2MGYA

Solution structure of the mitochondrial translocator protein (tspo) in complex with its high-affinity ligand pk11195
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
169
structure length
169
Chain Sequence
MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYAGLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Translocator protein
publication title Structure of the mitochondrial translocator protein in complex with a diagnostic ligand.
pubmed doi rcsb
source organism Mus musculus
total genus 50
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03073 TspO_MBR TspO/MBR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.100 Mainly Alpha Up-down Bundle Ferritin Ferritin 2mgyA01
2N02A 2MGYA
chains in the Genus database with same CATH superfamily
2WLAA 3GE4A 1GWGA 3MPSA 4RC6B 5I4JA 4IXKA 3RGDA 1JREA 2X170 3SHXA 4EVEA 4ZMCA 5D8PA 2XJOA 3E1QA 4II4B 4RC7A 3F38A 3V3KB 2V8UA 3VNXA 3AJOA 1N1QA 2CN6A 5J9VA 4TW3A 2V2PA 3C23A 3PW1A 2D5KA 3UOFA 1RCGA 4RC6A 4Z3BA 3PW8C 1JKUA 1JKVA 2QF9A 4ZJKA 1YUXA 2YW6A 4II4A 3KA4A 2FFXJ 4ML5A 1JI4A 3GVYA 4ERUA 3WVUA 3W54A 4CVSA 5GN8A 1R03A 4MY7A 1DPSA 1LB3A 2Z5PA 4REUA 3E6SA 2CLBA 2ZA6A 3BVFA 2CN7A 1QYBA 3EGMA 5GU0X 3F33A 1VELA 3HIUA 1RCIA 4AM5A 3Q4RA 2PYBA 1NFVA 2V2RA 1BCFA 2Z5QA 4TOBA 3F37A 3KA8A 2FHAA 3PWQA 3Q4OA 5D8RA 3FSEA 3L0MA 2HR5A 2V15A 2ZG9X 3KHKA 2Y3QA 3PZAA 1XZ1A 2C2JA 4DZ0A 4Y08A 1NF4A 3F34A 1RYTA 1UVHA 3WNWA 5D8YA 2V2NA 3VVAA 4W4LB 5FEJA 1L8IA 3AJPA 2RBDA 1XZ3A 5HJHA 3AK8A 1YV1A 3IS8A 3BVKA 3KA6A 4E40A 3E2CA 2WTLA 2ZA7A 3NP0X 4QUWA 2JD70 1NF6A 1YUZA 4LQNA 1AEWA 2IY4A 3PWQC 5HJFA 5JKLA 1JYBA 1JI5A 5E1UA 4U3GA 3QHCA 3M6JA 3R2LA 1Z6OA 1JTSA 3AF7X 4MN9A 4ETRA 3C1YA 3RD0A 5D8XA 1MOJA 3FRSA 4LPNA 4R42A 3AF9X 3Q4NA 3SH6A 4CMYA 3LKDA 2OH3A 4RC5B 4M35A 4DYZA 1L8HA 4ZL6A 3OGHA 1O9IA 3R2OA 2ZA8A 3AJQA 2W0OA 2BK6A 1LKMA 5C6FA 3RBCA 4LYXA 1LKOA 3E1MA 3OJ5A 5GOUA 4WJG4 4YKHA 4ZKHA 4MXPA 4DYYA 4MKUA 4RC5A 3HL1A 2C2FA 4LQHA 2FJCA 4EVDA 1OTKA 3BKNA 1EUMA 3IS7A 3UFBA 5LG2A 4CMYV 3C1ZA 