4ETRA

X-ray structure of pa2169 from pseudomonas aeruginosa
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
146
structure length
121
Chain Sequence
NLDDTLDVLNDLLQTSKDGEAGFHACAEDLRDPQLKAAMLEQSRDCAAAADELERIVLELGGKPEEAVLNECERGEDVAKHRYQAALEKSLPAEIHQVIERQYQGVLRHHDRVRALRDARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
publication title The AEROPATH project targeting Pseudomonas aeruginosa: crystallographic studies for assessment of potential targets in early-stage drug discovery.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 57
structure length 121
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09537 DUF2383 Domain of unknown function (DUF2383)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4etrA00
1RYTA 5D8XA 2XGWA 3FI6A 2C6RA 4LYUA 3AF9X 2XKQA 2FKZA 1JI5A 3QZ3A 5FFEA 1LB3A 4DYYA 3UOFA 3GVYA 2V2RA 1DATA 2VZBA 2CEIA 2CLUA 2Z5RA 1RCIA 1BG7A 2BJYA 3R2HA 5E1UA 5ERJA 3QB9A 5CMQA 4Z5SA 1VELA 4R42A 1MOJA 2V2SA 2OH3A 4ZKWA 2OC5A 3RBCA 3F32A 1TKPA 4M33A 2XJOA 4OYNA 4ETRA 5I4JA 3KXUA 1NF6A 2FHAA 5K52A 5J8WA 3SE1A 2WLAA 5D8PA 1JKVA 4TOCA 3F34A 1NNQA 4TODA 3UNOA 2Z90A 1JREA 5LG2A 3PVRA 4REUA 3PW8A 1VLGA 3PW1A 5IX6A 5LBHA 3EZUA 2JD70 3HIUA 5GN8A 2VXIA 1L8IA 3E1QA 1IERA 4TOFA 1DVBA 3R2SA 3NOZX 3HL1A 3PVRB 3PWFA 1TK6A 3PW1B 2GYQA 3FVBA 5LG8A 5HJFA 5K53A 3WNWA 5GN8B 1JI4A 4ZJKA 1J30A 2X170 1RCEA 4TOAA 1NF4A 3O7SA 4ZLWA 3R2LA 1UVHA 1XZ3A 3O7RA 4DI0A 2VXXA 4EVCA 4M35A 3VNXA 1H96A 4Y08A 2FZFA 1XZ1A 2CIHA 5CMRA 5C6FA 3UOIA 2CHPA 1EUMA 4A25A 5HJHA 2C2JA 2IB0A 2C2FA 5FFDA 5JKMA 4ZMCA 4KVQA 3PW8C 2XJNA 1YUZA 1VEIA 3AF7X 3PZAA 4RC6B 1QGHA 3Q4QA 4ZL6A 2ZG7X 4RC7A 3FSEA 1UMNA 3NP2X 1LKPA 4MN9A 3KX9A 3RE7A 3BT5A 5GU2X 3MPSA 3AF8X 2BW1A 3PVYA 4EVDA 5HQOA 2FJCA 3SIDA 1NFVA 4ISPA 3RGDA 1F33A 1JYBA 4IWJA 3EGMA 3PVTA 3KA6A 2ZURX 4ERUA 5J93A 2YW6A 3Q4NA 3F36A 2V2JA 4RC7B 4Z3BA 1VEQA 2V2LA 3QVDA 4CY9A 1ZS3A 1JKUA 3E6RA 4AM4A 1ZUJA 3ISFA 4LQJA 4RC5B 3PVYB 3KA8A 2V2MA 1SOFA 3E1PA 3QD8A 3WVUA 4CVTA 3PVTB 4TOEA 1O9IA 1RCDA 3AK9A 3E1JA 3R2RA 4DYZA 3E1LA 2CF7A 5D8SA 3PWQA 4ZTTA 3F38A 2HR5A 2YJKA 5D8OA 4XKSA 4E6KA 1O9RA 1HRSA 5JKMG 4LQHA 1FHAA 5D8YA 4PG1A 2HTNA 2F7NA 3QHBA 4CYAA 4EVBA 1JIGA 2FG8A 4PGKA 2V15A 4TOBA 1L8HA 1YUXA 4YKHA 3BVFA 4TO9A 2IY4A 4XGSA 3BVEA 5JKLA 3F33A 3ISEA 4IXKA 3GE4A 2V2PA 2W0OA 4ITWA 1RCCA 5FFCA 2ZA6A 3KA4A 3U90A 3BKNA 1N1QA 2ZG8X 4KVRA 3T9JA 5D8QA 4LPMA 1MFRA 2WLUA 4LYXA 5J8SA 5GU3X 4QUWA 3F37A 3IS8A 2ZG9X 3R2KA 4RC6A 4TW3A 3PWQC 2Y3QA 3GHQA 2Z5PA 4U3GA 3IQ1A 1JGCA 4AM5A 5GOUA 2G4HA 3H7GA 1BFRA 4MJYA 4P18A 5FFAA 3SH6A 3Q4RA 4XKUA 3KWOA 4ZKHA 3KA3A 4DE6A 2QF9A 4MKUA 3E1MA 3NP0X 3A9QA 4RC5A 2RBDA 3F39A 3SHXA 4XKTA 1JTSA 2CN7A 1GWGA 2WTLA 3E2CA 2ZA7A 4AM2A 1TKOA 4CVPA 3ES3A 5JKLG 2V2OA 4LQNA 4RC8A 2JD80 4ML5A 4DYXA 2Z6MA 1S3QA 1KRQA 5JACA 5AXSA 2UX1A 1BCFA 2YJJA 1QYBA 3E1NA 2FFXJ 4LQVA 4TOHA 4ISMA 2YW7A 2FG4A 4DYUA 4PGIA 