2XKQA

Crystal structure of streptococcus suis dpr with manganese
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
151
structure length
151
Chain Sequence
LADSKAVLNQAVADLSVAHSILHQVHWYMRGRGFMIWHPKMDEYMEEIDGYLDEMSERLITLGGAPFSTLKEFSENSQLKEVLGDYNVTIEEQLARVVEVFRYLAALFQKGFDVSDEEGDSVTNDIFNVAKASIEKHIWMLQAELGQAPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DNA PROTECTION DURING STARVATION PROTEIN
publication title Structural and Thermodynamic Characterization of Metal Ion Binding in Streptococcus Suis Dpr.
pubmed doi rcsb
source organism Streptococcus suis
total genus 64
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.16.-.-:
pdb deposition date 2010-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2xkqA00
2YW7A 4PGIA 4TOGA 3FI6A 3PW8A 4CVSA 3R2KA 5CZUA 5D8SA 4M34A 2X170 5I4JA 3IQ1A 4YKHA 2CLUA 4LQVA 1RCDA 3SHXA 3E6RA 3RGDA 3ERZA 1NFVA 3ISFA 3QHBA 3WVWA 1Z6OM 3AJOA 4M33A 2PYBA 2V2IA 3E1QA 1J30A 3BVFA 1IERA 3E1PA 2GS4A 5K53A 5HQOA 4ZTTA 3RAVA 1AEWA 4DYYA 1JI5A 3A9QA 5LBHA 4Z5SA 3WVVA 1NNQA 3T9JA 4P18A 1TKPA 3F39A 2V15A 3PVTA 3E1LA 2D5KA 5D8YA 2C6RA 3FSEA 4MN9A 3TA8A 4OYNA 4RC5B 2QF9A 1LB3A 3PVYB 2VZBA 1BG7A 5ERJA 4DZ0A 3GHQA 1S2ZA 3H7GA 1B71A 5JKMG 4TOBA 5D8OA 1O9RA 2XJMA 3RE7A 1XZ3A 2V2NA 1H96A 2GYQA 2JD80 3QZ3A 2V2OA 1VELA 3PWFA 4U3GA 4A25A 4RC7B 5CMRA 4XKSA 4Z3BA 3QD8A 4LYXA 5K52A 2CEIA 4DYZA 4CYBA 4RC6A 3R2RA 4ZKXA 4DYXA 4CMYA 2IB0A 4LPJA 2OH3A 2YW6A 4CY9A 3QVDA 3Q4NA 5J8WA 2W0OA 2FFXJ 2JD70 5GU3X 2QQYA 4ML5A 1N1QA 3PW1A 1F33A 1MFRA 2FG8A 3Q4RA 2HR5A 3E1MA 3AJPA 3RBCA 2FG4A 2IU2A 4LQJA 3KA9A 4AM2A 5J8SA 2Z6MA 5JKMA 1NF4A 4DE6A 3O7SA 2BK6A 3PVRA 4AM4A 2WLUA 2CN7A 1JKVA 1DPSA 5HJHA 1YV1A 5FFBA 5FEJA 1XZ1A 4CMYV 2VXIA 1JYBA 4ITTA 3GE4A 2XGWA 3E1OA 4PG0A 2F7NA 5FFDA 3EZUA 2ZG8X 4II4B 3NP0X 5D8PA 5E1UA 1RCGA 2ZURX 2V2PA 4ZJKA 3KA8A 5C6FA 2CLBA 2CF7A 3E1NA 4RC6B 5GU1X 3PW8C 2GYDA 2Z5QA 4KVQA 5FFAA 2ZA7A 3IS8A 1LKMA 2WTLA 2IY4A 2V2LA 3MPSA 1O9IA 1BFRA 1RCCA 4MJYA 2CN6A 3Q4QA 2YJJA 3F35A 3PW1B 3UOFA 1YUZA 2ZG7X 3R2LA 1L8HA 2Y3QA 2FJCA 3AK8A 5CMQA 1SQ3A 3OJ5A 2BW1A 2V2RA 2G4HA 2OC5A 3SE1A 3BVEA 1EUMA 4ZLWA 2Z90A 2HTNA 4II4A 1OTKA 3RD0A 1JREA 3PVRB 4M32A 1HRSA 4CVRA 4ZL5A 4ISMA 3R2SA 4TW3A 5GN8A 1RYTA 3R2HA 2YJKA 1VEQA 5LG8A 3IS7A 1YUXA 2UX1A 4Y08A 1JKUA 2Z5RA 5D8XA 3F34A 4ZMCA 2RBDA 1RCIA 4XKUA 4KVSA 5AXSA 5JACA 4REUA 4ZKWA 2FZFA 5LG2A 1R03A 3ES3A 1S3QA 5JKLG 3F32A 2C41A 3R2OA 1FHAA 2ZA8A 3UNOA 3BVIA 4TOEA 3A68A 3WVUA 4XGSA 4TOAA 3F33A 4E6KA 4LYUA 2FL0A 1IESA 3HIUA 5HJFA 5E2DA 4DASA 4MUDA 1JI4A 4MKUA 2C2FA 2CHPA 3E1JA 1ZUJA 1DATA 4DI0A 3AJQA 3PWQC 3GVYA 1GWGA 3KWOA 4ZKHA 4ERUA 1UMNA 5FFCA 1UVHA 2FKZA 3F38A 2C2UA 3UOIA 4RC8A 3E2CA 3FVBA 1BCFA 2WLAA 3SH6A 1JTSA 4LPMA 1KRQA 5GN8B 3U90A 5JKLA 3BVLA 2XKQA 3O7RA 2CIHA 2V2JA 4TOCA 4ITWA 3KA3A 2C2JA 4QUWA 2ZA6A 4IXKA 1MOJA 4TO9A 1Z4AA 5GOUA 2ZG9X 5J9VA 1VEIA 1TJOA 3BVKA 4EVCA 2JD60 