4E6KA 3WVWA 3D19A 2XJNA 2CF7A 2F7NA 3F39A 2Z90A 4ZKWA 4DASA 3PVRB 3ES3A 4TOFA 3QB9A 4OYNA 4PGIA 4XGSA 5JKMA 3C21A 3PVYB 5CMRA 5JDOB 2CIHA 1RCDA 3QD8A 3E6RA 4YXJA 1NNQA 3JZ9A 3KXUA 2V2MA 2IU2A 1DATA 2FG4A 4ISPA 3GGZA 4DYUA 3KDQA 5JACA 3R2RA 1HRSA 3PVRA 4A25A 3KWOA 1IERA 2OKCA 5K53A 3IQ1A 1O9RA 1ZUJA 1VLGA 3PVYA 4CVRA 4X0JA 3WVVA 4DI0A 4ZL5A 4LPJA 2XGWA 3VV9A 2YJJA 2V2SA 1J30A 4CVTA 5GU1X 3GGYA 5LS9A 2HTNA 3E1PA 2WWXB 2ITBA 5K52A 5ERJA 2VZBA 1S30A 2GS4A 4CYBA 4Z5SA 5GU2X 2CHPA 2G4HA 1BFRA 5GU3X 3UOIA 3TA8A 3KA9A 4TO9A 3NOZX 4LQJA 4EVBA 2ZG8X 3BVEA 4M32A 2ZG7X 4EVCA 4TOEA 3A68A 4P18A 3ISEA 3QZ3A 4W4KB 2FZFA 1UMNA 5D8SA 3SIDA 1SOFA 3PW8A 4CY9A 3NP2X 3R2MA 4XKSA 5LBHA 1BG7A 2GYDA 2ZURX 3O7SA 1LKPA 1KRQA 1DVBA 3E1OA 4ITTA 4XKTA 2MGYA 1TKOA 2FKZA 1TKPA 2CEIA 3UNOA 3PW1B 4IWKA 2BKCA 1TJOA 1RCCA 2VXXA 3Q4QA 4AM2A 4ZLWA 2FG8A 5AXSA 2N02A 3RE7A 2C2UA 5ERKA 3ERZA 5JKMG 1FHAA 1B71A 3KX9A 2WLUA 4MJYA 5FFDA 4MUDA 2G38B 5GN8B 3E1JA 4KVQA 2BW1A 2CHIA 3BVLA 2JD80 3F32A 1QGHA 3R2SA 3QVDA 3F36A 3BT5A 1VEIA 2JD60 5J8SA 2YW7A 2V8TA 1Z6OM 5E2DA 2BJYA 3RAVA 2Z6MA 1H96A 4CVPA 3T9JA 2OC5A 2V2IA 5J8WA 1F30A 4ZTTA 2UX1A 2V2LA 4XKUA 5JDOA 4ZKXA 3PWFA 3E1LA 2XKQA 5D8QA 2V2JA 4YVZA 4TOGA 4KVRA 5J93A 3PVTB 3O7RA 5FFBA 3FRRA 5LG8A 3A9QA 4IWJA 1MFRA 4LPMA 4M34A 4PGKA 2Y44A 3H7GA 1VJXA 1ZS3A 4DE6A 4PG1A 3EZUA 3N6OA 5FFEA 3FVBA 1JGCA 2FL0A 5HU6D 5JKLG 2IB0A 1S2ZA 3DBYA 5FFCA 3PVTA 3R2HA 3AF8X 3SE1A 1RCEA 3F35A 1SQ3A 3QHBA 4RC8A 3KA3A 3JZAB 2C41A 5IX6A 2QQYA 3AK9A 5CMQA 2YJKA 3BVIA 5CZUA 4AM4A 3EZ0A 2XJMA 5D8OA 4YXMA 4KXRB 2AR0A 1TK6A 5FFAA 4TOCA 2CWLA 4TODA 3ISFA 4ISMA 4DYXA 5HQOA 1Z4AA 4KVSA 4PG0A 4TOHA 4LYUA 4M33A 4CYAA 3GHQA 3FI6A 4TOAA 2VXIA 2V2OA 2CLUA 2C6RA 1S3QA 3E1NA 4LQVA 1JIGA 4RC7B 4ITWA 3R2KA 3U90A 2Z5RA 1F33A 2GYQA 1VEQA 1IESA
chains in the Genus database with same CATH topology
