4ETRA

X-ray structure of pa2169 from pseudomonas aeruginosa
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
146
structure length
121
Chain Sequence
NLDDTLDVLNDLLQTSKDGEAGFHACAEDLRDPQLKAAMLEQSRDCAAAADELERIVLELGGKPEEAVLNECERGEDVAKHRYQAALEKSLPAEIHQVIERQYQGVLRHHDRVRALRDARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title The AEROPATH project targeting Pseudomonas aeruginosa: crystallographic studies for assessment of potential targets in early-stage drug discovery.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Unknown function
total genus 57
structure length 121
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09537 DUF2383 Domain of unknown function (DUF2383)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4etrA00
1NF6A 3PVYA 2Z90A 4XKTA 1RCDA 1TK6A 4RC6A 4IWKA 1VJXA 1L8IA 4MY7A 3E1NA 1JYBA 5GU1X 1LB3A 3BVEA 4IXKA 3RGDA 3U90A 4ERUA 4A25A 4M35A 1TJOA 2BW1A 4ZMCA 1H96A 3RAVA 2XGWA 3Q4QA 2YW6A 4ZL6A 3A68A 4LQHA 2FG4A 1EUMA 2Y3QA 4OYNA 1F33A 3F33A 4TOCA 2IU2A 3PVRA 5ERJA 3O7RA 5JACA 3KA3A 3R2MA 5E1UA 4MUDA 2ZG9X 2FFXJ 4ITTA 2Z5PA 5GN8A 3FI6A 2FZFA 1LKMA 2BK6A 3HIUA 3GHQA 3AJOA 1JKUA 5FEJA 1QYBA 3ISFA 4LQVA 3BT5A 2HR5A 2CLBA 1ZS3A 5GU0X 3OJ5A 3PZAA 2FL0A 4CMYA 1B71A 2C41A 4MN9A 3PVTB 3BVIA 5FFBA 3E1OA 2VXXA 4II4A 2BKCA 3NP2X 3KWOA 1UMNA 1JI5A 4REUA 3NP0X 2V2PA 2C2UA 1S30A 2WTLA 5K53A 3E6SA 3Q4RA 3MPSA 2CLUA 1BCFA 3E1JA 4ZKXA 5LBHA 3R2RA 2V2NA 3H7GA 4CVPA 5GU3X 3QD8A 2V2SA 3E2CA 2ZG8X 3TA8A 1YV1A 3SE1A 3PWQA 3WNWA 4ZL5A 3ES3A 5D8YA 3F34A 4P18A 3F38A 3UNOA 3IS8A 3AK8A 3AF9X 4LPNA 5ERKA 5E2DA 5D8QA 4EVCA 2Z6MA 1FHAA 4CY9A 5JKMG 1BG7A 4EVEA 2OC5A 3PW8A 5I4JA 1VEIA 3R2SA 4RC7B 4Y08A 2V2RA 2XJNA 5JKMA 4LPJA 5HQOA 1RCEA 5D8RA 1UVHA 2D5KA 2Z5RA 4ZKHA 1S2ZA 4PGKA 1RCGA 2ZA6A 2G4HA 3AJQA 3R2HA 1JGCA 1JI4A 3GVYA 2C2JA 4U3GA 2CN6A 3SIDA 2ZG7X 4LQJA 4TOEA 2XJMA 1MOJA 3KA4A 3AJPA 5IX6A 5FFCA 1MFRA 3PW1B 4PG0A 1L8HA 4LYUA 4RC8A 5LS9A 3F36A 3RBCA 4XKSA 4KVSA 3NOZX 3PWFA 4RC5B 1KRQA 3QHBA 1IESA 3R2KA 2CHPA 5HJFA 1BFRA 3KX9A 2ZA7A 1XZ3A 5GOUA 3F35A 3E1MA 3SHXA 3GE4A 1QGHA 2YJKA 4EVBA 2YJJA 4ZTTA 2QF9A 1IERA 4TOAA 2VXIA 5D8OA 1RCCA 5CMQA 2HTNA 1RYTA 2FHAA 3RE7A 3IQ1A 3AF8X 4ZKWA 3IS7A 5JKLG 4ZLWA 2XKQA 2QQYA 3E1PA 3F39A 3RD0A 2RBDA 1Z6OA 5CZUA 5D8XA 3AK9A 3BVLA 1XZ1A 4RC7A 1O9IA 2V2MA 3BVFA 5JKLA 3OGHA 2C6RA 2ZURX 5AXSA 3UOIA 1GWGA 3F37A 3EZUA 3HL1A 5J93A 2CIHA 3E1LA 1YUZA 5GN8B 3WVWA 3E6RA 2WLUA 1NFVA 3BKNA 1YUXA 4XGSA 3R2LA 4Z3BA 4XKUA 2Z5QA 4ML5A 4DYXA 4AM5A 3A9QA 4TO9A 1VELA 4MKUA 1VEQA 4ETRA 5HJHA 3R2OA 2BJYA 1NNQA 3FVBA 4M33A 1RCIA 4LPMA 1TKPA 2CF7A 3KXUA 4QUWA 1HRSA 4TW3A 3PW1A 1JKVA 1VLGA 2CN7A 5LG2A 2PYBA 1AEWA 4RC5A 4CYAA 4M34A 4DZ0A 4TOGA 2CEIA 3QB9A 3VNXA 5J8SA 2XJOA 2JD60 1O9RA 4Z5SA 4EVDA 5K52A 3PVTA 4DYYA 4ZJKA 3T9JA 4DI0A 2X170 5LG8A 4DYZA 3EGMA 3AF7X 5CMRA 1DATA 4DYUA 2JD70 1JTSA 3E1QA 2YW7A 2GYQA 2V2IA 1S3QA 4KVRA 