4IWKA 2V2SA 1Z6OA 4TOHA 5GU2X 3E6SA 2XJOA 5D8QA 5IX6A 3QB9A 3AK9A 1QYBA 4LQNA 4LPNA 4EVBA 3R2MA 3OGHA 1L8IA 3VNXA 2BJYA 3BT5A 2BKCA 5D8RA 4MY7A 3BKNA 1ZS3A 3EGMA 4IWJA 1LKOA 4LQHA 5GU0X 2ITBA 1RCEA 1TKOA 4PGKA 4ZL6A 1JGCA 2Z5PA 4TOFA 1JIGA 3NP2X 3F37A 2XJNA 3WNWA 4DYUA 3SIDA 1NF6A 1QGHA 1SOFA 4KVRA 4CVTA 3NOZX 1F30A 5LS9A 1LKPA 4R42A 5FFEA 3HL1A 4RC5A 2VXXA 3F36A 4EVEA 1VLGA 3PVYA 3AF7X 1DVBA 2FHAA 4ISPA 1S30A 1VJXA 3PZAA 3PWQA 3Q4OA 4ETRA 4M35A 5J93A 4PG1A 4CYAA 1TK6A 3KXUA 3PVTB 4XKTA 3EZ0A 3AF8X 4RC7A 2CHIA 4CVPA 2V2MA 4EVDA 3ISEA 3KX9A 5ERKA 4AM5A 3KA6A 4TODA 3AF9X 3QHCA 3KA4A
chains in the Genus database with same CATH superfamily
2YW7A 4PGIA 4TOGA 3FI6A 3PW8A 4CVSA 3R2KA 5CZUA 5D8SA 4M34A 2X170 5I4JA 3IQ1A 4YKHA 2CLUA 4LQVA 1RCDA 4WJG4 3SHXA 3E6RA 3RGDA 3ERZA 1NFVA 3ISFA 3QHBA 3WVWA 1Z6OM 3AJOA 4M33A 2PYBA 2V2IA 3E1QA 1J30A 3BVFA 1IERA 3E1PA 2GS4A 5K53A 5HQOA 4ZTTA 3RAVA 1AEWA 4DYYA 1JI5A 3A9QA 5LBHA 4Z5SA 4X0JA 3WVVA 1NNQA 3T9JA 4P18A 1TKPA 3F39A 2V15A 3PVTA 3E1LA 2D5KA 2OKCA 5D8YA 2C6RA 3FSEA 4MN9A 3TA8A 4OYNA 5JDOB 4RC5B 2QF9A 1LB3A 3PVYB 2VZBA 1BG7A 5ERJA 4DZ0A 3GHQA 3DBYA 1S2ZA 3H7GA 1B71A 5JKMG 3C21A 4TOBA 5D8OA 1O9RA 2XJMA 3RE7A 1XZ3A 2V2NA 1H96A 2GYQA 2JD80 3QZ3A 2V2OA 1VELA 3PWFA 4U3GA 4W4LB 4A25A 4RC7B 5CMRA 4XKSA 4Z3BA 3QD8A 4LYXA 5K52A 2N02A 2CEIA 3VVAA 4DYZA 4CYBA 4RC6A 3R2RA 4ZKXA 4DYXA 4CMYA 2IB0A 4LPJA 4KXRB 3KDQA 2OH3A 2YW6A 4CY9A 3QVDA 3Q4NA 5J8WA 2W0OA 2FFXJ 2JD70 5GU3X 2QQYA 4ML5A 1N1QA 3PW1A 1F33A 1MFRA 2FG8A 3Q4RA 3GGYA 2HR5A 3E1MA 3AJPA 3RBCA 2FG4A 2IU2A 4LQJA 3KA9A 4AM2A 5J8SA 3W54A 2Z6MA 5JKMA 1NF4A 4DE6A 3O7SA 2BK6A 3PVRA 4AM4A 2WLUA 2CN7A 1JKVA 1DPSA 5HJHA 1YV1A 5FFBA 2Y44A 5FEJA 1XZ1A 4CMYV 2VXIA 1JYBA 4ITTA 3GE4A 2XGWA 3E1OA 4PG0A 2F7NA 2AR0A 5FFDA 3EZUA 2ZG8X 4II4B 3NP0X 5D8PA 5E1UA 1RCGA 2ZURX 2V2PA 4ZJKA 3KA8A 5C6FA 2CLBA 2CF7A 3E1NA 4RC6B 3FRRA 5GU1X 3PW8C 3KHKA 2GYDA 3JZAB 2Z5QA 4KVQA 5FFAA 2ZA7A 3IS8A 1LKMA 3L0MA 2WTLA 2IY4A 2V2LA 3MPSA 1O9IA 1BFRA 1RCCA 4MJYA 2CN6A 3Q4QA 2YJJA 3F35A 3PW1B 3UOFA 2MGYA 1YUZA 2ZG7X 3R2LA 1L8HA 2Y3QA 3D19A 2FJCA 3AK8A 2V8UA 5CMQA 1SQ3A 2CWLA 3OJ5A 2BW1A 2V2RA 2G4HA 2OC5A 3SE1A 3BVEA 1EUMA 4ZLWA 2Z90A 2HTNA 4II4A 1OTKA 5HU6D 3AF9X 3RD0A 1JREA 3PVRB 4M32A 1HRSA 4CVRA 4ZL5A 4ISMA 3C1ZA 3R2SA 4TW3A 4E40A 5GN8A 1RYTA 3R2HA 2YJKA 1VEQA 5LG8A 3IS7A 1YUXA 2UX1A 4Y08A 1JKUA 2Z5RA 5D8XA 3F34A 4ZMCA 2RBDA 2V8TA 1RCIA 4XKUA 4KVSA 5AXSA 5JACA 4REUA 4ZKWA 2FZFA 5LG2A 1R03A 3ES3A 1S3QA 5JKLG 3F32A 2C41A 3R2OA 1FHAA 2ZA8A 3UNOA 2G38B 3BVIA 4TOEA 3A68A 3WVUA 4XGSA 4TOAA 3F33A 4E6KA 4LYUA 2FL0A 1IESA 4YXMA 3HIUA 3V3KB 5HJFA 5E2DA 4DASA 4MUDA 1JI4A 3M6JA 4MKUA 2C2FA 2CHPA 3E1JA 1ZUJA 1DATA 4DI0A 3AJQA 3PWQC 3GVYA 1GWGA 3JZ9A 3KWOA 4ZKHA 4ERUA 1UMNA 5FFCA 1UVHA 2FKZA 3F38A 2C2UA 3UFBA 3UOIA 4RC8A 3E2CA 3FVBA 1BCFA 2WLAA 3SH6A 1JTSA 4LPMA 1KRQA 5GN8B 3U90A 5JKLA 3BVLA 2XKQA 