1YV1A 1S30A 3AJOA 1IESA 3OJ5A 2PYBA 2BKCA 3BVIA 1LKMA 1B71A 1S2ZA 2QQYA 2FL0A 4II4A 5LS9A 4MUDA 2Z5QA 4LPJA 2IU2A 1OTKA 1F30A 4LPNA 3IS7A 4M34A 1DPSA 3QHCA 2CN6A 4KVSA 5E2DA 2V2IA 2GYDA 3BVKA 4TOGA 4ZL5A 4DASA 3KA9A 4II4B 2D5KA 5ERKA 4CMYV 2CLBA 4CMYA 4CVRA 3OGHA 3AK8A 1Z6OM 1TJOA 5FEJA 3WVVA 3AJPA 5CZUA 3RD0A 1VJXA 5GU0X 1R03A 1Z6OA 3A68A 1Z4AA 5J9VA 3R2MA 4IWKA 3AJQA 4ZKXA 3R2OA 2BK6A 4PG0A 5GU1X 3ERZA 3Q4OA 2C41A 3E1OA 2ZA8A 4M32A 4CYBA 3TA8A 1LKOA 3F35A 2XJMA 1SQ3A 4DZ0A 2JD60 3BVLA 5D8RA 1AEWA 2GS4A 2ITBA 3EZ0A 4CVSA 3RAVA 4EVEA 4ITTA 1RCGA 4MY7A 2C2UA 3WVWA 3E6SA 2V2NA 5FFBA 2CHIA
chains in the Genus database with same CATH superfamily
1RYTA 5D8XA 2XGWA 3FI6A 2C6RA 4LYUA 3AF9X 2XKQA 3L0MA 2FKZA 1JI5A 3QZ3A 5FFEA 1LB3A 3V3KB 4DYYA 3UOFA 3GVYA 2V2RA 1DATA 3VVAA 2VZBA 2CEIA 2CLUA 2Z5RA 1RCIA 5JDOB 1BG7A 2BJYA 3R2HA 5E1UA 5ERJA 3QB9A 5CMQA 4Z5SA 2AR0A 3KHKA 1VELA 4R42A 3C23A 4W4KB 1MOJA 2MGYA 2OH3A 2V2SA 4ZKWA 2OC5A 3RBCA 3F32A 1TKPA 4M33A 2XJOA 4OYNA 4ETRA 5I4JA 3KXUA 1NF6A 2FHAA 3KDQA 5K52A 5J8WA 3SE1A 2WLAA 4YVZA 2V8UA 5D8PA 1JKVA 4TOCA 3F34A 1NNQA 4TODA 3UNOA 2Z90A 4KXRB 1JREA 5LG2A 3PVRA 4REUA 3PW8A 1VLGA 3PW1A 5IX6A 5LBHA 3EZUA 2JD70 3HIUA 5GN8A 2VXIA 1L8IA 3E1QA 1IERA 4TOFA 1DVBA 3R2SA 3NOZX 3HL1A 3PVRB 3PWFA 1TK6A 3PW1B 2GYQA 3FVBA 5LG8A 5HJFA 5K53A 3WNWA 2CWLA 5GN8B 1JI4A 4ZJKA 1J30A 2X170 1RCEA 4TOAA 1NF4A 4MXPA 4X0JA 3O7SA 4ZLWA 3R2LA 1UVHA 3C1ZA 1XZ3A 3O7RA 4DI0A 2VXXA 4EVCA 4M35A 3VNXA 1H96A 4Y08A 2FZFA 1XZ1A 2CIHA 5CMRA 5C6FA 3UOIA 2CHPA 3W54A 1EUMA 4A25A 4WJG4 5HJHA 2OKCA 2C2JA 2IB0A 2C2FA 5FFDA 5JKMA 4ZMCA 4KVQA 3PW8C 2XJNA 1YUZA 1VEIA 3AF7X 3FRSA 3PZAA 4RC6B 1QGHA 3Q4QA 4ZL6A 2ZG7X 4RC7A 3FSEA 1UMNA 3NP2X 1LKPA 4MN9A 2WWXB 3UFBA 3KX9A 3RE7A 3BT5A 5GU2X 3MPSA 3AF8X 2BW1A 3LKDA 3PVYA 4EVDA 5HQOA 2FJCA 3SIDA 1NFVA 4ISPA 3RGDA 1F33A 1JYBA 4IWJA 3EGMA 3PVTA 3KA6A 2ZURX 4ERUA 5J93A 2YW6A 3Q4NA 3F36A 2V2JA 4RC7B 4Z3BA 1VEQA 2V2LA 3QVDA 4CY9A 1ZS3A 3D19A 1JKUA 3E6RA 4AM4A 1ZUJA 3ISFA 4LQJA 4RC5B 3PVYB 3KA8A 2V2MA 1SOFA 2V8TA 3E1PA 3QD8A 3WVUA 4CVTA 3PVTB 4TOEA 4YXJA 1O9IA 1RCDA 3AK9A 3E1JA 3R2RA 4DYZA 3E1LA 2CF7A 5D8SA 3DBYA 3PWQA 4ZTTA 3F38A 2HR5A 2YJKA 5D8OA 4XKSA 4E6KA 1O9RA 1HRSA 5JKMG 4LQHA 1FHAA 5D8YA 3VV9A 4PG1A 2HTNA 2F7NA 3QHBA 4CYAA 4EVBA 5HU6D 1JIGA 2FG8A 4PGKA 2V15A 4TOBA 1L8HA 1YUXA 4YKHA 3BVFA 4TO9A 2IY4A 4XGSA 3BVEA 5JKLA 3F33A 3ISEA 3N6OA 4IXKA 3GE4A 2V2PA 2W0OA 4ITWA 1RCCA 5FFCA 2ZA6A 3KA4A 3U90A 3BKNA 1N1QA 2ZG8X 4KVRA 3T9JA 5D8QA 4LPMA 1MFRA 2WLUA 4LYXA 5J8SA 5GU3X 4QUWA 3F37A 3IS8A 2ZG9X 3R2KA 4RC6A 4TW3A 3PWQC 2Y3QA 3GHQA 2Z5PA 4U3GA 3IQ1A 3JZ9A 1JGCA 4AM5A 5GOUA 3FRRA 2G4HA 3H7GA 1BFRA 4YXMA 4MJYA 4P18A 4E40A 5FFAA 3SH6A 3Q4RA 4XKUA 3GGYA 3KWOA 4ZKHA 3KA3A 4DE6A 2N02A 2QF9A 4MKUA 3E1MA 3NP0X 3A9QA 4RC5A 2RBDA 3F39A 3SHXA 4XKTA 1JTSA 3JZAB 2CN7A 1GWGA 2WTLA 3E2CA 2ZA7A 4AM2A 1TKOA 4CVPA 3ES3A 5JKLG 