3FSEA 4CVSA 1SOFA 2JD80 3QVDA 3PVYB 1NF4A 3WVVA 3Q4NA 5GU2X 4RC6B 3SH6A 5FFDA 4DE6A 1R03A 3EZ0A 4TODA 3WVUA 1DVBA 2F7NA 4PG1A 1DPSA 1OTKA 4DASA 3KA6A 4R42A 4LQNA 2C2FA 2FKZA 4CMYV 1J30A 2W0OA 4ITWA 2GS4A 4MJYA 2V2JA 2IY4A 4PGIA 1F30A 1LKOA 4TOBA 3BVKA 3PVRB 4CVRA 3QHCA 4LYXA 4IWJA 4TOHA 1N1QA 4KVQA 2V2OA 4AM2A 1JREA 2V2LA 2IB0A 3PWQC 1Z4AA 4CVTA 5FFEA 3KA9A 3O7SA 4TOFA 2V15A 4E6KA 3QZ3A 5J9VA 1JIGA 4YKHA 1SQ3A 4CYBA 2WLAA 4M32A 5D8SA 5FFAA 1TKOA 3F32A 2ZA8A 1ZUJA 2FG8A 4ISMA 4AM4A 2ITBA 3PW8C 2GYDA 3KA8A 1Z6OM 3Q4OA 3ERZA 5D8PA 4II4B 2OH3A 2VZBA 5J8WA 2UX1A 2FJCA 1LKPA 3ISEA 5C6FA 3UOFA 2CHIA 4ISPA
chains in the Genus database with same CATH superfamily
1NF6A 3PVYA 2Z90A 3UFBA 4XKTA 1RCDA 1TK6A 4RC6A 4IWKA 2N02A 1VJXA 1L8IA 4MY7A 3E1NA 1JYBA 5GU1X 3GGYA 1LB3A 3BVEA 4IXKA 3RGDA 3U90A 4ERUA 2V8TA 4A25A 3LKDA 3N6OA 4M35A 1TJOA 2BW1A 4ZMCA 1H96A 3RAVA 2V8UA 2XGWA 3Q4QA 2YW6A 4ZL6A 3A68A 4LQHA 2FG4A 1EUMA 2Y3QA 4OYNA 1F33A 3F33A 4TOCA 2IU2A 3PVRA 5ERJA 3O7RA 5JACA 3KA3A 4WJG4 3R2MA 5E1UA 4MUDA 2ZG9X 2FFXJ 4ITTA 2Z5PA 5GN8A 3FI6A 2FZFA 1LKMA 2BK6A 3HIUA 3GHQA 3AJOA 1JKUA 5FEJA 1QYBA 3ISFA 4LQVA 3BT5A 2HR5A 2CLBA 1ZS3A 5GU0X 3OJ5A 3PZAA 2FL0A 4CMYA 1B71A 2C41A 4MXPA 3VV9A 4MN9A 3PVTB 3BVIA 3FRSA 5FFBA 5HU6D 3E1OA 2VXXA 3C21A 4II4A 2BKCA 3NP2X 3KWOA 1UMNA 1JI5A 4REUA 3NP0X 2V2PA 2C2UA 1S30A 2WTLA 5K53A 3E6SA 3Q4RA 3MPSA 2CLUA 1BCFA 3E1JA 4ZKXA 2OKCA 5LBHA 3FRRA 3R2RA 2V2NA 3M6JA 3H7GA 4CVPA 5GU3X 3QD8A 2V2SA 3E2CA 2ZG8X 3TA8A 1YV1A 3SE1A 3GGZA 3PWQA 3WNWA 2WWXB 4ZL5A 2Y44A 3ES3A 5D8YA 3F34A 4P18A 3F38A 3UNOA 3IS8A 3AK8A 3AF9X 4LPNA 5ERKA 5JDOA 5E2DA 5D8QA 4EVCA 2Z6MA 1FHAA 4CY9A 5JKMG 1BG7A 4EVEA 2OC5A 3PW8A 5I4JA 1VEIA 3R2SA 3JZAB 4RC7B 4Y08A 2V2RA 2XJNA 3C1YA 3DBYA 5JKMA 4LPJA 5HQOA 1RCEA 5D8RA 4KXRB 1UVHA 2D5KA 2Z5RA 4ZKHA 1S2ZA 4PGKA 1RCGA 3KHKA 2ZA6A 2G4HA 3VVAA 3AJQA 3R2HA 1JGCA 1JI4A 3GVYA 2C2JA 4U3GA 2CN6A 3SIDA 2ZG7X 4LQJA 4TOEA 2XJMA 1MOJA 3KA4A 3AJPA 5IX6A 5FFCA 1MFRA 3D19A 3PW1B 4PG0A 1L8HA 3C23A 4LYUA 4RC8A 5LS9A 3F36A 3RBCA 4XKSA 4KVSA 3NOZX 3PWFA 4RC5B 1KRQA 3QHBA 1IESA 3R2KA 2CHPA 5HJFA 1BFRA 3KX9A 2ZA7A 1XZ3A 3V3KB 5GOUA 4W4LB 3F35A 3E1MA 3SHXA 3GE4A 1QGHA 2YJKA 4EVBA 2YJJA 4ZTTA 2QF9A 1IERA 4TOAA 2VXIA 5D8OA 1RCCA 5CMQA 2AR0A 2HTNA 1RYTA 2FHAA 3RE7A 3IQ1A 3AF8X 4ZKWA 3IS7A 5JKLG 4ZLWA 2XKQA 2QQYA 3E1PA 3F39A 3RD0A 2RBDA 1Z6OA 5CZUA 5D8XA 3AK9A 3BVLA 1XZ1A 4RC7A 1O9IA 2V2MA 3BVFA 4X0JA 5JKLA 3OGHA 2C6RA 2ZURX 5AXSA 3UOIA 1GWGA 3F37A 4YXJA 3EZUA 3HL1A 4W4KB 5J93A 2CIHA 3E1LA 1YUZA 5GN8B 3WVWA 3E6RA 2WLUA 1NFVA 3BKNA 1YUXA 4XGSA 3R2LA 4Z3BA 4XKUA 2Z5QA 4ML5A 3L0MA 4DYXA 3JZ9A 4AM5A 3A9QA 4TO9A 1VELA 4MKUA 1VEQA 4ETRA 5HJHA 3R2OA 2BJYA 1NNQA 3FVBA 4M33A 3W54A 1RCIA 1TKPA 2CF7A 3KXUA 4LPMA 4QUWA 1HRSA 4TW3A 3PW1A 1JKVA 1VLGA 2CN7A 5LG2A 2PYBA 1AEWA 4RC5A 4CYAA 4M34A 4DZ0A 4TOGA 2CEIA 2CWLA 3QB9A 3VNXA 5J8SA 2XJOA 2JD60 1O9RA 