2H A;  3RGD A;  1O9R A;  2QF9 A;  1JRE A;  3E1P A;  2V15 A;  3R2K A;  1XZ1 A;  2W0O A;  3F32 A;  4EVB A;  3GE4 A;  4KXR B;  5ERK A;  2CN6 A;  3KX9 A;  1SOF A;  3BT5 A;  3L0M A;  3PZA A;  5J9V A;  1JIG A;  4CY9 A;  5JKM A;  2JD6 0;  2ZG9 X;  4ISP A;  1Z6O A;  2V2L A;  5K52 A;  3O7R A;  4ITT A;  3PVY A;  2CF7 A;  2FJC A;  2GYD A;  3UOI A;  1YUZ A;  4MXP A;  2FG4 A;  4LQN A;  2Z5P A;  3O7S A;  3PW8 C;  2G38 B;  2C41 A;  3UNO A;  3F37 A;  1NFV A;  3KWO A;  3OGH A;  5GU3 X;  3BVL A;  3E6R A;  4R42 A;  1S30 A;  4TOE A;  3ERZ A;  2FZF A;  3PVT B;  5D8S A;  1DAT A;  1UMN A;  2XJM A;  3PVT A;  1MFR A;  2CLU A;  4CVT A;  4PGI A;  1RCE A;  3A9Q A;  3IS7 A;  3QD8 A;  4LYX A;  3F35 A;  4YXJ A;  2BKC A;  3R2L A;  2ZG7 X;  5D8Q A;  4IXK A;  2C2U A;  3PW8 A;  1UVH A;  4ETR A;  4ML5 A;  1F33 A;  3BVK A;  4RC5 B;  5JKM G;  4ISM A;  2IU2 A;  4IWK A;  2BK6 A;  2ZG8 X;  3WVW A;  3KHK A;  2IY4 A;  1TKO A;  4RC5 A;  3RE7 A;  2CEI A;  1QGH A;  5K53 A;  3AK8 A;  3EZU A;  4W4K B;  3D19 A;  3DBY A;  4CVP A;  1F30 A;  4X0J A;  2C6R A;  2YW6 A;  4DE6 A;  3WNW A;  3PVR A;  2XJO A;  3VNX A;  1RYT A;  1VJX A;  4REU A;  4TOH A;  4TOB A;  1NF6 A;  2Z5R A;  2Y44 A;  3AJP A;  5HQO A;  4ITW A;  4E6K A;  5GU1 X;  3ISF A;  3AF9 X;  3VV9 A;  4TOF A;  2Z6M A;  2PYB A;  1R03 A;  4M33 A;  4DI0 A;  3A68 A;  2XGW A;  3FRR A;  3MPS A;  3RAV A;  1L8H A;  3QZ3 A;  1JTS A;  3PW1 B;  4XKS A;  4U3G A;  4TOA A;  1Z6O M;  3Q4N A;  1BG7 A;  1BFR A;  4PG1 A;  2JD7 0;  4M32 A;  4CVS A;  3BVE A;  3KXU A;  4CYB A;  1RCI A;  2Z5Q A;  2X17 0;  2F7N A;  4AM4 A;  1TKP A;  2XKQ A;  3AK9 A;  5GU0 X;  5FEJ A;  5D8R A;  3C21 A;  2GS4 A;  2XJN A;  4XKT A;  3PVY B;  4AM5 A;  2JD8 0;  4ZMC A;  5AXS A;  4ZL6 A;  4A25 A;  4OYN A;  5HU6 D;  3R2M A;  3JZA B;  5D8P A;  2V2N A;  1LKP A;  3WVU A;  5J8W A;  2V8T A;  4DZ0 A;  5FFE A;  3SE1 A;  1JI4 A;  3Q4O A;  1J30 A;  4EVE A;  5FFD A;  3EGM A;  4TO9 A;  5C6F A;  3ISE A;  2UX1 A;  3HIU A;  3FSE A;  3Q4Q A;  4PGK A;  3FVB A;  2V2P A;  3NOZ X;  5GN8 B;  5IX6 A;  4RC6 A;  3R2O A;  1ZUJ A;  3IS8 A;  4CMY A;  4ZLW A;  4RC7 B;  5GN8 A;  2CHP A;  4DYY A;  4IWJ A;  2WTL A;  2YW7 A;  3VVA A;  2WLU A;  3E1N A;  4RC7 A;  2Y3Q A;  1S3Q A;  3N6O A;  3NP2 X;  4M34 A;  2MGY A;  2FG8 A;  2ZA6 A;  5HJF A;  2YJJ A;  1DVB A;  5D8O A;  3C23 A;  4ZJK A;  4LPJ A;  4XGS A;  3AF8 X;  2ZA7 A;  2ZA8 A;  4II4 A;  4CYA A;  3E1O A;  4P18 A;  3UOF A;  2HTN A;  3F33 A;  4YKH A;  3QHB A;  1NF4 A;  3R2S A;  1NNQ A;  3PVR B;  1SQ3 A;  4MN9 A;  4ZTT A;  1JI5 A;  1IES A;  2WLA A;  3E6S A;  3BKN A;  4XKU A;  4ZKX A;  5CZU A;  5CMR A;  3E1L A;  3AJO A;  3QHC A;  1JGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...