2V2OA 4LQNA 4RC8A 2JD80 4ML5A 4DYXA 2Z6MA 1S3QA 1KRQA 5JACA 5AXSA 2UX1A 1BCFA 2YJJA 1QYBA 3E1NA 2FFXJ 4LQVA 4TOHA 4ISMA 2YW7A 3GGZA 2FG4A 4DYUA 4PGIA 1YV1A 1S30A 3AJOA 1IESA 3OJ5A 2PYBA 2BKCA 3BVIA 1LKMA 1B71A 1S2ZA 2QQYA 3C1YA 2FL0A 4II4A 5LS9A 4MUDA 2Z5QA 4LPJA 2IU2A 1OTKA 1F30A 4LPNA 3IS7A 4M34A 1DPSA 3QHCA 2CN6A 4KVSA 5E2DA 2V2IA 2GYDA 3C21A 3BVKA 4TOGA 4ZL5A 4DASA 3KA9A 4II4B 2D5KA 5ERKA 4CMYV 2CLBA 4CMYA 4CVRA 3M6JA 4W4LB 3OGHA 3AK8A 1Z6OM 1TJOA 5FEJA 3WVVA 3AJPA 5CZUA 3RD0A 1VJXA 5GU0X 1R03A 1Z6OA 2Y44A 3A68A 1Z4AA 5J9VA 3R2MA 4IWKA 3AJQA 4ZKXA 3R2OA 2BK6A 4PG0A 5GU1X 3ERZA 3Q4OA 2C41A 3E1OA 2ZA8A 4M32A 4CYBA 3TA8A 1LKOA 3F35A 2XJMA 1SQ3A 4DZ0A 2JD60 3BVLA 5D8RA 1AEWA 2GS4A 2G38B 2ITBA 3EZ0A 4CVSA 3RAVA 4EVEA 4ITTA 1RCGA 4MY7A 2C2UA 3WVWA 3E6SA 2V2NA 5FFBA 2CHIA 5JDOA
chains in the Genus database with same CATH topology
1RYTA 5D8XA 2XGWA 3FI6A 2C6RA 4LYUA 3AF9X 2XKQA 3L0MA 2FKZA 1JI5A 3QZ3A 5FFEA 1LB3A 3V3KB 4DYYA 3UOFA 3GVYA 2V2RA 1DATA 3VVAA 2VZBA 2CEIA 2CLUA 2Z5RA 1RCIA 5JDOB 1BG7A 2BJYA 3R2HA 5E1UA 5ERJA 3QB9A 5CMQA 4Z5SA 2AR0A 3KHKA 1VELA 4R42A 3C23A 4W4KB 1MOJA 2MGYA 2OH3A 2V2SA 4ZKWA 2OC5A 3RBCA 3F32A 1TKPA 4M33A 2XJOA 4OYNA 4ETRA 5I4JA 3KXUA 1NF6A 2FHAA 3KDQA 5K52A 5J8WA 3SE1A 2WLAA 4YVZA 2V8UA 5D8PA 1JKVA 4TOCA 3F34A 1NNQA 4TODA 3UNOA 2Z90A 4KXRB 1JREA 5LG2A 3PVRA 4REUA 3PW8A 1VLGA 3PW1A 5IX6A 5LBHA 3EZUA 2JD70 3HIUA 5GN8A 2VXIA 1L8IA 3E1QA 1IERA 4TOFA 1DVBA 3R2SA 3NOZX 3HL1A 3PVRB 3PWFA 1TK6A 3PW1B 2GYQA 3FVBA 5LG8A 5HJFA 5K53A 3WNWA 2CWLA 5GN8B 1JI4A 4ZJKA 1J30A 2X170 1RCEA 4TOAA 1NF4A 4MXPA 4X0JA 3O7SA 4ZLWA 3R2LA 1UVHA 3C1ZA 1XZ3A 3O7RA 4DI0A 2VXXA 4EVCA 4M35A 3VNXA 1H96A 4Y08A 2FZFA 1XZ1A 2CIHA 5CMRA 5C6FA 3UOIA 2CHPA 3W54A 1EUMA 4A25A 4WJG4 5HJHA 2OKCA 2C2JA 2IB0A 2C2FA 5FFDA 5JKMA 4ZMCA 4KVQA 3PW8C 2XJNA 1YUZA 1VEIA 3AF7X 3FRSA 3PZAA 4RC6B 1QGHA 3Q4QA 4ZL6A 2ZG7X 4RC7A 3FSEA 1UMNA 3NP2X 1LKPA 4MN9A 2WWXB 3UFBA 3KX9A 3RE7A 3BT5A 5GU2X 3MPSA 3AF8X 2BW1A 3LKDA 3PVYA 4EVDA 5HQOA 2FJCA 3SIDA 1NFVA 4ISPA 3RGDA 1F33A 1JYBA 4IWJA 3EGMA 3PVTA 3KA6A 2ZURX 4ERUA 5J93A 2YW6A 3Q4NA 3F36A 2V2JA 4RC7B 4Z3BA 1VEQA 2V2LA 3QVDA 4CY9A 1ZS3A 3D19A 1JKUA 3E6RA 4AM4A 1ZUJA 3ISFA 4LQJA 4RC5B 3PVYB 3KA8A 2V2MA 1SOFA 2V8TA 3E1PA 3QD8A 3WVUA 4CVTA 3PVTB 4TOEA 4YXJA 1O9IA 1RCDA 3AK9A 3E1JA 3R2RA 4DYZA 3E1LA 2CF7A 5D8SA 3DBYA 3PWQA 4ZTTA 3F38A 2HR5A 2YJKA 5D8OA 4XKSA 4E6KA 1O9RA 1HRSA 5JKMG 4LQHA 1FHAA 5D8YA 3VV9A 4PG1A 2HTNA 2F7NA 3QHBA 4CYAA 4EVBA 5HU6D 1JIGA 2FG8A 4PGKA 2V15A 4TOBA 1L8HA 1YUXA 4YKHA 3BVFA 4TO9A 2IY4A 4XGSA 3BVEA 5JKLA 3F33A 3ISEA 3N6OA 4IXKA 3GE4A 2V2PA 2W0OA 4ITWA 1RCCA 5FFCA 2ZA6A 3KA4A 3U90A 3BKNA 1N1QA 2ZG8X 4KVRA 3T9JA 5D8QA 4LPMA 1MFRA 2WLUA 4LYXA 5J8SA 5GU3X 4QUWA 3F37A 3IS8A 2ZG9X 3R2KA 4RC6A 4TW3A 3PWQC 2Y3QA 3GHQA 2Z5PA 4U3GA 3IQ1A 3JZ9A 1JGCA 4AM5A 5GOUA 3FRRA 2G4HA 3H7GA 1BFRA 4YXMA 4MJYA 4P18A 4E40A 