2WLAA 3GE4A 1GWGA 3MPSA 4RC6B 5I4JA 4IXKA 3RGDA 1JREA 2X170 3SHXA 4EVEA 4ZMCA 5D8PA 2XJOA 3E1QA 4II4B 4RC7A 3F38A 3V3KB 2V8UA 3VNXA 3AJOA 1N1QA 2CN6A 5J9VA 4TW3A 2V2PA 3C23A 3PW1A 2D5KA 3UOFA 1RCGA 4RC6A 4Z3BA 3PW8C 1JKUA 1JKVA 2QF9A 4ZJKA 1YUXA 2YW6A 4II4A 3KA4A 2FFXJ 4ML5A 1JI4A 3GVYA 4ERUA 3WVUA 3W54A 4CVSA 5GN8A 1R03A 4MY7A 1DPSA 1LB3A 2Z5PA 4REUA 3E6SA 2CLBA 2ZA6A 3BVFA 2CN7A 1QYBA 3EGMA 5GU0X 3F33A 1VELA 3HIUA 1RCIA 4AM5A 3Q4RA 2PYBA 1NFVA 2V2RA 1BCFA 2Z5QA 4TOBA 3F37A 3KA8A 2FHAA 3PWQA 3Q4OA 5D8RA 3FSEA 3L0MA 2HR5A 2V15A 2ZG9X 3KHKA 2Y3QA 3PZAA 1XZ1A 2C2JA 4DZ0A 4Y08A 1NF4A 3F34A 1RYTA 1UVHA 3WNWA 5D8YA 2V2NA 3VVAA 4W4LB 5FEJA 1L8IA 3AJPA 2RBDA 1XZ3A 5HJHA 3AK8A 1YV1A 3IS8A 3BVKA 3KA6A 4E40A 3E2CA 2WTLA 2ZA7A 3NP0X 4QUWA 2JD70 1NF6A 1YUZA 4LQNA 1AEWA 2IY4A 3PWQC 5HJFA 5JKLA 1JYBA 1JI5A 5E1UA 4U3GA 3QHCA 3M6JA 3R2LA 1Z6OA 1JTSA 3AF7X 4MN9A 4ETRA 3C1YA 3RD0A 5D8XA 1MOJA 3FRSA 4LPNA 4R42A 3AF9X 3Q4NA 3SH6A 4CMYA 3LKDA 2OH3A 4RC5B 4M35A 4DYZA 1L8HA 4ZL6A 3OGHA 1O9IA 3R2OA 2ZA8A 3AJQA 2W0OA 2BK6A 1LKMA 5C6FA 3RBCA 4LYXA 1LKOA 3E1MA 3OJ5A 5GOUA 4WJG4 4YKHA 4ZKHA 4MXPA 4DYYA 4MKUA 4RC5A 3HL1A 2C2FA 4LQHA 2FJCA 4EVDA 1OTKA 3BKNA 1EUMA 3IS7A 3UFBA 5LG2A 4CMYV 3C1ZA 4E6KA 3WVWA 3D19A 2XJNA 2CF7A 2F7NA 3F39A 2Z90A 4ZKWA 4DASA 3PVRB 3ES3A 4TOFA 3QB9A 4OYNA 4PGIA 4XGSA 5JKMA 3C21A 3PVYB 5CMRA 5JDOB 2CIHA 1RCDA 3QD8A 3E6RA 4YXJA 1NNQA 3JZ9A 3KXUA 2V2MA 2IU2A 1DATA 2FG4A 4ISPA 3GGZA 4DYUA 3KDQA 5JACA 3R2RA 1HRSA 3PVRA 4A25A 3KWOA 1IERA 2OKCA 5K53A 3IQ1A 1O9RA 1ZUJA 1VLGA 3PVYA 4CVRA 4X0JA 3WVVA 4DI0A 4ZL5A 4LPJA 2XGWA 3VV9A 2YJJA 2V2SA 1J30A 4CVTA 5GU1X 3GGYA 5LS9A 2HTNA 3E1PA 2WWXB 2ITBA 5K52A 5ERJA 2VZBA 1S30A 2GS4A 4CYBA 4Z5SA 5GU2X 2CHPA 2G4HA 1BFRA 5GU3X 3UOIA 3TA8A 3KA9A 4TO9A 3NOZX 4LQJA 4EVBA 2ZG8X 3BVEA 4M32A 2ZG7X 4EVCA 4TOEA 3A68A 4P18A 3ISEA 3QZ3A 4W4KB 2FZFA 1UMNA 5D8SA 3SIDA 1SOFA 3PW8A 4CY9A 3NP2X 3R2MA 4XKSA 5LBHA 1BG7A 2GYDA 2ZURX 3O7SA 1LKPA 1KRQA 1DVBA 3E1OA 4ITTA 4XKTA 2MGYA 1TKOA 2FKZA 1TKPA 2CEIA 3UNOA 3PW1B 4IWKA 2BKCA 1TJOA 1RCCA 2VXXA 3Q4QA 4AM2A 4ZLWA 2FG8A 5AXSA 2N02A 3RE7A 2C2UA 5ERKA 3ERZA 5JKMG 1FHAA 1B71A 3KX9A 2WLUA 4MJYA 5FFDA 4MUDA 2G38B 5GN8B 3E1JA 4KVQA 2BW1A 