4Z5SA 4EVDA 2G38B 5K52A 3PVTA 4DYYA 4ZJKA 3T9JA 4DI0A 2X170 5LG8A 4DYZA 3EGMA 4YXMA 3AF7X 5CMRA 1DATA 4DYUA 2JD70 1JTSA 3E1QA 2YW7A 5JDOB 2GYQA 2MGYA 2V2IA 1S3QA 4KVRA 3FSEA 4CVSA 1SOFA 2JD80 3KDQA 3QVDA 3PVYB 1NF4A 3WVVA 3Q4NA 5GU2X 4RC6B 3SH6A 5FFDA 4DE6A 1R03A 3EZ0A 4TODA 3WVUA 1DVBA 2F7NA 4PG1A 1DPSA 1OTKA 4DASA 3KA6A 4R42A 4LQNA 2C2FA 2FKZA 4E40A 4CMYV 1J30A 2W0OA 4ITWA 2GS4A 4MJYA 2V2JA 2IY4A 4PGIA 1F30A 1LKOA 4TOBA 3BVKA 3PVRB 4CVRA 3QHCA 4LYXA 4IWJA 4TOHA 1N1QA 3C1ZA 4KVQA 2V2OA 4AM2A 1JREA 2V2LA 2IB0A 4YVZA 3PWQC 1Z4AA 4CVTA 5FFEA 3KA9A 3O7SA 4TOFA 2V15A 4E6KA 3QZ3A 5J9VA 1JIGA 4YKHA 1SQ3A 4CYBA 2WLAA 4M32A 5D8SA 5FFAA 1TKOA 3F32A 2ZA8A 1ZUJA 2FG8A 4ISMA 4AM4A 2ITBA 3PW8C 2GYDA 3KA8A 1Z6OM 3Q4OA 3ERZA 5D8PA 4II4B 2OH3A 2VZBA 5J8WA 2UX1A 2FJCA 1LKPA 3ISEA 5C6FA 3UOFA 2CHIA 4ISPA
chains in the Genus database with same CATH topology
1NF6A 3PVYA 2Z90A 3UFBA 4XKTA 1RCDA 1TK6A 4RC6A 4IWKA 2N02A 1VJXA 1L8IA 4MY7A 3E1NA 1JYBA 5GU1X 3GGYA 1LB3A 3BVEA 4IXKA 3RGDA 3U90A 4ERUA 2V8TA 4A25A 3LKDA 3N6OA 4M35A 1TJOA 2BW1A 4ZMCA 1H96A 3RAVA 2V8UA 2XGWA 3Q4QA 2YW6A 4ZL6A 3A68A 4LQHA 2FG4A 1EUMA 2Y3QA 4OYNA 1F33A 3F33A 4TOCA 2IU2A 3PVRA 5ERJA 3O7RA 5JACA 3KA3A 4WJG4 3R2MA 5E1UA 4MUDA 2ZG9X 2FFXJ 4ITTA 2Z5PA 5GN8A 3FI6A 2FZFA 1LKMA 2BK6A 3HIUA 3GHQA 3AJOA 1JKUA 5FEJA 1QYBA 3ISFA 4LQVA 3BT5A 2HR5A 2CLBA 1ZS3A 5GU0X 3OJ5A 3PZAA 2FL0A 4CMYA 1B71A 2C41A 4MXPA 3VV9A 4MN9A 3PVTB 3BVIA 3FRSA 5FFBA 5HU6D 3E1OA 2VXXA 3C21A 4II4A 2BKCA 3NP2X 3KWOA 1UMNA 1JI5A 4REUA 3NP0X 2V2PA 2C2UA 1S30A 2WTLA 5K53A 3E6SA 3Q4RA 3MPSA 2CLUA 1BCFA 3E1JA 4ZKXA 2OKCA 5LBHA 3FRRA 3R2RA 2V2NA 3M6JA 3H7GA 4CVPA 5GU3X 3QD8A 2V2SA 3E2CA 2ZG8X 3TA8A 1YV1A 3SE1A 3GGZA 3PWQA 3WNWA 2WWXB 4ZL5A 2Y44A 3ES3A 5D8YA 3F34A 4P18A 3F38A 3UNOA 3IS8A 3AK8A 3AF9X 4LPNA 5ERKA 5JDOA 5E2DA 5D8QA 4EVCA 2Z6MA 1FHAA 4CY9A 5JKMG 1BG7A 4EVEA 2OC5A 3PW8A 5I4JA 1VEIA 3R2SA 3JZAB 4RC7B 4Y08A 2V2RA 2XJNA 3C1YA 3DBYA 5JKMA 4LPJA 5HQOA 1RCEA 5D8RA 4KXRB 1UVHA 2D5KA 2Z5RA 4ZKHA 1S2ZA 4PGKA 1RCGA 3KHKA 2ZA6A 2G4HA 3VVAA 3AJQA 3R2HA 1JGCA 1JI4A 3GVYA 2C2JA 4U3GA 2CN6A 3SIDA 2ZG7X 4LQJA 4TOEA 2XJMA 1MOJA 3KA4A 3AJPA 5IX6A 5FFCA 1MFRA 3D19A 3PW1B 4PG0A 1L8HA 3C23A 4LYUA 4RC8A 5LS9A 3F36A 3RBCA 4XKSA 4KVSA 3NOZX 3PWFA 4RC5B 1KRQA 3QHBA 1IESA 3R2KA 2CHPA 5HJFA 1BFRA 3KX9A 2ZA7A 1XZ3A 3V3KB 5GOUA 4W4LB 3F35A 3E1MA 3SHXA 3GE4A 1QGHA 2YJKA 4EVBA 2YJJA 4ZTTA 2QF9A 1IERA 4TOAA 2VXIA 5D8OA 1RCCA 5CMQA 2AR0A 2HTNA 1RYTA 2FHAA 3RE7A 3IQ1A 3AF8X 4ZKWA 3IS7A 5JKLG 4ZLWA 2XKQA 2QQYA 3E1PA 3F39A 3RD0A 2RBDA 1Z6OA 5CZUA 5D8XA 3AK9A 3BVLA 1XZ1A 4RC7A 1O9IA 2V2MA 3BVFA 4X0JA 5JKLA 3OGHA 2C6RA 2ZURX 5AXSA 3UOIA 1GWGA 3F37A 4YXJA 3EZUA 3HL1A 4W4KB 5J93A 2CIHA 3E1LA 1YUZA 5GN8B 3WVWA 3E6RA 2WLUA 1NFVA 3BKNA 1YUXA 4XGSA 3R2LA 4Z3BA 4XKUA 2Z5QA 4ML5A 3L0MA 4DYXA 3JZ9A 4AM5A 3A9QA 4TO9A 1VELA 4MKUA 1VEQA 4ETRA 5HJHA 3R2OA 2BJYA 