5FFAA 3SH6A 3Q4RA 4XKUA 3GGYA 3KWOA 4ZKHA 3KA3A 4DE6A 2N02A 2QF9A 4MKUA 3E1MA 3NP0X 3A9QA 4RC5A 2RBDA 3F39A 3SHXA 4XKTA 1JTSA 3JZAB 2CN7A 1GWGA 2WTLA 3E2CA 2ZA7A 4AM2A 1TKOA 4CVPA 3ES3A 5JKLG 2V2OA 4LQNA 4RC8A 2JD80 4ML5A 4DYXA 2Z6MA 1S3QA 1KRQA 5JACA 5AXSA 2UX1A 1BCFA 2YJJA 1QYBA 3E1NA 2FFXJ 4LQVA 4TOHA 4ISMA 2YW7A 3GGZA 2FG4A 4DYUA 4PGIA 1YV1A 1S30A 3AJOA 1IESA 3OJ5A 2PYBA 2BKCA 3BVIA 1LKMA 1B71A 1S2ZA 2QQYA 3C1YA 2FL0A 4II4A 5LS9A 4MUDA 2Z5QA 4LPJA 2IU2A 1OTKA 1F30A 4LPNA 3IS7A 4M34A 1DPSA 3QHCA 2CN6A 4KVSA 5E2DA 2V2IA 2GYDA 3C21A 3BVKA 4TOGA 4ZL5A 4DASA 3KA9A 4II4B 2D5KA 5ERKA 4CMYV 2CLBA 4CMYA 4CVRA 3M6JA 4W4LB 3OGHA 3AK8A 1Z6OM 1TJOA 5FEJA 3WVVA 3AJPA 5CZUA 3RD0A 1VJXA 5GU0X 1R03A 1Z6OA 2Y44A 3A68A 1Z4AA 5J9VA 3R2MA 4IWKA 3AJQA 4ZKXA 3R2OA 2BK6A 4PG0A 5GU1X 3ERZA 3Q4OA 2C41A 3E1OA 2ZA8A 4M32A 4CYBA 3TA8A 1LKOA 3F35A 2XJMA 1SQ3A 4DZ0A 2JD60 3BVLA 5D8RA 1AEWA 2GS4A 2G38B 2ITBA 3EZ0A 4CVSA 3RAVA 4EVEA 4ITTA 1RCGA 4MY7A 2C2UA 3WVWA 3E6SA 2V2NA 5FFBA 2CHIA 5JDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RYT A;  5D8X A;  2XGW A;  3FI6 A;  2C6R A;  4LYU A;  3AF9 X;  2XKQ A;  2FKZ A;  1JI5 A;  3QZ3 A;  5FFE A;  1LB3 A;  4DYY A;  3UOF A;  3GVY A;  2V2R A;  1DAT A;  2VZB A;  2CEI A;  2CLU A;  2Z5R A;  1RCI A;  1BG7 A;  2BJY A;  3R2H A;  5E1U A;  5ERJ A;  3QB9 A;  5CMQ A;  4Z5S A;  1VEL A;  4R42 A;  1MOJ A;  2V2S A;  2OH3 A;  4ZKW A;  2OC5 A;  3RBC A;  3F32 A;  1TKP A;  4M33 A;  2XJO A;  4OYN A;  4ETR A;  5I4J A;  3KXU A;  1NF6 A;  2FHA A;  5K52 A;  5J8W A;  3SE1 A;  2WLA A;  5D8P A;  1JKV A;  4TOC A;  3F34 A;  1NNQ A;  4TOD A;  3UNO A;  2Z90 A;  1JRE A;  5LG2 A;  3PVR A;  4REU A;  3PW8 A;  1VLG A;  3PW1 A;  5IX6 A;  5LBH A;  3EZU A;  2JD7 0;  3HIU A;  5GN8 A;  2VXI A;  1L8I A;  3E1Q A;  1IER A;  4TOF A;  1DVB A;  3R2S A;  3NOZ X;  3HL1 A;  3PVR B;  3PWF A;  1TK6 A;  3PW1 B;  2GYQ A;  3FVB A;  5LG8 A;  5HJF A;  5K53 A;  3WNW A;  5GN8 B;  1JI4 A;  4ZJK A;  1J30 A;  2X17 0;  1RCE A;  4TOA A;  1NF4 A;  3O7S A;  4ZLW A;  3R2L A;  1UVH A;  1XZ3 A;  3O7R A;  4DI0 A;  2VXX A;  4EVC A;  4M35 A;  3VNX A;  1H96 A;  4Y08 A;  2FZF A;  1XZ1 A;  2CIH A;  5CMR A;  5C6F A;  3UOI A;  2CHP A;  1EUM A;  4A25 A;  5HJH A;  2C2J A;  2IB0 A;  2C2F A;  5FFD A;  5JKM A;  4ZMC A;  4KVQ A;  3PW8 C;  2XJN A;  1YUZ A;  1VEI A;  3AF7 X;  3PZA A;  4RC6 B;  1QGH A;  3Q4Q A;  4ZL6 A;  2ZG7 X;  4RC7 A;  3FSE A;  1UMN A;  3NP2 X;  1LKP A;  4MN9 A;  3KX9 A;  3RE7 A;  3BT5 A;  5GU2 X;  3MPS A;  3AF8 X;  2BW1 A;  3PVY A;  4EVD A;  5HQO A;  2FJC A;  3SID A;  1NFV A;  4ISP A;  3RGD A;  1F33 A;  1JYB A;  4IWJ A;  3EGM A;  3PVT A;  3KA6 A;  2ZUR X;  4ERU A;  5J93 A;  2YW6 A;  3Q4N A;  3F36 A;  2V2J A;  4RC7 B;  4Z3B A;  1VEQ A;  2V2L A;  3QVD A;  4CY9 A;  1ZS3 A;  1JKU A;  3E6R A;  4AM4 A;  1ZUJ A;  3ISF A;  4LQJ A;  4RC5 B;  3PVY B;  3KA8 A;  2V2M A;  1SOF A;  3E1P