2CHIA 3BVLA 2JD80 3F32A 1QGHA 3R2SA 3QVDA 3F36A 3BT5A 1VEIA 2JD60 5J8SA 2YW7A 2V8TA 1Z6OM 5E2DA 2BJYA 3RAVA 2Z6MA 1H96A 4CVPA 3T9JA 2OC5A 2V2IA 5J8WA 1F30A 4ZTTA 2UX1A 2V2LA 4XKUA 5JDOA 4ZKXA 3PWFA 3E1LA 2XKQA 5D8QA 2V2JA 4YVZA 4TOGA 4KVRA 5J93A 3PVTB 3O7RA 5FFBA 3FRRA 5LG8A 3A9QA 4IWJA 1MFRA 4LPMA 4M34A 4PGKA 2Y44A 3H7GA 1VJXA 1ZS3A 4DE6A 4PG1A 3EZUA 3N6OA 5FFEA 3FVBA 1JGCA 2FL0A 5HU6D 5JKLG 2IB0A 1S2ZA 3DBYA 5FFCA 3PVTA 3R2HA 3AF8X 3SE1A 1RCEA 3F35A 1SQ3A 3QHBA 4RC8A 3KA3A 3JZAB 2C41A 5IX6A 2QQYA 3AK9A 5CMQA 2YJKA 3BVIA 5CZUA 4AM4A 3EZ0A 2XJMA 5D8OA 4YXMA 4KXRB 2AR0A 1TK6A 5FFAA 4TOCA 2CWLA 4TODA 3ISFA 4ISMA 4DYXA 5HQOA 1Z4AA 4KVSA 4PG0A 4TOHA 4LYUA 4M33A 4CYAA 3GHQA 3FI6A 4TOAA 2VXIA 2V2OA 2CLUA 2C6RA 1S3QA 3E1NA 4LQVA 1JIGA 4RC7B 4ITWA 3R2KA 3U90A 2Z5RA 1F33A 2GYQA 1VEQA 1IESA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N02 A;  2MGY A; 
#chains in the Genus database with same CATH topology
 2WLA A;  3GE4 A;  1GWG A;  3MPS A;  4RC6 B;  5I4J A;  4IXK A;  3RGD A;  1JRE A;  2X17 0;  3SHX A;  4EVE A;  4ZMC A;  5D8P A;  2XJO A;  3E1Q A;  4II4 B;  4RC7 A;  3F38 A;  3V3K B;  2V8U A;  3VNX A;  3AJO A;  1N1Q A;  2CN6 A;  5J9V A;  4TW3 A;  2V2P A;  3C23 A;  3PW1 A;  2D5K A;  3UOF A;  1RCG A;  4RC6 A;  4Z3B A;  3PW8 C;  1JKU A;  1JKV A;  2QF9 A;  4ZJK A;  1YUX A;  2YW6 A;  4II4 A;  3KA4 A;  2FFX J;  4ML5 A;  1JI4 A;  3GVY A;  4ERU A;  3WVU A;  3W54 A;  4CVS A;  5GN8 A;  1R03 A;  4MY7 A;  1DPS A;  1LB3 A;  2Z5P A;  4REU A;  3E6S A;  2CLB A;  2ZA6 A;  3BVF A;  2CN7 A;  1QYB A;  3EGM A;  5GU0 X;  3F33 A;  1VEL A;  3HIU A;  1RCI A;  4AM5 A;  3Q4R A;  2PYB A;  1NFV A;  2V2R A;  1BCF A;  2Z5Q A;  4TOB A;  3F37 A;  3KA8 A;  2FHA A;  3PWQ A;  3Q4O A;  5D8R A;  3FSE A;  3L0M A;  2HR5 A;  2V15 A;  2ZG9 X;  3KHK A;  2Y3Q A;  3PZA A;  1XZ1 A;  2C2J A;  4DZ0 A;  4Y08 A;  1NF4 A;  3F34 A;  1RYT A;  1UVH A;  3WNW A;  5D8Y A;  2V2N A;  3VVA A;  4W4L B;  5FEJ A;  1L8I A;  3AJP A;  2RBD A;  1XZ3 A;  5HJH A;  3AK8 A;  1YV1 A;  3IS8 A;  