3O7RA 2CIHA 2V2JA 4TOCA 4ITWA 4YXJA 3KA3A 2C2JA 3LKDA 4QUWA 3FRSA 2ZA6A 4IXKA 4YVZA 1MOJA 4TO9A 4W4KB 1Z4AA 5GOUA 2ZG9X 5J9VA 1VEIA 1TJOA 3BVKA 4EVCA 2JD60 4IWKA 2V2SA 1Z6OA 4TOHA 5GU2X 3E6SA 2XJOA 5D8QA 5IX6A 3QB9A 3AK9A 1QYBA 3C1YA 4LQNA 4LPNA 4EVBA 3R2MA 3OGHA 1L8IA 3VNXA 2BJYA 3BT5A 2BKCA 5D8RA 3N6OA 4MY7A 3BKNA 1ZS3A 3EGMA 4IWJA 1LKOA 4LQHA 5GU0X 2ITBA 1RCEA 1TKOA 4PGKA 2WWXB 1JGCA 2Z5PA 4ZL6A 4TOFA 1JIGA 3NP2X 3F37A 2XJNA 3WNWA 4DYUA 3SIDA 1NF6A 1QGHA 1SOFA 4KVRA 4CVTA 3NOZX 1F30A 4MXPA 5LS9A 1LKPA 4R42A 5FFEA 3C23A 5JDOA 3HL1A 4RC5A 2VXXA 3F36A 4EVEA 1VLGA 3PVYA 3AF7X 3VV9A 1DVBA 2FHAA 4ISPA 1S30A 1VJXA 3PZAA 3PWQA 3Q4OA 4ETRA 4M35A 5J93A 4PG1A 4CYAA 1TK6A 3KXUA 3PVTB 4XKTA 3EZ0A 3AF8X 4RC7A 2CHIA 4CVPA 2V2MA 4EVDA 3ISEA 3KX9A 5ERKA 4AM5A 3KA6A 4TODA 3GGZA 3QHCA 3KA4A
chains in the Genus database with same CATH topology
2YW7A 4PGIA 4TOGA 3FI6A 3PW8A 4CVSA 3R2KA 5CZUA 5D8SA 4M34A 2X170 5I4JA 3IQ1A 4YKHA 2CLUA 4LQVA 1RCDA 4WJG4 3SHXA 3E6RA 3RGDA 3ERZA 1NFVA 3ISFA 3QHBA 3WVWA 1Z6OM 3AJOA 4M33A 2PYBA 2V2IA 3E1QA 1J30A 3BVFA 1IERA 3E1PA 2GS4A 5K53A 5HQOA 4ZTTA 3RAVA 1AEWA 4DYYA 1JI5A 3A9QA 5LBHA 4Z5SA 4X0JA 3WVVA 1NNQA 3T9JA 4P18A 1TKPA 3F39A 2V15A 3PVTA 3E1LA 2D5KA 2OKCA 5D8YA 2C6RA 3FSEA 4MN9A 3TA8A 4OYNA 5JDOB 4RC5B 2QF9A 1LB3A 3PVYB 2VZBA 1BG7A 5ERJA 4DZ0A 3GHQA 3DBYA 1S2ZA 3H7GA 1B71A 5JKMG 3C21A 4TOBA 5D8OA 1O9RA 2XJMA 3RE7A 1XZ3A 2V2NA 1H96A 2GYQA 2JD80 3QZ3A 2V2OA 1VELA 3PWFA 4U3GA 4W4LB 4A25A 4RC7B 5CMRA 4XKSA 4Z3BA 3QD8A 4LYXA 5K52A 2N02A 2CEIA 3VVAA 4DYZA 4CYBA 4RC6A 3R2RA 4ZKXA 4DYXA 4CMYA 2IB0A 4LPJA 4KXRB 3KDQA 2OH3A 2YW6A 4CY9A 3QVDA 3Q4NA 5J8WA 2W0OA 2FFXJ 2JD70 5GU3X 2QQYA 4ML5A 1N1QA 3PW1A 1F33A 1MFRA 2FG8A 3Q4RA 3GGYA 2HR5A 3E1MA 3AJPA 3RBCA 2FG4A 2IU2A 4LQJA 3KA9A 4AM2A 5J8SA 3W54A 2Z6MA 5JKMA 1NF4A 4DE6A 3O7SA 2BK6A 3PVRA 4AM4A 2WLUA 2CN7A 1JKVA 1DPSA 5HJHA 1YV1A 5FFBA 2Y44A 5FEJA 1XZ1A 4CMYV 2VXIA 1JYBA 4ITTA 3GE4A 2XGWA 3E1OA 4PG0A 2F7NA 2AR0A 5FFDA 3EZUA 2ZG8X 4II4B 3NP0X 5D8PA 5E1UA 1RCGA 2ZURX 2V2PA 4ZJKA 3KA8A 5C6FA 2CLBA 2CF7A 3E1NA 4RC6B 3FRRA 5GU1X 3PW8C 3KHKA 2GYDA 3JZAB 2Z5QA 4KVQA 5FFAA 2ZA7A 3IS8A 1LKMA 3L0MA 2WTLA 2IY4A 2V2LA 3MPSA 1O9IA 1BFRA 1RCCA 4MJYA 2CN6A 3Q4QA 2YJJA 3F35A 3PW1B 3UOFA 2MGYA 1YUZA 2ZG7X 3R2LA 1L8HA 2Y3QA 3D19A 2FJCA 3AK8A 2V8UA 5CMQA 1SQ3A 2CWLA 3OJ5A 2BW1A 2V2RA 2G4HA 2OC5A 3SE1A 3BVEA 1EUMA 4ZLWA 2Z90A 2HTNA 4II4A 1OTKA 5HU6D 3AF9X 3RD0A 1JREA 3PVRB 4M32A 1HRSA 4CVRA 4ZL5A 4ISMA 3C1ZA 3R2SA 4TW3A 4E40A 5GN8A 1RYTA 3R2HA 2YJKA 1VEQA 5LG8A 3IS7A 1YUXA 2UX1A 4Y08A 1JKUA 2Z5RA 5D8XA 3F34A 4ZMCA 2RBDA 2V8TA 1RCIA 4XKUA 4KVSA 5AXSA 5JACA 4REUA 4ZKWA 2FZFA 5LG2A 1R03A 3ES3A 1S3QA 5JKLG 3F32A 2C41A 3R2OA 1FHAA 2ZA8A 3UNOA 2G38B 3BVIA 4TOEA 3A68A 3WVUA 4XGSA 4TOAA 3F33A 4E6KA 4LYUA 2FL0A 1IESA 4YXMA 3HIUA 3V3KB 5HJFA 5E2DA 4DASA 4MUDA 1JI4A 3M6JA 4MKUA 2C2FA 2CHPA 3E1JA 1ZUJA 1DATA 