A;  3QD8 A;  3WVU A;  4CVT A;  3PVT B;  4TOE A;  1O9I A;  1RCD A;  3AK9 A;  3E1J A;  3R2R A;  4DYZ A;  3E1L A;  2CF7 A;  5D8S A;  3PWQ A;  4ZTT A;  3F38 A;  2HR5 A;  2YJK A;  5D8O A;  4XKS A;  4E6K A;  1O9R A;  1HRS A;  5JKM G;  4LQH A;  1FHA A;  5D8Y A;  4PG1 A;  2HTN A;  2F7N A;  3QHB A;  4CYA A;  4EVB A;  1JIG A;  2FG8 A;  4PGK A;  2V15 A;  4TOB A;  1L8H A;  1YUX A;  4YKH A;  3BVF A;  4TO9 A;  2IY4 A;  4XGS A;  3BVE A;  5JKL A;  3F33 A;  3ISE A;  4IXK A;  3GE4 A;  2V2P A;  2W0O A;  4ITW A;  1RCC A;  5FFC A;  2ZA6 A;  3KA4 A;  3U90 A;  3BKN A;  1N1Q A;  2ZG8 X;  4KVR A;  3T9J A;  5D8Q A;  4LPM A;  1MFR A;  2WLU A;  4LYX A;  5J8S A;  5GU3 X;  4QUW A;  3F37 A;  3IS8 A;  2ZG9 X;  3R2K A;  4RC6 A;  4TW3 A;  3PWQ C;  2Y3Q A;  3GHQ A;  2Z5P A;  4U3G A;  3IQ1 A;  1JGC A;  4AM5 A;  5GOU A;  2G4H A;  3H7G A;  1BFR A;  4MJY A;  4P18 A;  5FFA A;  3SH6 A;  3Q4R A;  4XKU A;  3KWO A;  4ZKH A;  3KA3 A;  4DE6 A;  2QF9 A;  4MKU A;  3E1M A;  3NP0 X;  3A9Q A;  4RC5 A;  2RBD A;  3F39 A;  3SHX A;  4XKT A;  1JTS A;  2CN7 A;  1GWG A;  2WTL A;  3E2C A;  2ZA7 A;  4AM2 A;  1TKO A;  4CVP A;  3ES3 A;  5JKL G;  2V2O A;  4LQN A;  4RC8 A;  2JD8 0;  4ML5 A;  4DYX A;  2Z6M A;  1S3Q A;  1KRQ A;  5JAC A;  5AXS A;  2UX1 A;  1BCF A;  2YJJ A;  1QYB A;  3E1N A;  2FFX J;  4LQV A;  4TOH A;  4ISM A;  2YW7 A;  2FG4 A;  4DYU A;  4PGI A;  1YV1 A;  1S30 A;  3AJO A;  1IES A;  3OJ5 A;  2PYB A;  2BKC A;  3BVI A;  1LKM A;  1B71 A;  1S2Z A;  2QQY A;  2FL0 A;  4II4 A;  5LS9 A;  4MUD A;  2Z5Q A;  4LPJ A;  2IU2 A;  1OTK A;  1F30 A;  4LPN A;  3IS7 A;  4M34 A;  1DPS A;  3QHC A;  2CN6 A;  4KVS A;  5E2D A;  2V2I A;  2GYD A;  3BVK A;  4TOG A;  4ZL5 A;  4DAS A;  3KA9 A;  4II4 B;  2D5K A;  5ERK A;  4CMY V;  2CLB A;  4CMY A;  4CVR A;  3OGH A;  3AK8 A;  1Z6O M;  1TJO A;  5FEJ A;  3WVV A;  3AJP A;  5CZU A;  3RD0 A;  1VJX A;  5GU0 X;  1R03 A;  1Z6O A;  3A68 A;  1Z4A A;  5J9V A;  3R2M A;  4IWK A;  3AJQ A;  4ZKX A;  3R2O A;  2BK6 A;  4PG0 A;  5GU1 X;  3ERZ A;  3Q4O A;  2C41 A;  3E1O A;  2ZA8 A;  4M32 A;  4CYB A;  3TA8 A;  1LKO A;  3F35 A;  2XJM A;  1SQ3 A;  4DZ0 A;  2JD6 0;  3BVL A;  5D8R A;  1AEW A;  2GS4 A;  2ITB A;  3EZ0 A;  4CVS A;  3RAV A;  4EVE A;  4ITT A;  1RCG A;  4MY7 A;  2C2U A;  3WVW A;  3E6S A;  2V2N A;  5FFB A;  2CHI A; 
#chains in the Genus database with same CATH topology
 1RYT A;  5D8X A;  2XGW A;  3FI6 A;  2C6R A;  4LYU A;  3AF9 X;  2XKQ A;  3L0M A;  2FKZ A;  1JI5 A;  3QZ3 A;  5FFE A;  1LB3 A;  3V3K B;  4DYY A;  3UOF A;  3GVY A;  2V2R A;  1DAT A;  3VVA A;  2VZB A;  2CEI A;  2CLU A;  2Z5R A;  1RCI A;  5JDO B;  1BG7 A;  2BJY A;  3R2H A;  5E1U A;  5ERJ A;  3QB9 A;  5CMQ A;  4Z5S A;  2AR0 A;  3KHK A;  1VEL A;  4R42 A;  3C23 A;  4W4K B;  1MOJ A;  2MGY A;  2OH3 A;  2V2S A;  4ZKW A;  2OC5 A;  3RBC A;  3F32 A;  1TKP A;  4M33 A;  2XJO A;  4OYN A;  4ETR A;  5I4J A;  3KXU A;  1NF6 A;  2FHA