3BVK A;  3KA6 A;  4E40 A;  3E2C A;  2WTL A;  2ZA7 A;  3NP0 X;  4QUW A;  2JD7 0;  1NF6 A;  1YUZ A;  4LQN A;  1AEW A;  2IY4 A;  3PWQ C;  5HJF A;  5JKL A;  1JYB A;  1JI5 A;  5E1U A;  4U3G A;  3QHC A;  3M6J A;  3R2L A;  1Z6O A;  1JTS A;  3AF7 X;  4MN9 A;  4ETR A;  3C1Y A;  3RD0 A;  5D8X A;  1MOJ A;  3FRS A;  4LPN A;  4R42 A;  3AF9 X;  3Q4N A;  3SH6 A;  4CMY A;  3LKD A;  2OH3 A;  4RC5 B;  4M35 A;  4DYZ A;  1L8H A;  4ZL6 A;  3OGH A;  1O9I A;  3R2O A;  2ZA8 A;  3AJQ A;  2W0O A;  2BK6 A;  1LKM A;  5C6F A;  3RBC A;  4LYX A;  1LKO A;  3E1M A;  3OJ5 A;  5GOU A;  4WJG 4;  4YKH A;  4ZKH A;  4MXP A;  4DYY A;  4MKU A;  4RC5 A;  3HL1 A;  2C2F A;  4LQH A;  2FJC A;  4EVD A;  1OTK A;  3BKN A;  1EUM A;  3IS7 A;  3UFB A;  5LG2 A;  4CMY V;  3C1Z A;  4E6K A;  3WVW A;  3D19 A;  2XJN A;  2CF7 A;  2F7N A;  3F39 A;  2Z90 A;  4ZKW A;  4DAS A;  3PVR B;  3ES3 A;  4TOF A;  3QB9 A;  4OYN A;  4PGI A;  4XGS A;  5JKM A;  3C21 A;  3PVY B;  5CMR A;  5JDO B;  2CIH A;  1RCD A;  3QD8 A;  3E6R A;  4YXJ A;  1NNQ A;  3JZ9 A;  3KXU A;  2V2M A;  2IU2 A;  1DAT A;  2FG4 A;  4ISP A;  3GGZ A;  4DYU A;  3KDQ A;  5JAC A;  3R2R A;  1HRS A;  3PVR A;  4A25 A;  3KWO A;  1IER A;  2OKC A;  5K53 A;  3IQ1 A;  1O9R A;  1ZUJ A;  1VLG A;  3PVY A;  4CVR A;  4X0J A;  3WVV A;  4DI0 A;  4ZL5 A;  4LPJ A;  2XGW A;  3VV9 A;  2YJJ A;  2V2S A;  1J30 A;  4CVT A;  5GU1 X;  3GGY A;  5LS9 A;  2HTN A;  3E1P A;  2WWX B;  2ITB A;  5K52 A;  5ERJ A;  2VZB A;  1S30 A;  2GS4 A;  4CYB A;  4Z5S A;  5GU2 X;  2CHP A;  2G4H A;  1BFR A;  5GU3 X;  3UOI A;  3TA8 A;  3KA9 A;  4TO9 A;  3NOZ X;  4LQJ A;  4EVB A;  2ZG8 X;  3BVE A;  4M32 A;  2ZG7 X;  4EVC A;  4TOE A;  3A68 A;  4P18 A;  3ISE A;  3QZ3 A;  4W4K B;  2FZF A;  1UMN A;  5D8S A;  3SID A;  1SOF A;  3PW8 A;  4CY9 A;  3NP2 X;  3R2M A;  4XKS A;  5LBH A;  1BG7 A;  2GYD A;  2ZUR X;  3O7S A;  1LKP A;  1KRQ A;  1DVB A;  3E1O A;  4ITT A;  4XKT A;  2MGY A;  1TKO A;  2FKZ A;  1TKP A;  2CEI A;  3UNO A;  3PW1 B;  4IWK A;  2BKC A;  1TJO A;  1RCC A;  2VXX A;  3Q4Q A;  4AM2 