1NNQA 3FVBA 4M33A 3W54A 1RCIA 1TKPA 2CF7A 3KXUA 4LPMA 4QUWA 1HRSA 4TW3A 3PW1A 1JKVA 1VLGA 2CN7A 5LG2A 2PYBA 1AEWA 4RC5A 4CYAA 4M34A 4DZ0A 4TOGA 2CEIA 2CWLA 3QB9A 3VNXA 5J8SA 2XJOA 2JD60 1O9RA 4Z5SA 4EVDA 2G38B 5K52A 3PVTA 4DYYA 4ZJKA 3T9JA 4DI0A 2X170 5LG8A 4DYZA 3EGMA 4YXMA 3AF7X 5CMRA 1DATA 4DYUA 2JD70 1JTSA 3E1QA 2YW7A 5JDOB 2GYQA 2MGYA 2V2IA 1S3QA 4KVRA 3FSEA 4CVSA 1SOFA 2JD80 3KDQA 3QVDA 3PVYB 1NF4A 3WVVA 3Q4NA 5GU2X 4RC6B 3SH6A 5FFDA 4DE6A 1R03A 3EZ0A 4TODA 3WVUA 1DVBA 2F7NA 4PG1A 1DPSA 1OTKA 4DASA 3KA6A 4R42A 4LQNA 2C2FA 2FKZA 4E40A 4CMYV 1J30A 2W0OA 4ITWA 2GS4A 4MJYA 2V2JA 2IY4A 4PGIA 1F30A 1LKOA 4TOBA 3BVKA 3PVRB 4CVRA 3QHCA 4LYXA 4IWJA 4TOHA 1N1QA 3C1ZA 4KVQA 2V2OA 4AM2A 1JREA 2V2LA 2IB0A 4YVZA 3PWQC 1Z4AA 4CVTA 5FFEA 3KA9A 3O7SA 4TOFA 2V15A 4E6KA 3QZ3A 5J9VA 1JIGA 4YKHA 1SQ3A 4CYBA 2WLAA 4M32A 5D8SA 5FFAA 1TKOA 3F32A 2ZA8A 1ZUJA 2FG8A 4ISMA 4AM4A 2ITBA 3PW8C 2GYDA 3KA8A 1Z6OM 3Q4OA 3ERZA 5D8PA 4II4B 2OH3A 2VZBA 5J8WA 2UX1A 2FJCA 1LKPA 3ISEA 5C6FA 3UOFA 2CHIA 4ISPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NF6 A;  3PVY A;  2Z90 A;  4XKT A;  1RCD A;  1TK6 A;  4RC6 A;  4IWK A;  1VJX A;  1L8I A;  4MY7 A;  3E1N A;  1JYB A;  5GU1 X;  1LB3 A;  3BVE A;  4IXK A;  3RGD A;  3U90 A;  4ERU A;  4A25 A;  4M35 A;  1TJO A;  2BW1 A;  4ZMC A;  1H96 A;  3RAV A;  2XGW A;  3Q4Q A;  2YW6 A;  4ZL6 A;  3A68 A;  4LQH A;  2FG4 A;  1EUM A;  2Y3Q A;  4OYN A;  1F33 A;  3F33 A;  4TOC A;  2IU2 A;  3PVR A;  5ERJ A;  3O7R A;  5JAC A;  3KA3 A;  3R2M A;  5E1U A;  4MUD A;  2ZG9 X;  2FFX J;  4ITT A;  2Z5P A;  5GN8 A;  3FI6 A;  2FZF A;  1LKM A;  2BK6 A;  3HIU A;  3GHQ A;  3AJO A;  1JKU A;  5FEJ A;  1QYB A;  3ISF A;  4LQV A;  3BT5 A;  2HR5 A;  2CLB A;  1ZS3 A;  5GU0 X;  3OJ5 A;  3PZA A;  2FL0 A;  4CMY A;  1B71 A;  2C41 A;  4MN9 A;  3PVT B;  3BVI A;  5FFB A;  3E1O A;  2VXX A;  4II4 A;  2BKC A;  3NP2 X;  3KWO A;  1UMN A;  1JI5 A;  4REU A;  3NP0 X;  2V2P A;  2C2U A;  1S30 A;  2WTL A;  5K53 A;  3E6S A;  3Q4R A;  3MPS A;  2CLU A;  1BCF A;  3E1J A;  4ZKX A;  5LBH A;  3R2R A;  2V2N A;  3H7G A;  4CVP A;  5GU3 X;  3QD8 A;  2V2S A;  3E2C A;  2ZG8 X;  3TA8 A;  1YV1 A;  3SE1 A;  3PWQ A;  3WNW A;  4ZL5 A;  3ES3 A;  5D8Y A;  3F34 A;  4P18 A;  3F38 A;  3UNO A;  3IS8 A;  3AK8 A;  3AF9 X;  4LPN A;  5ERK A;  5E2D A;  5D8Q A;  4EVC A;  2Z6M A;  1FHA A;  4CY9 A;  5JKM G;  1BG7 A;  4EVE A;  2OC5 A;  3PW8 A;  5I4J A;  1VEI A;  3R2S A;  4RC7 B;  4Y08 A;  2V2R A;  2XJN A;  5JKM A;  4LPJ A;  5HQO A;  1RCE A;  5D8R A;  1UVH A;  2D5K A;  2Z5R A;  4ZKH A;  1S2Z A;  4PGK A;  1RCG A;  2ZA6 A;  2G4H A;  3AJQ A;  3R2H A;  1JGC A;  1JI4 A;  3GVY A;  2C2J A;  4U3G A;  2CN6 A;  3SID A;  2ZG7 X;  4LQJ A;  4TOE A;  2XJM A;  1MOJ A;  3KA4 A;  3AJP A;  5IX6 A;  5FFC A;  1MFR A;  3PW1 B;  4PG0 A;  1L8H A;  4LYU A;  4RC8 A;  5LS9 A;  3F36 A;  3RBC A;  4XKS A;  4KVS A;  3NOZ X;  3PWF A;  4RC5 