4DI0A 3AJQA 3PWQC 3GVYA 1GWGA 3JZ9A 3KWOA 4ZKHA 4ERUA 1UMNA 5FFCA 1UVHA 2FKZA 3F38A 2C2UA 3UFBA 3UOIA 4RC8A 3E2CA 3FVBA 1BCFA 2WLAA 3SH6A 1JTSA 4LPMA 1KRQA 5GN8B 3U90A 5JKLA 3BVLA 2XKQA 3O7RA 2CIHA 2V2JA 4TOCA 4ITWA 4YXJA 3KA3A 2C2JA 3LKDA 4QUWA 3FRSA 2ZA6A 4IXKA 4YVZA 1MOJA 4TO9A 4W4KB 1Z4AA 5GOUA 2ZG9X 5J9VA 1VEIA 1TJOA 3BVKA 4EVCA 2JD60 4IWKA 2V2SA 1Z6OA 4TOHA 5GU2X 3E6SA 2XJOA 5D8QA 5IX6A 3QB9A 3AK9A 1QYBA 3C1YA 4LQNA 4LPNA 4EVBA 3R2MA 3OGHA 1L8IA 3VNXA 2BJYA 3BT5A 2BKCA 5D8RA 3N6OA 4MY7A 3BKNA 1ZS3A 3EGMA 4IWJA 1LKOA 4LQHA 5GU0X 2ITBA 1RCEA 1TKOA 4PGKA 2WWXB 1JGCA 2Z5PA 4ZL6A 4TOFA 1JIGA 3NP2X 3F37A 2XJNA 3WNWA 4DYUA 3SIDA 1NF6A 1QGHA 1SOFA 4KVRA 4CVTA 3NOZX 1F30A 4MXPA 5LS9A 1LKPA 4R42A 5FFEA 3C23A 5JDOA 3HL1A 4RC5A 2VXXA 3F36A 4EVEA 1VLGA 3PVYA 3AF7X 3VV9A 1DVBA 2FHAA 4ISPA 1S30A 1VJXA 3PZAA 3PWQA 3Q4OA 4ETRA 4M35A 5J93A 4PG1A 4CYAA 1TK6A 3KXUA 3PVTB 4XKTA 3EZ0A 3AF8X 4RC7A 2CHIA 4CVPA 2V2MA 4EVDA 3ISEA 3KX9A 5ERKA 4AM5A 3KA6A 4TODA 3GGZA 3QHCA 3KA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YW7 A;  4PGI A;  4TOG A;  3FI6 A;  3PW8 A;  4CVS A;  3R2K A;  5CZU A;  5D8S A;  4M34 A;  2X17 0;  5I4J A;  3IQ1 A;  4YKH A;  2CLU A;  4LQV A;  1RCD A;  3SHX A;  3E6R A;  3RGD A;  3ERZ A;  1NFV A;  3ISF A;  3QHB A;  3WVW A;  1Z6O M;  3AJO A;  4M33 A;  2PYB A;  2V2I A;  3E1Q A;  1J30 A;  3BVF A;  1IER A;  3E1P A;  2GS4 A;  5K53 A;  5HQO A;  4ZTT A;  3RAV A;  1AEW A;  4DYY A;  1JI5 A;  3A9Q A;  5LBH A;  4Z5S A;  3WVV A;  1NNQ A;  3T9J A;  4P18 A;  1TKP A;  3F39 A;  2V15 A;  3PVT A;  3E1L A;  2D5K A;  5D8Y A;  2C6R A;  3FSE A;  4MN9 A;  3TA8 A;  4OYN A;  4RC5 B;  2QF9 A;  1LB3 A;  3PVY B;  2VZB A;  1BG7 A;  5ERJ A;  4DZ0 A;  3GHQ A;  1S2Z A;  3H7G A;  1B71 A;  5JKM G;  4TOB A;  5D8O A;  1O9R A;  2XJM A;  3RE7 A;  1XZ3 A;  2V2N A;  1H96 A;  2GYQ A;  2JD8 0;  3QZ3 A;  2V2O A;  1VEL A;  3PWF A;  4U3G A;  4A25 A;  4RC7 B;  5CMR A;  4XKS A;  4Z3B A;  3QD8 A;  4LYX A;  5K52 A;  2CEI A;  4DYZ A;  4CYB A;  4RC6 A;  3R2R A;  4ZKX A;  4DYX A;  4CMY A;  2IB0 A;  4LPJ A;  2OH3 A;  2YW6 A;  4CY9 A;  3QVD A;  3Q4N A;  5J8W A;  2W0O A;  2FFX J;  2JD7 0;  5GU3 X;  2QQY A;  4ML5 A;  1N1Q A;  3PW1 A;  1F33 A;  1MFR A;  2FG8 A;  3Q4R A;  2HR5 A;  3E1M A;  3AJP A;  3RBC A;  2FG4 A;  2IU2 A;  4LQJ A;  3KA9 A;  4AM2 A;  5J8S A;  2Z6M A;  5JKM A;  1NF4 A;  4DE6 A;  3O7S A;  2BK6 A;  3PVR A;  4AM4 A;  2WLU A;  2CN7 A;  1JKV A;  1DPS A;  5HJH A;  1YV1 A;  5FFB A;  5FEJ A;  1XZ1 A;  4CMY V;  2VXI A;  1JYB A;  4ITT A;  3GE4 A;  2XGW A;  3E1O A;  4PG0 A;  2F7N A;  5FFD A;  3EZU A;  2ZG8 X;  4II4 B;  3NP0 X;  5D8P A;  5E1U A;  1RCG A;  2ZUR X;  2V2P A;  4ZJK A;  3KA8 A;  5C6F A;  2CLB A;  2CF7 A;  3E1N A;  4RC6 B;  5GU1 X;  3PW8 C;  2GYD A;  2Z5Q A;  4KVQ A;  5FFA A;  2ZA7 A;  3IS8 A;  1LKM A;  2WTL A;  2IY4 A;  2V2L A;  3MPS A;  1O9I A;  1BFR A;  1RCC A;  