A;  4ZLW A;  2FG8 A;  5AXS A;  2N02 A;  3RE7 A;  2C2U A;  5ERK A;  3ERZ A;  5JKM G;  1FHA A;  1B71 A;  3KX9 A;  2WLU A;  4MJY A;  5FFD A;  4MUD A;  2G38 B;  5GN8 B;  3E1J A;  4KVQ A;  2BW1 A;  2CHI A;  3BVL A;  2JD8 0;  3F32 A;  1QGH A;  3R2S A;  3QVD A;  3F36 A;  3BT5 A;  1VEI A;  2JD6 0;  5J8S A;  2YW7 A;  2V8T A;  1Z6O M;  5E2D A;  2BJY A;  3RAV A;  2Z6M A;  1H96 A;  4CVP A;  3T9J A;  2OC5 A;  2V2I A;  5J8W A;  1F30 A;  4ZTT A;  2UX1 A;  2V2L A;  4XKU A;  5JDO A;  4ZKX A;  3PWF A;  3E1L A;  2XKQ A;  5D8Q A;  2V2J A;  4YVZ A;  4TOG A;  4KVR A;  5J93 A;  3PVT B;  3O7R A;  5FFB A;  3FRR A;  5LG8 A;  3A9Q A;  4IWJ A;  1MFR A;  4LPM A;  4M34 A;  4PGK A;  2Y44 A;  3H7G A;  1VJX A;  1ZS3 A;  4DE6 A;  4PG1 A;  3EZU A;  3N6O A;  5FFE A;  3FVB A;  1JGC A;  2FL0 A;  5HU6 D;  5JKL G;  2IB0 A;  1S2Z A;  3DBY A;  5FFC A;  3PVT A;  3R2H A;  3AF8 X;  3SE1 A;  1RCE A;  3F35 A;  1SQ3 A;  3QHB A;  4RC8 A;  3KA3 A;  3JZA B;  2C41 A;  5IX6 A;  2QQY A;  3AK9 A;  5CMQ A;  2YJK A;  3BVI A;  5CZU A;  4AM4 A;  3EZ0 A;  2XJM A;  5D8O A;  4YXM A;  4KXR B;  2AR0 A;  1TK6 A;  5FFA A;  4TOC A;  2CWL A;  4TOD A;  3ISF A;  4ISM A;  4DYX A;  5HQO A;  1Z4A A;  4KVS A;  4PG0 A;  4TOH A;  4LYU A;  4M33 A;  4CYA A;  3GHQ A;  3FI6 A;  4TOA A;  2VXI A;  2V2O A;  2CLU A;  2C6R A;  1S3Q A;  3E1N A;  4LQV A;  1JIG A;  4RC7 B;  4ITW A;  3R2K A;  3U90 A;  2Z5R A;  1F33 A;  2GYQ A;  1VEQ A;  1IES A; 
#chains in the Genus database with same CATH homology
 2WLA A;  3GE4 A;  1GWG A;  3MPS A;  4RC6 B;  5I4J A;  4IXK A;  3RGD A;  1JRE A;  2X17 0;  3SHX A;  4EVE A;  4ZMC A;  5D8P A;  2XJO A;  3E1Q A;  4II4 B;  4RC7 A;  3F38 A;  3V3K B;  2V8U A;  3VNX A;  3AJO A;  1N1Q A;  2CN6 A;  5J9V A;  4TW3 A;  2V2P A;  3C23 A;  3PW1 A;  2D5K A;  3UOF A;  1RCG A;  4RC6 A;  4Z3B A;  3PW8 C;  1JKU A;  1JKV A;  2QF9 A;  4ZJK A;  1YUX A;  2YW6 A;  4II4 A;  3KA4 A;  2FFX J;  4ML5 A;  1JI4 A;  3GVY A;  4ERU A;  3WVU A;  3W54 A;  4CVS A;  5GN8 A;  1R03 A;  4MY7 A;  1DPS A;  1LB3 A;  2Z5P