B;  1KRQ A;  3QHB A;  1IES A;  3R2K A;  2CHP A;  5HJF A;  1BFR A;  3KX9 A;  2ZA7 A;  1XZ3 A;  5GOU A;  3F35 A;  3E1M A;  3SHX A;  3GE4 A;  1QGH A;  2YJK A;  4EVB A;  2YJJ A;  4ZTT A;  2QF9 A;  1IER A;  4TOA A;  2VXI A;  5D8O A;  1RCC A;  5CMQ A;  2HTN A;  1RYT A;  2FHA A;  3RE7 A;  3IQ1 A;  3AF8 X;  4ZKW A;  3IS7 A;  5JKL G;  4ZLW A;  2XKQ A;  2QQY A;  3E1P A;  3F39 A;  3RD0 A;  2RBD A;  1Z6O A;  5CZU A;  5D8X A;  3AK9 A;  3BVL A;  1XZ1 A;  4RC7 A;  1O9I A;  2V2M A;  3BVF A;  5JKL A;  3OGH A;  2C6R A;  2ZUR X;  5AXS A;  3UOI A;  1GWG A;  3F37 A;  3EZU A;  3HL1 A;  5J93 A;  2CIH A;  3E1L A;  1YUZ A;  5GN8 B;  3WVW A;  3E6R A;  2WLU A;  1NFV A;  3BKN A;  1YUX A;  4XGS A;  3R2L A;  4Z3B A;  4XKU A;  2Z5Q A;  4ML5 A;  4DYX A;  4AM5 A;  3A9Q A;  4TO9 A;  1VEL A;  4MKU A;  1VEQ A;  4ETR A;  5HJH A;  3R2O A;  2BJY A;  1NNQ A;  3FVB A;  4M33 A;  1RCI A;  4LPM A;  1TKP A;  2CF7 A;  3KXU A;  4QUW A;  1HRS A;  4TW3 A;  3PW1 A;  1JKV A;  1VLG A;  2CN7 A;  5LG2 A;  2PYB A;  1AEW A;  4RC5 A;  4CYA A;  4M34 A;  4DZ0 A;  4TOG A;  2CEI A;  3QB9 A;  3VNX A;  5J8S A;  2XJO A;  2JD6 0;  1O9R A;  4Z5S A;  4EVD A;  5K52 A;  3PVT A;  4DYY A;  4ZJK A;  3T9J A;  4DI0 A;  2X17 0;  5LG8 A;  4DYZ A;  3EGM A;  3AF7 X;  5CMR A;  1DAT A;  4DYU A;  2JD7 0;  1JTS A;  3E1Q A;  2YW7 A;  2GYQ A;  2V2I A;  1S3Q A;  4KVR A;  3FSE A;  4CVS A;  1SOF A;  2JD8 0;  3QVD A;  3PVY B;  1NF4 A;  3WVV A;  3Q4N A;  5GU2 X;  4RC6 B;  3SH6 A;  5FFD A;  4DE6 A;  1R03 A;  3EZ0 A;  4TOD A;  3WVU A;  1DVB A;  2F7N A;  4PG1 A;  1DPS A;  1OTK A;  4DAS A;  3KA6 A;  4R42 A;  4LQN A;  2C2F A;  2FKZ A;  4CMY V;  1J30 A;  2W0O A;  4ITW A;  2GS4 A;  4MJY A;  2V2J A;  2IY4 A;  4PGI A;  1F30 A;  1LKO A;  4TOB A;  3BVK A;  3PVR B;  4CVR A;  3QHC A;  4LYX A;  4IWJ A;  4TOH A;  1N1Q A;  4KVQ A;  2V2O A;  4AM2 A;  1JRE A;  2V2L A;  2IB0 A;  3PWQ C;  1Z4A A;  4CVT A;  5FFE A;  3KA9 A;  3O7S A;  4TOF A;  2V15 A;  4E6K A;  3QZ3 A;  5J9V A;  1JIG A;  4YKH A;  1SQ3 A;  4CYB A;  2WLA A;  4M32 A;  5D8S A;  5FFA A;  1TKO A;  3F32 A;  2ZA8 A;  1ZUJ A;  2FG8 A;  4ISM A;  4AM4 A;  2ITB A;  3PW8 C;  2GYD A;  3KA8 A;  1Z6O M;  3Q4O A;  3ERZ A;  5D8P A;  4II4 B;  2OH3 A;  2VZB A;  5J8W A;  2UX1 A;  2FJC A;  1LKP A;  3ISE A;  5C6F A;  3UOF A;  2CHI A;  4ISP A; 
#chains in the Genus database with same CATH topology
 1NF6 A;  3PVY A;  2Z90 A;  3UFB A;  4XKT A;  1RCD A;  1TK6 A;  4RC6 A;  4IWK A;  2N02 A;  1VJX A;  1L8I A;  4MY7 A;  3E1N A;  1JYB A;  5GU1 X;  3GGY A;  1LB3 A;  3BVE A;  4IXK A;  3RGD A;  3U90 A;  4ERU A;  2V8T A;  4A25 A;  3LKD A;  3N6O A;  4M35 A;  1TJO A;  2BW1 A;  4ZMC A;  1H96 A;  3RAV A;  2V8U A;  2XGW A;  3Q4Q A;  2YW6 A;  4ZL6 A;  3A68 A;  4LQH A;  2FG4 A;  1EUM A;  2Y3Q A;  4OYN A;  1F33 A;  3F33 A;  4TOC A;  2IU2 A;  3PVR A;  5ERJ A;  3O7R A;  5JAC A;  3KA3 A;  4WJG 4;  3R2M A;  5E1U A;  4MUD