4MJY A;  2CN6 A;  3Q4Q A;  2YJJ A;  3F35 A;  3PW1 B;  3UOF A;  1YUZ A;  2ZG7 X;  3R2L A;  1L8H A;  2Y3Q A;  2FJC A;  3AK8 A;  5CMQ A;  1SQ3 A;  3OJ5 A;  2BW1 A;  2V2R A;  2G4H A;  2OC5 A;  3SE1 A;  3BVE A;  1EUM A;  4ZLW A;  2Z90 A;  2HTN A;  4II4 A;  1OTK A;  3RD0 A;  1JRE A;  3PVR B;  4M32 A;  1HRS A;  4CVR A;  4ZL5 A;  4ISM A;  3R2S A;  4TW3 A;  5GN8 A;  1RYT A;  3R2H A;  2YJK A;  1VEQ A;  5LG8 A;  3IS7 A;  1YUX A;  2UX1 A;  4Y08 A;  1JKU A;  2Z5R A;  5D8X A;  3F34 A;  4ZMC A;  2RBD A;  1RCI A;  4XKU A;  4KVS A;  5AXS A;  5JAC A;  4REU A;  4ZKW A;  2FZF A;  5LG2 A;  1R03 A;  3ES3 A;  1S3Q A;  5JKL G;  3F32 A;  2C41 A;  3R2O A;  1FHA A;  2ZA8 A;  3UNO A;  3BVI A;  4TOE A;  3A68 A;  3WVU A;  4XGS A;  4TOA A;  3F33 A;  4E6K A;  4LYU A;  2FL0 A;  1IES A;  3HIU A;  5HJF A;  5E2D A;  4DAS A;  4MUD A;  1JI4 A;  4MKU A;  2C2F A;  2CHP A;  3E1J A;  1ZUJ A;  1DAT A;  4DI0 A;  3AJQ A;  3PWQ C;  3GVY A;  1GWG A;  3KWO A;  4ZKH A;  4ERU A;  1UMN A;  5FFC A;  1UVH A;  2FKZ A;  3F38 A;  2C2U A;  3UOI A;  4RC8 A;  3E2C A;  3FVB A;  1BCF A;  2WLA A;  3SH6 A;  1JTS A;  4LPM A;  1KRQ A;  5GN8 B;  3U90 A;  5JKL A;  3BVL A;  2XKQ A;  3O7R A;  2CIH A;  2V2J A;  4TOC A;  4ITW A;  3KA3 A;  2C2J A;  4QUW A;  2ZA6 A;  4IXK A;  1MOJ A;  4TO9 A;  1Z4A A;  5GOU A;  2ZG9 X;  5J9V A;  1VEI A;  1TJO A;  3BVK A;  4EVC A;  2JD6 0;  4IWK A;  2V2S A;  1Z6O A;  4TOH A;  5GU2 X;  3E6S A;  2XJO A;  5D8Q A;  5IX6 A;  3QB9 A;  3AK9 A;  1QYB A;  4LQN A;  4LPN A;  4EVB A;  3R2M A;  3OGH A;  1L8I A;  3VNX A;  2BJY A;  3BT5 A;  2BKC A;  5D8R A;  4MY7 A;  3BKN A;  1ZS3 A;  3EGM A;  4IWJ A;  1LKO A;  4LQH A;  5GU0 X;  2ITB A;  1RCE A;  1TKO A;  4PGK A;  4ZL6 A;  1JGC A;  2Z5P A;  4TOF A;  1JIG A;  3NP2 X;  3F37 A;  2XJN A;  3WNW A;  4DYU A;  3SID A;  1NF6 A;  1QGH A;  1SOF A;  4KVR A;  4CVT A;  3NOZ X;  1F30 A;  5LS9 A;  1LKP A;  4R42 A;  5FFE A;  3HL1 A;  4RC5 A;  2VXX A;  3F36 A;  4EVE A;  1VLG A;  3PVY A;  3AF7 X;  1DVB A;  2FHA A;  4ISP A;  1S30 A;  1VJX A;  3PZA A;  3PWQ A;  3Q4O A;  4ETR A;  4M35 A;  5J93 A;  4PG1 A;  4CYA A;  1TK6 A;  3KXU A;  3PVT B;  4XKT A;  3EZ0 A;  3AF8 X;  4RC7 A;  2CHI A;  4CVP A;  2V2M A;  4EVD A;  3ISE A;  3KX9 A;  5ERK A;  4AM5 A;  3KA6 A;  4TOD A;  3AF9 X;  3QHC A;  3KA4 A; 
#chains in the Genus database with same CATH topology
 2YW7 A;  4PGI A;  4TOG A;  3FI6 A;  3PW8 A;  4CVS A;  3R2K A;  5CZU A;  5D8S A;  4M34 A;  2X17 0;  5I4J A;  3IQ1 A;  4YKH A;  2CLU A;  4LQV A;  1RCD A;  4WJG 4;  3SHX A;  3E6R A;  3RGD A;  3ERZ A;  1NFV A;  3ISF A;  3QHB A;  3WVW A;  1Z6O M;  3AJO A;  4M33 A;  2PYB A;  2V2I A;  3E1Q A;  1J30 A;  3BVF A;  1IER A;  3E1P A;  2GS4 A;  5K53 A;  5HQO A;  4ZTT A;  3RAV A;  1AEW A;  4DYY A;  1JI5 A;  3A9Q A;  5LBH A;  4Z5S A;  4X0J A;  3WVV A;  1NNQ A;  3T9J A;  4P18 A;  1TKP A;  3F39 A;  2V15 A;  3PVT A;  3E1L A;  2D5K