A;  4REU A;  3E6S A;  2CLB A;  2ZA6 A;  3BVF A;  2CN7 A;  1QYB A;  3EGM A;  5GU0 X;  3F33 A;  1VEL A;  3HIU A;  1RCI A;  4AM5 A;  3Q4R A;  2PYB A;  1NFV A;  2V2R A;  1BCF A;  2Z5Q A;  4TOB A;  3F37 A;  3KA8 A;  2FHA A;  3PWQ A;  3Q4O A;  5D8R A;  3FSE A;  3L0M A;  2HR5 A;  2V15 A;  2ZG9 X;  3KHK A;  2Y3Q A;  3PZA A;  1XZ1 A;  2C2J A;  4DZ0 A;  4Y08 A;  1NF4 A;  3F34 A;  1RYT A;  1UVH A;  3WNW A;  5D8Y A;  2V2N A;  3VVA A;  4W4L B;  5FEJ A;  1L8I A;  3AJP A;  2RBD A;  1XZ3 A;  5HJH A;  3AK8 A;  1YV1 A;  3IS8 A;  3BVK A;  3KA6 A;  4E40 A;  3E2C A;  2WTL A;  2ZA7 A;  3NP0 X;  4QUW A;  2JD7 0;  1NF6 A;  1YUZ A;  4LQN A;  1AEW A;  2IY4 A;  3PWQ C;  5HJF A;  5JKL A;  1JYB A;  1JI5 A;  5E1U A;  4U3G A;  3QHC A;  3M6J A;  3R2L A;  1Z6O A;  1JTS A;  3AF7 X;  4MN9 A;  4ETR A;  3C1Y A;  3RD0 A;  5D8X A;  1MOJ A;  3FRS A;  4LPN A;  4R42 A;  3AF9 X;  3Q4N A;  3SH6 A;  4CMY A;  3LKD A;  2OH3 A;  4RC5 B;  4M35 A;  4DYZ A;  1L8H A;  4ZL6 A;  3OGH A;  1O9I A;  3R2O A;  2ZA8 A;  3AJQ A;  2W0O A;  2BK6 A;  1LKM A;  5C6F A;  3RBC A;  4LYX A;  1LKO A;  3E1M A;  3OJ5 A;  5GOU A;  4WJG 4;  4YKH A;  4ZKH A;  4MXP A;  4DYY A;  4MKU A;  4RC5 A;  3HL1 A;  2C2F A;  4LQH A;  2FJC A;  4EVD A;  1OTK A;  3BKN A;  1EUM A;  3IS7 A;  3UFB A;  5LG2 A;  4CMY V;  3C1Z A;  4E6K A;  3WVW A;  3D19 A;  2XJN A;  2CF7 A;  2F7N A;  3F39 A;  2Z90 A;  4ZKW A;  4DAS A;  3PVR B;  3ES3 A;  4TOF A;  3QB9 A;  4OYN A;  4PGI A;  4XGS A;  5JKM A;  3C21 A;  3PVY B;  5CMR A;  5JDO B;  2CIH A;  1RCD A;  3QD8 A;  3E6R A;  4YXJ A;  1NNQ A;  3JZ9 A;  3KXU A;  2V2M A;  2IU2 A;  1DAT A;  2FG4 A;  4ISP A;  3GGZ A;  4DYU A;  3KDQ A;  5JAC A;  3R2R A;  1HRS A;  3PVR A;  4A25 A;  3KWO A;  1IER A;  2OKC A;  5K53 A;  3IQ1 A;  1O9R A;  1ZUJ A;  1VLG A;  3PVY A;  4CVR A;  4X0J A;  3WVV A;  4DI0 A;  4ZL5 A;  4LPJ A;  2XGW A;  3VV9 A;  2YJJ A;  2V2S A;  1J30 A;  4CVT A;  5GU1 X;  3GGY A;  5LS9 A;  2HTN A;  3E1P A;  2WWX B;  2ITB A;  5K52 A;  5ERJ A;  2VZB A;  1S30 A;  2GS4 A;  4CYB A;  4Z5S