A;  3KDQ A;  5K52 A;  5J8W A;  3SE1 A;  2WLA A;  4YVZ A;  2V8U A;  5D8P A;  1JKV A;  4TOC A;  3F34 A;  1NNQ A;  4TOD A;  3UNO A;  2Z90 A;  4KXR B;  1JRE A;  5LG2 A;  3PVR A;  4REU A;  3PW8 A;  1VLG A;  3PW1 A;  5IX6 A;  5LBH A;  3EZU A;  2JD7 0;  3HIU A;  5GN8 A;  2VXI A;  1L8I A;  3E1Q A;  1IER A;  4TOF A;  1DVB A;  3R2S A;  3NOZ X;  3HL1 A;  3PVR B;  3PWF A;  1TK6 A;  3PW1 B;  2GYQ A;  3FVB A;  5LG8 A;  5HJF A;  5K53 A;  3WNW A;  2CWL A;  5GN8 B;  1JI4 A;  4ZJK A;  1J30 A;  2X17 0;  1RCE A;  4TOA A;  1NF4 A;  4MXP A;  4X0J A;  3O7S A;  4ZLW A;  3R2L A;  1UVH A;  3C1Z A;  1XZ3 A;  3O7R A;  4DI0 A;  2VXX A;  4EVC A;  4M35 A;  3VNX A;  1H96 A;  4Y08 A;  2FZF A;  1XZ1 A;  2CIH A;  5CMR A;  5C6F A;  3UOI A;  2CHP A;  3W54 A;  1EUM A;  4A25 A;  4WJG 4;  5HJH A;  2OKC A;  2C2J A;  2IB0 A;  2C2F A;  5FFD A;  5JKM A;  4ZMC A;  4KVQ A;  3PW8 C;  2XJN A;  1YUZ A;  1VEI A;  3AF7 X;  3FRS A;  3PZA A;  4RC6 B;  1QGH A;  3Q4Q A;  4ZL6 A;  2ZG7 X;  4RC7 A;  3FSE A;  1UMN A;  3NP2 X;  1LKP A;  4MN9 A;  2WWX B;  3UFB A;  3KX9 A;  3RE7 A;  3BT5 A;  5GU2 X;  3MPS A;  3AF8 X;  2BW1 A;  3LKD A;  3PVY A;  4EVD A;  5HQO A;  2FJC A;  3SID A;  1NFV A;  4ISP A;  3RGD A;  1F33 A;  1JYB A;  4IWJ A;  3EGM A;  3PVT A;  3KA6 A;  2ZUR X;  4ERU A;  5J93 A;  2YW6 A;  3Q4N A;  3F36 A;  2V2J A;  4RC7 B;  4Z3B A;  1VEQ A;  2V2L A;  3QVD A;  4CY9 A;  1ZS3 A;  3D19 A;  1JKU A;  3E6R A;  4AM4 A;  1ZUJ A;  3ISF A;  4LQJ A;  4RC5 B;  3PVY B;  3KA8 A;  2V2M A;  1SOF A;  2V8T A;  3E1P A;  3QD8 A;  3WVU A;  4CVT A;  3PVT B;  4TOE A;  4YXJ A;  1O9I A;  1RCD A;  3AK9 A;  3E1J A;  3R2R A;  4DYZ A;  3E1L A;  2CF7 A;  5D8S A;  3DBY A;  3PWQ A;  4ZTT A;  3F38 A;  2HR5 A;  2YJK A;  5D8O A;  4XKS A;  4E6K A;  1O9R A;  1HRS A;  5JKM G;  4LQH A;  1FHA A;  5D8Y A;  3VV9 A;  4PG1 A;  2HTN A;  2F7N A;  3QHB A;  4CYA A;  4EVB A;  5HU6 D;  1JIG A;  2FG8 A;  4PGK A;  2V15 A;  4TOB A;  1L8H A;  1YUX A;  4YKH A;  3BVF A;  4TO9 A;  2IY4 A;  4XGS A;  3BVE A;  5JKL A;  3F33 A;  3ISE A;  3N6O A;  4IXK A;  3GE4 A;  2V2P A;  2W0O A;  4ITW A;  1RCC A;  5FFC A;  2ZA6 A;  3KA4 A;  3U90 A;  3BKN A;  1N1Q A;  2ZG8 X;  4KVR A;  3T9J A;  5D8Q A;  4LPM A;  1MFR A;  2WLU A;  4LYX A;  5J8S A;  5GU3 X;  4QUW A;  3F37 A;  3IS8 A;  2ZG9 X;  3R2K A;  4RC6 A;  4TW3 A;  3PWQ C;  2Y3Q A;  3GHQ A;  2Z5P A;  4U3G A;  3IQ1 A;  3JZ9 A;  1JGC A;  4AM5 A;  5GOU A;  3FRR A;  2G4H A;  3H7G A;  1BFR A;  4YXM A;  4MJY A;  4P18 A;  4E40 A;  5FFA A;  3SH6 A;  3Q4R A;  4XKU A;  3GGY A;  3KWO A;  4ZKH A;  3KA3 A;  4DE6 A;  2N02 A;  2QF9 A;  4MKU A;  3E1M A;  3NP0 X;  3A9Q A;  4RC5 A;  2RBD A;  3F39 A;  3SHX A;  4XKT A;  1JTS A;  3JZA B;  2CN7 A;  1GWG A;  2WTL A;  3E2C A;  2ZA7 A;  4AM2 A;  1TKO A;  4CVP A;  3ES3 A;  5JKL G;  2V2O A;  4LQN A;  4RC8 A;  2JD8 0;  4ML5 A;  4DYX A;  2Z6M A;  1S3Q A;  1KRQ A;  5JAC A;  5AXS A;  