A;  2OKC A;  5D8Y A;  2C6R A;  3FSE A;  4MN9 A;  3TA8 A;  4OYN A;  5JDO B;  4RC5 B;  2QF9 A;  1LB3 A;  3PVY B;  2VZB A;  1BG7 A;  5ERJ A;  4DZ0 A;  3GHQ A;  3DBY A;  1S2Z A;  3H7G A;  1B71 A;  5JKM G;  3C21 A;  4TOB A;  5D8O A;  1O9R A;  2XJM A;  3RE7 A;  1XZ3 A;  2V2N A;  1H96 A;  2GYQ A;  2JD8 0;  3QZ3 A;  2V2O A;  1VEL A;  3PWF A;  4U3G A;  4W4L B;  4A25 A;  4RC7 B;  5CMR A;  4XKS A;  4Z3B A;  3QD8 A;  4LYX A;  5K52 A;  2N02 A;  2CEI A;  3VVA A;  4DYZ A;  4CYB A;  4RC6 A;  3R2R A;  4ZKX A;  4DYX A;  4CMY A;  2IB0 A;  4LPJ A;  4KXR B;  3KDQ A;  2OH3 A;  2YW6 A;  4CY9 A;  3QVD A;  3Q4N A;  5J8W A;  2W0O A;  2FFX J;  2JD7 0;  5GU3 X;  2QQY A;  4ML5 A;  1N1Q A;  3PW1 A;  1F33 A;  1MFR A;  2FG8 A;  3Q4R A;  3GGY A;  2HR5 A;  3E1M A;  3AJP A;  3RBC A;  2FG4 A;  2IU2 A;  4LQJ A;  3KA9 A;  4AM2 A;  5J8S A;  3W54 A;  2Z6M A;  5JKM A;  1NF4 A;  4DE6 A;  3O7S A;  2BK6 A;  3PVR A;  4AM4 A;  2WLU A;  2CN7 A;  1JKV A;  1DPS A;  5HJH A;  1YV1 A;  5FFB A;  2Y44 A;  5FEJ A;  1XZ1 A;  4CMY V;  2VXI A;  1JYB A;  4ITT A;  3GE4 A;  2XGW A;  3E1O A;  4PG0 A;  2F7N A;  2AR0 A;  5FFD A;  3EZU A;  2ZG8 X;  4II4 B;  3NP0 X;  5D8P A;  5E1U A;  1RCG A;  2ZUR X;  2V2P A;  4ZJK A;  3KA8 A;  5C6F A;  2CLB A;  2CF7 A;  3E1N A;  4RC6 B;  3FRR A;  5GU1 X;  3PW8 C;  3KHK A;  2GYD A;  3JZA B;  2Z5Q A;  4KVQ A;  5FFA A;  2ZA7 A;  3IS8 A;  1LKM A;  3L0M A;  2WTL A;  2IY4 A;  2V2L A;  3MPS A;  1O9I A;  1BFR A;  1RCC A;  4MJY A;  2CN6 A;  3Q4Q A;  2YJJ A;  3F35 A;  3PW1 B;  3UOF A;  2MGY A;  1YUZ A;  2ZG7 X;  3R2L A;  1L8H A;  2Y3Q A;  3D19 A;  2FJC A;  3AK8 A;  2V8U A;  5CMQ A;  1SQ3 A;  2CWL A;  3OJ5 A;  2BW1 A;  2V2R A;  2G4H A;  2OC5 A;  3SE1 A;  3BVE A;  1EUM A;  4ZLW A;  2Z90 A;  2HTN A;  4II4 A;  1OTK A;  5HU6 D;  3AF9 X;  3RD0 A;  1JRE A;  3PVR B;  4M32 A;  1HRS A;  4CVR A;  4ZL5 A;  4ISM A;  3C1Z A;  3R2S A;  4TW3 A;  4E40 A;  5GN8 A;  1RYT A;  3R2H A;  2YJK A;  1VEQ A;  5LG8 A;  3IS7 A;  1YUX A;  2UX1 A;  4Y08 A;  1JKU A;  2Z5R A;  5D8X A;  3F34 A;  4ZMC A;  2RBD A;  2V8T A;  1RCI A;  4XKU A;  4KVS A;  5AXS A;  5JAC A;  4REU A;  4ZKW A;  2FZF A;  5LG2 A;  1R03 A;  3ES3 A;  1S3Q A;  5JKL G;  3F32 A;  2C41 A;  3R2O A;  1FHA A;  2ZA8 A;  3UNO A;  2G38 B;  3BVI A;  4TOE A;  3A68 A;  3WVU A;  4XGS A;  4TOA A;  3F33 A;  4E6K A;  4LYU A;  2FL0 A;  1IES A;  4YXM A;  3HIU A;  3V3K B;  5HJF A;  5E2D A;  4DAS A;  4MUD A;  1JI4 A;  3M6J A;  4MKU A;  2C2F A;  2CHP A;  3E1J A;  1ZUJ A;  1DAT A;  4DI0 A;  3AJQ A;  3PWQ C;  3GVY A;  1GWG A;  3JZ9 A;  3KWO A;  4ZKH A;  4ERU A;  1UMN A;  5FFC A;  1UVH A;  2FKZ A;  3F38 A;  2C2U A;  3UFB A;  3UOI A;  4RC8 A;  3E2C A;  3FVB A;  1BCF A;  2WLA A;  3SH6 A;  1JTS A;  4LPM A;  1KRQ A;  5GN8 B;  3U90 A;  5JKL A;  3BVL A;  2XKQ A;  3O7R A;  2CIH A;  2V2J A;  4TOC A;  4ITW A;  4YXJ A;  3KA3 A;  2C2J A;  3LKD A;  4QUW A;  3FRS A;  