A;  2ZG9 X;  2FFX J;  4ITT A;  2Z5P A;  5GN8 A;  3FI6 A;  2FZF A;  1LKM A;  2BK6 A;  3HIU A;  3GHQ A;  3AJO A;  1JKU A;  5FEJ A;  1QYB A;  3ISF A;  4LQV A;  3BT5 A;  2HR5 A;  2CLB A;  1ZS3 A;  5GU0 X;  3OJ5 A;  3PZA A;  2FL0 A;  4CMY A;  1B71 A;  2C41 A;  4MXP A;  3VV9 A;  4MN9 A;  3PVT B;  3BVI A;  3FRS A;  5FFB A;  5HU6 D;  3E1O A;  2VXX A;  3C21 A;  4II4 A;  2BKC A;  3NP2 X;  3KWO A;  1UMN A;  1JI5 A;  4REU A;  3NP0 X;  2V2P A;  2C2U A;  1S30 A;  2WTL A;  5K53 A;  3E6S A;  3Q4R A;  3MPS A;  2CLU A;  1BCF A;  3E1J A;  4ZKX A;  2OKC A;  5LBH A;  3FRR A;  3R2R A;  2V2N A;  3M6J A;  3H7G A;  4CVP A;  5GU3 X;  3QD8 A;  2V2S A;  3E2C A;  2ZG8 X;  3TA8 A;  1YV1 A;  3SE1 A;  3GGZ A;  3PWQ A;  3WNW A;  2WWX B;  4ZL5 A;  2Y44 A;  3ES3 A;  5D8Y A;  3F34 A;  4P18 A;  3F38 A;  3UNO A;  3IS8 A;  3AK8 A;  3AF9 X;  4LPN A;  5ERK A;  5JDO A;  5E2D A;  5D8Q A;  4EVC A;  2Z6M A;  1FHA A;  4CY9 A;  5JKM G;  1BG7 A;  4EVE A;  2OC5 A;  3PW8 A;  5I4J A;  1VEI A;  3R2S A;  3JZA B;  4RC7 B;  4Y08 A;  2V2R A;  2XJN A;  3C1Y A;  3DBY A;  5JKM A;  4LPJ A;  5HQO A;  1RCE A;  5D8R A;  4KXR B;  1UVH A;  2D5K A;  2Z5R A;  4ZKH A;  1S2Z A;  4PGK A;  1RCG A;  3KHK A;  2ZA6 A;  2G4H A;  3VVA A;  3AJQ A;  3R2H A;  1JGC A;  1JI4 A;  3GVY A;  2C2J A;  4U3G A;  2CN6 A;  3SID A;  2ZG7 X;  4LQJ A;  4TOE A;  2XJM A;  1MOJ A;  3KA4 A;  3AJP A;  5IX6 A;  5FFC A;  1MFR A;  3D19 A;  3PW1 B;  4PG0 A;  1L8H A;  3C23 A;  4LYU A;  4RC8 A;  5LS9 A;  3F36 A;  3RBC A;  4XKS A;  4KVS A;  3NOZ X;  3PWF A;  4RC5 B;  1KRQ A;  3QHB A;  1IES A;  3R2K A;  2CHP A;  5HJF A;  1BFR A;  3KX9 A;  2ZA7 A;  1XZ3 A;  3V3K B;  5GOU A;  4W4L B;  3F35 A;  3E1M A;  3SHX A;  3GE4 A;  1QGH A;  2YJK A;  4EVB A;  2YJJ A;  4ZTT A;  2QF9 A;  1IER A;  4TOA A;  2VXI A;  5D8O A;  1RCC A;  5CMQ A;  2AR0 A;  2HTN A;  1RYT A;  2FHA A;  3RE7 A;  3IQ1 A;  3AF8 X;  4ZKW A;  3IS7 A;  5JKL G;  4ZLW A;  2XKQ A;  2QQY A;  3E1P A;  3F39 A;  3RD0 A;  2RBD A;  1Z6O A;  5CZU A;  5D8X A;  3AK9 A;  3BVL A;  1XZ1 A;  4RC7 A;  1O9I A;  2V2M A;  3BVF A;  4X0J A;  5JKL A;  3OGH A;  2C6R A;  2ZUR X;  5AXS A;  3UOI A;  1GWG A;  3F37 A;  4YXJ A;  3EZU A;  3HL1 A;  4W4K B;  5J93 A;  2CIH A;  3E1L A;  1YUZ A;  5GN8 B;  3WVW A;  3E6R A;  2WLU A;  1NFV A;  3BKN A;  1YUX A;  4XGS A;  3R2L A;  4Z3B A;  4XKU A;  2Z5Q A;  4ML5 A;  3L0M A;  4DYX A;  3JZ9 A;  4AM5 A;  3A9Q A;  4TO9 A;  1VEL A;  4MKU A;  1VEQ A;  4ETR A;  5HJH A;  3R2O A;  2BJY A;  1NNQ A;  3FVB A;  4M33 A;  3W54 A;  1RCI A;  1TKP A;  2CF7 A;  3KXU A;  4LPM A;  4QUW A;  1HRS A;  4TW3 A;  3PW1 A;  1JKV A;  1VLG A;  2CN7 A;  5LG2 A;  2PYB A;  1AEW A;  4RC5 A;  4CYA A;  4M34 A;  4DZ0 A;  4TOG A;  2CEI A;  2CWL A;  3QB9 A;  3VNX A;  5J8S A;  2XJO A;  2JD6 0;  1O9R A;  4Z5S A;  4EVD A;  2G38 B;  5K52 A;  3PVT A;  4DYY A;  4ZJK A;  3T9J A;  4DI0 A;  2X17 0;  5LG8 A;  4DYZ A;  3EGM