2UX1 A;  1BCF A;  2YJJ A;  1QYB A;  3E1N A;  2FFX J;  4LQV A;  4TOH A;  4ISM A;  2YW7 A;  3GGZ A;  2FG4 A;  4DYU A;  4PGI A;  1YV1 A;  1S30 A;  3AJO A;  1IES A;  3OJ5 A;  2PYB A;  2BKC A;  3BVI A;  1LKM A;  1B71 A;  1S2Z A;  2QQY A;  3C1Y A;  2FL0 A;  4II4 A;  5LS9 A;  4MUD A;  2Z5Q A;  4LPJ A;  2IU2 A;  1OTK A;  1F30 A;  4LPN A;  3IS7 A;  4M34 A;  1DPS A;  3QHC A;  2CN6 A;  4KVS A;  5E2D A;  2V2I A;  2GYD A;  3C21 A;  3BVK A;  4TOG A;  4ZL5 A;  4DAS A;  3KA9 A;  4II4 B;  2D5K A;  5ERK A;  4CMY V;  2CLB A;  4CMY A;  4CVR A;  3M6J A;  4W4L B;  3OGH A;  3AK8 A;  1Z6O M;  1TJO A;  5FEJ A;  3WVV A;  3AJP A;  5CZU A;  3RD0 A;  1VJX A;  5GU0 X;  1R03 A;  1Z6O A;  2Y44 A;  3A68 A;  1Z4A A;  5J9V A;  3R2M A;  4IWK A;  3AJQ A;  4ZKX A;  3R2O A;  2BK6 A;  4PG0 A;  5GU1 X;  3ERZ A;  3Q4O A;  2C41 A;  3E1O A;  2ZA8 A;  4M32 A;  4CYB A;  3TA8 A;  1LKO A;  3F35 A;  2XJM A;  1SQ3 A;  4DZ0 A;  2JD6 0;  3BVL A;  5D8R A;  1AEW A;  2GS4 A;  2G38 B;  2ITB A;  3EZ0 A;  4CVS A;  3RAV A;  4EVE A;  4ITT A;  1RCG A;  4MY7 A;  2C2U A;  3WVW A;  3E6S A;  2V2N A;  5FFB A;  2CHI A;  5JDO A; 
#chains in the Genus database with same CATH homology
 1RYT A;  5D8X A;  2XGW A;  3FI6 A;  2C6R A;  4LYU A;  3AF9 X;  2XKQ A;  3L0M A;  2FKZ A;  1JI5 A;  3QZ3 A;  5FFE A;  1LB3 A;  3V3K B;  4DYY A;  3UOF A;  3GVY A;  2V2R A;  1DAT A;  3VVA A;  2VZB A;  2CEI A;  2CLU A;  2Z5R A;  1RCI A;  5JDO B;  1BG7 A;  2BJY A;  3R2H A;  5E1U A;  5ERJ A;  3QB9 A;  5CMQ A;  4Z5S A;  2AR0 A;  3KHK A;  1VEL A;  4R42 A;  3C23 A;  4W4K B;  1MOJ A;  2MGY A;  2OH3 A;  2V2S A;  4ZKW A;  2OC5 A;  3RBC A;  3F32 A;  1TKP A;  4M33 A;  2XJO A;  4OYN A;  4ETR A;  5I4J A;  3KXU A;  1NF6 A;  2FHA A;  3KDQ A;  5K52 A;  5J8W A;  3SE1 A;  2WLA A;  4YVZ A;  2V8U A;  5D8P A;  1JKV A;  4TOC A;  3F34 A;  1NNQ A;  4TOD A;  3UNO A;  2Z90 A;  4KXR B;  1JRE A;  5LG2 A;  3PVR A;  4REU A;  3PW8 A;  1VLG A;  3PW1 A;  5IX6 A;  5LBH A;  3EZU A;  2JD7 0;  3HIU A;  5GN8 A;  2VXI A;  1L8I A;  3E1Q A;  1IER A;  4TOF A;  1DVB A;  3R2S A;  3NOZ X;  3HL1 A;  3PVR B;  3PWF A;  1TK6 A;  3PW1 B;  2GYQ A;  3FVB A;  5LG8 A;  5HJF A;  5K53 A;  3WNW A;  2CWL A;  5GN8 B;  1JI4 A;  4ZJK A;  1J30 A;  2X17 0;  1RCE A;  4TOA A;  1NF4 A;  4MXP A;  4X0J A;  3O7S A;  4ZLW A;  3R2L A;  1UVH A;  3C1Z A;  1XZ3 A;  3O7R A;  4DI0 A;  2VXX A;  4EVC A;  4M35 A;  3VNX A;  1H96 A;  4Y08 A;  2FZF A;  1XZ1 A;  2CIH A;  5CMR A;  5C6F A;  3UOI A;  2CHP A;  3W54 A;  1EUM A;  4A25 A;  4WJG 4;  5HJH A;  2OKC A;  2C2J A;  2IB0 A;  2C2F A;  5FFD A;  5JKM A;  4ZMC A;  4KVQ A;  3PW8 C;  2XJN A;  1YUZ A;  1VEI A;  3AF7 X;  3FRS A;  3PZA A;  4RC6 B;  1QGH A;  3Q4Q A;  4ZL6 A;  2ZG7 X;  4RC7 A;  3FSE A;  1UMN A;  3NP2 X;  1LKP A;  4MN9 A;  2WWX B;  3UFB A;  3KX9 A;  3RE7 A;  3BT5 A;  5GU2 X;  3MPS A;  3AF8 X;  2BW1 A;  3LKD A;  3PVY A;  4EVD A;  5HQO A;  2FJC