2ZA6 A;  4IXK A;  4YVZ A;  1MOJ A;  4TO9 A;  4W4K B;  1Z4A A;  5GOU A;  2ZG9 X;  5J9V A;  1VEI A;  1TJO A;  3BVK A;  4EVC A;  2JD6 0;  4IWK A;  2V2S A;  1Z6O A;  4TOH A;  5GU2 X;  3E6S A;  2XJO A;  5D8Q A;  5IX6 A;  3QB9 A;  3AK9 A;  1QYB A;  3C1Y A;  4LQN A;  4LPN A;  4EVB A;  3R2M A;  3OGH A;  1L8I A;  3VNX A;  2BJY A;  3BT5 A;  2BKC A;  5D8R A;  3N6O A;  4MY7 A;  3BKN A;  1ZS3 A;  3EGM A;  4IWJ A;  1LKO A;  4LQH A;  5GU0 X;  2ITB A;  1RCE A;  1TKO A;  4PGK A;  2WWX B;  1JGC A;  2Z5P A;  4ZL6 A;  4TOF A;  1JIG A;  3NP2 X;  3F37 A;  2XJN A;  3WNW A;  4DYU A;  3SID A;  1NF6 A;  1QGH A;  1SOF A;  4KVR A;  4CVT A;  3NOZ X;  1F30 A;  4MXP A;  5LS9 A;  1LKP A;  4R42 A;  5FFE A;  3C23 A;  5JDO A;  3HL1 A;  4RC5 A;  2VXX A;  3F36 A;  4EVE A;  1VLG A;  3PVY A;  3AF7 X;  3VV9 A;  1DVB A;  2FHA A;  4ISP A;  1S30 A;  1VJX A;  3PZA A;  3PWQ A;  3Q4O A;  4ETR A;  4M35 A;  5J93 A;  4PG1 A;  4CYA A;  1TK6 A;  3KXU A;  3PVT B;  4XKT A;  3EZ0 A;  3AF8 X;  4RC7 A;  2CHI A;  4CVP A;  2V2M A;  4EVD A;  3ISE A;  3KX9 A;  5ERK A;  4AM5 A;  3KA6 A;  4TOD A;  3GGZ A;  3QHC A;  3KA4 A; 
#chains in the Genus database with same CATH homology
 2YW7 A;  4PGI A;  4TOG A;  3FI6 A;  3PW8 A;  4CVS A;  3R2K A;  5CZU A;  5D8S A;  4M34 A;  2X17 0;  5I4J A;  3IQ1 A;  4YKH A;  2CLU A;  4LQV A;  1RCD A;  4WJG 4;  3SHX A;  3E6R A;  3RGD A;  3ERZ A;  1NFV A;  3ISF A;  3QHB A;  3WVW A;  1Z6O M;  3AJO A;  4M33 A;  2PYB A;  2V2I A;  3E1Q A;  1J30 A;  3BVF A;  1IER A;  3E1P A;  2GS4 A;  5K53 A;  5HQO A;  4ZTT A;  3RAV A;  1AEW A;  4DYY A;  1JI5 A;  3A9Q A;  5LBH A;  4Z5S A;  4X0J A;  3WVV A;  1NNQ A;  3T9J A;  4P18 A;  1TKP A;  3F39 A;  2V15 A;  3PVT A;  3E1L A;  2D5K A;  2OKC A;  5D8Y A;  2C6R A;  3FSE A;  4MN9 A;  3TA8 A;  4OYN A;  5JDO B;  4RC5 B;  2QF9 A;  1LB3 A;  3PVY B;  2VZB A;  1BG7 A;  5ERJ A;  4DZ0 A;  3GHQ A;  3DBY A;  1S2Z A;  3H7G A;  1B71 A;  5JKM G;  3C21 A;  4TOB A;  5D8O A;  1O9R A;  2XJM A;  3RE7 A;  1XZ3 A;  2V2N A;  1H96 A;  2GYQ A;  2JD8 0;  3QZ3 A;  2V2O A;  1VEL A;  3PWF A;  4U3G A;  4W4L B;  4A25 A;  4RC7 B;  5CMR A;  4XKS A;  4Z3B A;  3QD8 A;  4LYX A;  5K52 A;  2N02 A;  2CEI A;  3VVA A;  4DYZ A;  4CYB A;  4RC6 A;  3R2R A;  4ZKX A;  4DYX A;  4CMY A;  2IB0 A;  4LPJ A;  4KXR B;  3KDQ A;  2OH3 A;  2YW6 A;  4CY9 A;  3QVD A;  3Q4N A;  5J8W A;  2W0O A;  2FFX J;  2JD7 0;  5GU3 X;  2QQY A;  4ML5 A;  1N1Q A;  3PW1 A;  1F33 A;  1MFR A;  2FG8 A;  3Q4R A;  3GGY A;  2HR5 A;  3E1M A;  3AJP A;  3RBC A;  2FG4 A;  2IU2 A;  4LQJ A;  3KA9 A;  4AM2 A;  5J8S A;  3W54 A;  2Z6M A;  5JKM A;  1NF4 A;  4DE6 A;  3O7S A;  2BK6 A;  3PVR A;  4AM4 A;  2WLU A;  2CN7 A;  1JKV A;  1DPS A;  5HJH A;  1YV1 A;  5FFB A;  2Y44 A;  5FEJ A;  1XZ1 A;  4CMY V;  2VXI A;  1JYB A;  4ITT A;  3GE4 A;  2XGW A;  3E1O A;  4PG0 A;  2F7N A;  2AR0 A;  5FFD A;  3EZU A;  2ZG8 X;  4II4 B;  3NP0 X;  5D8P A;  