A;  5GU2 X;  2CHP A;  2G4H A;  1BFR A;  5GU3 X;  3UOI A;  3TA8 A;  3KA9 A;  4TO9 A;  3NOZ X;  4LQJ A;  4EVB A;  2ZG8 X;  3BVE A;  4M32 A;  2ZG7 X;  4EVC A;  4TOE A;  3A68 A;  4P18 A;  3ISE A;  3QZ3 A;  4W4K B;  2FZF A;  1UMN A;  5D8S A;  3SID A;  1SOF A;  3PW8 A;  4CY9 A;  3NP2 X;  3R2M A;  4XKS A;  5LBH A;  1BG7 A;  2GYD A;  2ZUR X;  3O7S A;  1LKP A;  1KRQ A;  1DVB A;  3E1O A;  4ITT A;  4XKT A;  2MGY A;  1TKO A;  2FKZ A;  1TKP A;  2CEI A;  3UNO A;  3PW1 B;  4IWK A;  2BKC A;  1TJO A;  1RCC A;  2VXX A;  3Q4Q A;  4AM2 A;  4ZLW A;  2FG8 A;  5AXS A;  2N02 A;  3RE7 A;  2C2U A;  5ERK A;  3ERZ A;  5JKM G;  1FHA A;  1B71 A;  3KX9 A;  2WLU A;  4MJY A;  5FFD A;  4MUD A;  2G38 B;  5GN8 B;  3E1J A;  4KVQ A;  2BW1 A;  2CHI A;  3BVL A;  2JD8 0;  3F32 A;  1QGH A;  3R2S A;  3QVD A;  3F36 A;  3BT5 A;  1VEI A;  2JD6 0;  5J8S A;  2YW7 A;  2V8T A;  1Z6O M;  5E2D A;  2BJY A;  3RAV A;  2Z6M A;  1H96 A;  4CVP A;  3T9J A;  2OC5 A;  2V2I A;  5J8W A;  1F30 A;  4ZTT A;  2UX1 A;  2V2L A;  4XKU A;  5JDO A;  4ZKX A;  3PWF A;  3E1L A;  2XKQ A;  5D8Q A;  2V2J A;  4YVZ A;  4TOG A;  4KVR A;  5J93 A;  3PVT B;  3O7R A;  5FFB A;  3FRR A;  5LG8 A;  3A9Q A;  4IWJ A;  1MFR A;  4LPM A;  4M34 A;  4PGK A;  2Y44 A;  3H7G A;  1VJX A;  1ZS3 A;  4DE6 A;  4PG1 A;  3EZU A;  3N6O A;  5FFE A;  3FVB A;  1JGC A;  2FL0 A;  5HU6 D;  5JKL G;  2IB0 A;  1S2Z A;  3DBY A;  5FFC A;  3PVT A;  3R2H A;  3AF8 X;  3SE1 A;  1RCE A;  3F35 A;  1SQ3 A;  3QHB A;  4RC8 A;  3KA3 A;  3JZA B;  2C41 A;  5IX6 A;  2QQY A;  3AK9 A;  5CMQ A;  2YJK A;  3BVI A;  5CZU A;  4AM4 A;  3EZ0 A;  2XJM A;  5D8O A;  4YXM A;  4KXR B;  2AR0 A;  1TK6 A;  5FFA A;  4TOC A;  2CWL A;  4TOD A;  3ISF A;  4ISM A;  4DYX A;  5HQO A;  1Z4A A;  4KVS A;  4PG0 A;  4TOH A;  4LYU A;  4M33 A;  4CYA A;  3GHQ A;  3FI6 A;  4TOA A;  2VXI A;  2V2O A;  2CLU A;  2C6R A;  1S3Q A;  3E1N A;  4LQV A;  1JIG A;  4RC7 B;  4ITW A;  3R2K A;  3U90 A;  2Z5R A;  1F33 A;  2GYQ A;  1VEQ A;  1IES A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...