A;  4YXM A;  3AF7 X;  5CMR A;  1DAT A;  4DYU A;  2JD7 0;  1JTS A;  3E1Q A;  2YW7 A;  5JDO B;  2GYQ A;  2MGY A;  2V2I A;  1S3Q A;  4KVR A;  3FSE A;  4CVS A;  1SOF A;  2JD8 0;  3KDQ A;  3QVD A;  3PVY B;  1NF4 A;  3WVV A;  3Q4N A;  5GU2 X;  4RC6 B;  3SH6 A;  5FFD A;  4DE6 A;  1R03 A;  3EZ0 A;  4TOD A;  3WVU A;  1DVB A;  2F7N A;  4PG1 A;  1DPS A;  1OTK A;  4DAS A;  3KA6 A;  4R42 A;  4LQN A;  2C2F A;  2FKZ A;  4E40 A;  4CMY V;  1J30 A;  2W0O A;  4ITW A;  2GS4 A;  4MJY A;  2V2J A;  2IY4 A;  4PGI A;  1F30 A;  1LKO A;  4TOB A;  3BVK A;  3PVR B;  4CVR A;  3QHC A;  4LYX A;  4IWJ A;  4TOH A;  1N1Q A;  3C1Z A;  4KVQ A;  2V2O A;  4AM2 A;  1JRE A;  2V2L A;  2IB0 A;  4YVZ A;  3PWQ C;  1Z4A A;  4CVT A;  5FFE A;  3KA9 A;  3O7S A;  4TOF A;  2V15 A;  4E6K A;  3QZ3 A;  5J9V A;  1JIG A;  4YKH A;  1SQ3 A;  4CYB A;  2WLA A;  4M32 A;  5D8S A;  5FFA A;  1TKO A;  3F32 A;  2ZA8 A;  1ZUJ A;  2FG8 A;  4ISM A;  4AM4 A;  2ITB A;  3PW8 C;  2GYD A;  3KA8 A;  1Z6O M;  3Q4O A;  3ERZ A;  5D8P A;  4II4 B;  2OH3 A;  2VZB A;  5J8W A;  2UX1 A;  2FJC A;  1LKP A;  3ISE A;  5C6F A;  3UOF A;  2CHI A;  4ISP A; 
#chains in the Genus database with same CATH homology
 1NF6 A;  3PVY A;  2Z90 A;  3UFB A;  4XKT A;  1RCD A;  1TK6 A;  4RC6 A;  4IWK A;  2N02 A;  1VJX A;  1L8I A;  4MY7 A;  3E1N A;  1JYB A;  5GU1 X;  3GGY A;  1LB3 A;  3BVE A;  4IXK A;  3RGD A;  3U90 A;  4ERU A;  2V8T A;  4A25 A;  3LKD A;  3N6O A;  4M35 A;  1TJO A;  2BW1 A;  4ZMC A;  1H96 A;  3RAV A;  2V8U A;  2XGW A;  3Q4Q A;  2YW6 A;  4ZL6 A;  3A68 A;  4LQH A;  2FG4 A;  1EUM A;  2Y3Q A;  4OYN A;  1F33 A;  3F33 A;  4TOC A;  2IU2 A;  3PVR A;  5ERJ A;  3O7R A;  5JAC A;  3KA3 A;  4WJG 4;  3R2M A;  5E1U A;  4MUD A;  2ZG9 X;  2FFX J;  4ITT A;  2Z5P A;  5GN8 A;  3FI6 A;  2FZF A;  1LKM A;  2BK6 A;  3HIU A;  3GHQ A;  3AJO A;  1JKU A;  5FEJ A;  1QYB A;  3ISF A;  4LQV A;  3BT5 A;  2HR5 A;  2CLB A;  1ZS3 A;  5GU0 X;  3OJ5 A;  3PZA A;  2FL0 A;  4CMY A;  1B71 A;  2C41 A;  4MXP A;  3VV9 A;  4MN9 A;  3PVT B;  3BVI A;  3FRS A;  5FFB A;  5HU6 D;  3E1O A;  2VXX A;  3C21 A;  4II4 A;  2BKC A;  3NP2 X;  3KWO A;  1UMN A;  1JI5 A;  4REU A;  3NP0 X;  2V2P A;  2C2U A;  1S30 A;  2WTL A;  5K53 A;  3E6S A;  3Q4R A;  3MPS A;  2CLU A;  1BCF A;  3E1J A;  4ZKX A;  2OKC A;  5LBH A;  3FRR A;  3R2R A;  2V2N A;  3M6J A;  3H7G A;  4CVP A;  5GU3 X;  3QD8 A;  2V2S A;  3E2C A;  2ZG8 X;  3TA8 A;  1YV1 A;  3SE1 A;  3GGZ A;  3PWQ A;  3WNW A;  2WWX B;  4ZL5 A;  2Y44 A;  3ES3 A;  5D8Y A;  3F34 A;  4P18 A;  3F38 A;  3UNO A;  3IS8 A;  3AK8 A;  3AF9 X;  4LPN A;  5ERK A;  5JDO A;  5E2D A;  5D8Q A;  4EVC A;  2Z6M A;  1FHA A;  4CY9 A;  5JKM G;  1BG7 A;  4EVE A;  2OC5 A;  3PW8 A;  5I4J A;  1VEI A;  3R2S A;  3JZA B;  4RC7 B;  4Y08 A;  2V2R A;  2XJN A;  3C1Y A;  3DBY A;  5JKM A;  4LPJ A;  5HQO A;  1RCE A;  5D8R A;  4KXR B;  1UVH A;  2D5K A;  2Z5R A;  4ZKH A;  1S2Z A;  4PGK