5E1U A;  1RCG A;  2ZUR X;  2V2P A;  4ZJK A;  3KA8 A;  5C6F A;  2CLB A;  2CF7 A;  3E1N A;  4RC6 B;  3FRR A;  5GU1 X;  3PW8 C;  3KHK A;  2GYD A;  3JZA B;  2Z5Q A;  4KVQ A;  5FFA A;  2ZA7 A;  3IS8 A;  1LKM A;  3L0M A;  2WTL A;  2IY4 A;  2V2L A;  3MPS A;  1O9I A;  1BFR A;  1RCC A;  4MJY A;  2CN6 A;  3Q4Q A;  2YJJ A;  3F35 A;  3PW1 B;  3UOF A;  2MGY A;  1YUZ A;  2ZG7 X;  3R2L A;  1L8H A;  2Y3Q A;  3D19 A;  2FJC A;  3AK8 A;  2V8U A;  5CMQ A;  1SQ3 A;  2CWL A;  3OJ5 A;  2BW1 A;  2V2R A;  2G4H A;  2OC5 A;  3SE1 A;  3BVE A;  1EUM A;  4ZLW A;  2Z90 A;  2HTN A;  4II4 A;  1OTK A;  5HU6 D;  3AF9 X;  3RD0 A;  1JRE A;  3PVR B;  4M32 A;  1HRS A;  4CVR A;  4ZL5 A;  4ISM A;  3C1Z A;  3R2S A;  4TW3 A;  4E40 A;  5GN8 A;  1RYT A;  3R2H A;  2YJK A;  1VEQ A;  5LG8 A;  3IS7 A;  1YUX A;  2UX1 A;  4Y08 A;  1JKU A;  2Z5R A;  5D8X A;  3F34 A;  4ZMC A;  2RBD A;  2V8T A;  1RCI A;  4XKU A;  4KVS A;  5AXS A;  5JAC A;  4REU A;  4ZKW A;  2FZF A;  5LG2 A;  1R03 A;  3ES3 A;  1S3Q A;  5JKL G;  3F32 A;  2C41 A;  3R2O A;  1FHA A;  2ZA8 A;  3UNO A;  2G38 B;  3BVI A;  4TOE A;  3A68 A;  3WVU A;  4XGS A;  4TOA A;  3F33 A;  4E6K A;  4LYU A;  2FL0 A;  1IES A;  4YXM A;  3HIU A;  3V3K B;  5HJF A;  5E2D A;  4DAS A;  4MUD A;  1JI4 A;  3M6J A;  4MKU A;  2C2F A;  2CHP A;  3E1J A;  1ZUJ A;  1DAT A;  4DI0 A;  3AJQ A;  3PWQ C;  3GVY A;  1GWG A;  3JZ9 A;  3KWO A;  4ZKH A;  4ERU A;  1UMN A;  5FFC A;  1UVH A;  2FKZ A;  3F38 A;  2C2U A;  3UFB A;  3UOI A;  4RC8 A;  3E2C A;  3FVB A;  1BCF A;  2WLA A;  3SH6 A;  1JTS A;  4LPM A;  1KRQ A;  5GN8 B;  3U90 A;  5JKL A;  3BVL A;  2XKQ A;  3O7R A;  2CIH A;  2V2J A;  4TOC A;  4ITW A;  4YXJ A;  3KA3 A;  2C2J A;  3LKD A;  4QUW A;  3FRS A;  2ZA6 A;  4IXK A;  4YVZ A;  1MOJ A;  4TO9 A;  4W4K B;  1Z4A A;  5GOU A;  2ZG9 X;  5J9V A;  1VEI A;  1TJO A;  3BVK A;  4EVC A;  2JD6 0;  4IWK A;  2V2S A;  1Z6O A;  4TOH A;  5GU2 X;  3E6S A;  2XJO A;  5D8Q A;  5IX6 A;  3QB9 A;  3AK9 A;  1QYB A;  3C1Y A;  4LQN A;  4LPN A;  4EVB A;  3R2M A;  3OGH A;  1L8I A;  3VNX A;  2BJY A;  3BT5 A;  2BKC A;  5D8R A;  3N6O A;  4MY7 A;  3BKN A;  1ZS3 A;  3EGM A;  4IWJ A;  1LKO A;  4LQH A;  5GU0 X;  2ITB A;  1RCE A;  1TKO A;  4PGK A;  2WWX B;  1JGC A;  2Z5P A;  4ZL6 A;  4TOF A;  1JIG A;  3NP2 X;  3F37 A;  2XJN A;  3WNW A;  4DYU A;  3SID A;  1NF6 A;  1QGH A;  1SOF A;  4KVR A;  4CVT A;  3NOZ X;  1F30 A;  4MXP A;  5LS9 A;  1LKP A;  4R42 A;  5FFE A;  3C23 A;  5JDO A;  3HL1 A;  4RC5 A;  2VXX A;  3F36 A;  4EVE A;  1VLG A;  3PVY A;  3AF7 X;  3VV9 A;  1DVB A;  2FHA A;  4ISP A;  1S30 A;  1VJX A;  3PZA A;  3PWQ A;  3Q4O A;  4ETR A;  4M35 A;  5J93 A;  4PG1 A;  4CYA A;  1TK6 A;  3KXU A;  3PVT B;  4XKT A;  3EZ0 A;  3AF8 X;  4RC7 A;  2CHI A;  4CVP A;  2V2M A;  4EVD A;  3ISE A;  3KX9 A;  5ERK A;  4AM5 A;  3KA6 A;  4TOD A;  3GGZ A;  3QHC A;  3KA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...