A;  3SID A;  1NFV A;  4ISP A;  3RGD A;  1F33 A;  1JYB A;  4IWJ A;  3EGM A;  3PVT A;  3KA6 A;  2ZUR X;  4ERU A;  5J93 A;  2YW6 A;  3Q4N A;  3F36 A;  2V2J A;  4RC7 B;  4Z3B A;  1VEQ A;  2V2L A;  3QVD A;  4CY9 A;  1ZS3 A;  3D19 A;  1JKU A;  3E6R A;  4AM4 A;  1ZUJ A;  3ISF A;  4LQJ A;  4RC5 B;  3PVY B;  3KA8 A;  2V2M A;  1SOF A;  2V8T A;  3E1P A;  3QD8 A;  3WVU A;  4CVT A;  3PVT B;  4TOE A;  4YXJ A;  1O9I A;  1RCD A;  3AK9 A;  3E1J A;  3R2R A;  4DYZ A;  3E1L A;  2CF7 A;  5D8S A;  3DBY A;  3PWQ A;  4ZTT A;  3F38 A;  2HR5 A;  2YJK A;  5D8O A;  4XKS A;  4E6K A;  1O9R A;  1HRS A;  5JKM G;  4LQH A;  1FHA A;  5D8Y A;  3VV9 A;  4PG1 A;  2HTN A;  2F7N A;  3QHB A;  4CYA A;  4EVB A;  5HU6 D;  1JIG A;  2FG8 A;  4PGK A;  2V15 A;  4TOB A;  1L8H A;  1YUX A;  4YKH A;  3BVF A;  4TO9 A;  2IY4 A;  4XGS A;  3BVE A;  5JKL A;  3F33 A;  3ISE A;  3N6O A;  4IXK A;  3GE4 A;  2V2P A;  2W0O A;  4ITW A;  1RCC A;  5FFC A;  2ZA6 A;  3KA4 A;  3U90 A;  3BKN A;  1N1Q A;  2ZG8 X;  4KVR A;  3T9J A;  5D8Q A;  4LPM A;  1MFR A;  2WLU A;  4LYX A;  5J8S A;  5GU3 X;  4QUW A;  3F37 A;  3IS8 A;  2ZG9 X;  3R2K A;  4RC6 A;  4TW3 A;  3PWQ C;  2Y3Q A;  3GHQ A;  2Z5P A;  4U3G A;  3IQ1 A;  3JZ9 A;  1JGC A;  4AM5 A;  5GOU A;  3FRR A;  2G4H A;  3H7G A;  1BFR A;  4YXM A;  4MJY A;  4P18 A;  4E40 A;  5FFA A;  3SH6 A;  3Q4R A;  4XKU A;  3GGY A;  3KWO A;  4ZKH A;  3KA3 A;  4DE6 A;  2N02 A;  2QF9 A;  4MKU A;  3E1M A;  3NP0 X;  3A9Q A;  4RC5 A;  2RBD A;  3F39 A;  3SHX A;  4XKT A;  1JTS A;  3JZA B;  2CN7 A;  1GWG A;  2WTL A;  3E2C A;  2ZA7 A;  4AM2 A;  1TKO A;  4CVP A;  3ES3 A;  5JKL G;  2V2O A;  4LQN A;  4RC8 A;  2JD8 0;  4ML5 A;  4DYX A;  2Z6M A;  1S3Q A;  1KRQ A;  5JAC A;  5AXS A;  2UX1 A;  1BCF A;  2YJJ A;  1QYB A;  3E1N A;  2FFX J;  4LQV A;  4TOH A;  4ISM A;  2YW7 A;  3GGZ A;  2FG4 A;  4DYU A;  4PGI A;  1YV1 A;  1S30 A;  3AJO A;  1IES A;  3OJ5 A;  2PYB A;  2BKC A;  3BVI A;  1LKM A;  1B71 A;  1S2Z A;  2QQY A;  3C1Y A;  2FL0 A;  4II4 A;  5LS9 A;  4MUD A;  2Z5Q A;  4LPJ A;  2IU2 A;  1OTK A;  1F30 A;  4LPN A;  3IS7 A;  4M34 A;  1DPS A;  3QHC A;  2CN6 A;  4KVS A;  5E2D A;  2V2I A;  2GYD A;  3C21 A;  3BVK A;  4TOG A;  4ZL5 A;  4DAS A;  3KA9 A;  4II4 B;  2D5K A;  5ERK A;  4CMY V;  2CLB A;  4CMY A;  4CVR A;  3M6J A;  4W4L B;  3OGH A;  3AK8 A;  1Z6O M;  1TJO A;  5FEJ A;  3WVV A;  3AJP A;  5CZU A;  3RD0 A;  1VJX A;  5GU0 X;  1R03 A;  1Z6O A;  2Y44 A;  3A68 A;  1Z4A A;  5J9V A;  3R2M A;  4IWK A;  3AJQ A;  4ZKX A;  3R2O A;  2BK6 A;  4PG0 A;  5GU1 X;  3ERZ A;  3Q4O A;  2C41 A;  3E1O A;  2ZA8 A;  4M32 A;  4CYB A;  3TA8 A;  1LKO A;  3F35 A;  2XJM A;  1SQ3 A;  4DZ0 A;  2JD6 0;  3BVL A;  5D8R A;  1AEW A;  2GS4 A;  2G38 B;  2ITB A;  3EZ0 A;  4CVS A;  3RAV A;  4EVE A;  4ITT A;  1RCG A;  4MY7 A;  2C2U A;  3WVW A;  3E6S A;  2V2N A;  5FFB A;  2CHI A;  5JDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...