A;  1RCG A;  3KHK A;  2ZA6 A;  2G4H A;  3VVA A;  3AJQ A;  3R2H A;  1JGC A;  1JI4 A;  3GVY A;  2C2J A;  4U3G A;  2CN6 A;  3SID A;  2ZG7 X;  4LQJ A;  4TOE A;  2XJM A;  1MOJ A;  3KA4 A;  3AJP A;  5IX6 A;  5FFC A;  1MFR A;  3D19 A;  3PW1 B;  4PG0 A;  1L8H A;  3C23 A;  4LYU A;  4RC8 A;  5LS9 A;  3F36 A;  3RBC A;  4XKS A;  4KVS A;  3NOZ X;  3PWF A;  4RC5 B;  1KRQ A;  3QHB A;  1IES A;  3R2K A;  2CHP A;  5HJF A;  1BFR A;  3KX9 A;  2ZA7 A;  1XZ3 A;  3V3K B;  5GOU A;  4W4L B;  3F35 A;  3E1M A;  3SHX A;  3GE4 A;  1QGH A;  2YJK A;  4EVB A;  2YJJ A;  4ZTT A;  2QF9 A;  1IER A;  4TOA A;  2VXI A;  5D8O A;  1RCC A;  5CMQ A;  2AR0 A;  2HTN A;  1RYT A;  2FHA A;  3RE7 A;  3IQ1 A;  3AF8 X;  4ZKW A;  3IS7 A;  5JKL G;  4ZLW A;  2XKQ A;  2QQY A;  3E1P A;  3F39 A;  3RD0 A;  2RBD A;  1Z6O A;  5CZU A;  5D8X A;  3AK9 A;  3BVL A;  1XZ1 A;  4RC7 A;  1O9I A;  2V2M A;  3BVF A;  4X0J A;  5JKL A;  3OGH A;  2C6R A;  2ZUR X;  5AXS A;  3UOI A;  1GWG A;  3F37 A;  4YXJ A;  3EZU A;  3HL1 A;  4W4K B;  5J93 A;  2CIH A;  3E1L A;  1YUZ A;  5GN8 B;  3WVW A;  3E6R A;  2WLU A;  1NFV A;  3BKN A;  1YUX A;  4XGS A;  3R2L A;  4Z3B A;  4XKU A;  2Z5Q A;  4ML5 A;  3L0M A;  4DYX A;  3JZ9 A;  4AM5 A;  3A9Q A;  4TO9 A;  1VEL A;  4MKU A;  1VEQ A;  4ETR A;  5HJH A;  3R2O A;  2BJY A;  1NNQ A;  3FVB A;  4M33 A;  3W54 A;  1RCI A;  1TKP A;  2CF7 A;  3KXU A;  4LPM A;  4QUW A;  1HRS A;  4TW3 A;  3PW1 A;  1JKV A;  1VLG A;  2CN7 A;  5LG2 A;  2PYB A;  1AEW A;  4RC5 A;  4CYA A;  4M34 A;  4DZ0 A;  4TOG A;  2CEI A;  2CWL A;  3QB9 A;  3VNX A;  5J8S A;  2XJO A;  2JD6 0;  1O9R A;  4Z5S A;  4EVD A;  2G38 B;  5K52 A;  3PVT A;  4DYY A;  4ZJK A;  3T9J A;  4DI0 A;  2X17 0;  5LG8 A;  4DYZ A;  3EGM A;  4YXM A;  3AF7 X;  5CMR A;  1DAT A;  4DYU A;  2JD7 0;  1JTS A;  3E1Q A;  2YW7 A;  5JDO B;  2GYQ A;  2MGY A;  2V2I A;  1S3Q A;  4KVR A;  3FSE A;  4CVS A;  1SOF A;  2JD8 0;  3KDQ A;  3QVD A;  3PVY B;  1NF4 A;  3WVV A;  3Q4N A;  5GU2 X;  4RC6 B;  3SH6 A;  5FFD A;  4DE6 A;  1R03 A;  3EZ0 A;  4TOD A;  3WVU A;  1DVB A;  2F7N A;  4PG1 A;  1DPS A;  1OTK A;  4DAS A;  3KA6 A;  4R42 A;  4LQN A;  2C2F A;  2FKZ A;  4E40 A;  4CMY V;  1J30 A;  2W0O A;  4ITW A;  2GS4 A;  4MJY A;  2V2J A;  2IY4 A;  4PGI A;  1F30 A;  1LKO A;  4TOB A;  3BVK A;  3PVR B;  4CVR A;  3QHC A;  4LYX A;  4IWJ A;  4TOH A;  1N1Q A;  3C1Z A;  4KVQ A;  2V2O A;  4AM2 A;  1JRE A;  2V2L A;  2IB0 A;  4YVZ A;  3PWQ C;  1Z4A A;  4CVT A;  5FFE A;  3KA9 A;  3O7S A;  4TOF A;  2V15 A;  4E6K A;  3QZ3 A;  5J9V A;  1JIG A;  4YKH A;  1SQ3 A;  4CYB A;  2WLA A;  4M32 A;  5D8S A;  5FFA A;  1TKO A;  3F32 A;  2ZA8 A;  1ZUJ A;  2FG8 A;  4ISM A;  4AM4 A;  2ITB A;  3PW8 C;  2GYD A;  3KA8 A;  1Z6O M;  3Q4O A;  3ERZ A;  5D8P A;  4II4 B;  2OH3 A;  2VZB A;  5J8W A;  2UX1 A;  2FJC A;  1LKP A;  3ISE A;  5C6F A;  3UOF A;  2CHI A;  4ISP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...