4XKSA

E. coli bfr variant y45f
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
157
structure length
157
Chain Sequence
MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEFHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDWLETELDLIQKMGLQNYLQAQIREE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Bacterioferritin
publication title Three Aromatic Residues are Required for Electron Transfer during Iron Mineralization in Bacterioferritin.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 75
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2015-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4xksA00
3UNOA 3GVYA 3AJQA 1TKOA 4E6KA 1JREA 3AF7X 5GOUA 3ISEA 2V2LA 4AM4A 2RBDA 1NFVA 2FG8A 2IB0A 3F36A 1R03A 4YKHA 3OGHA 4PGKA 1Z6OA 3OJ5A 2XJNA 1RCCA 3AK8A 2CN7A 1NNQA 1MFRA 4DYZA 5CMRA 1IESA 1BFRA 1NF4A 2Z6MA 5J8SA 3PWQA 2D5KA 2YJJA 4ITTA 4RC5B 2BJYA 3PVYB 3QHBA 3AF9X 3QVDA 2OC5A 1TK6A 1HRSA 3PWFA 4MJYA 4PGIA 2QQYA 5CZUA 2Z5QA 4EVCA 5AXSA 5D8RA 3KWOA 4ZKHA 2CHIA 1OTKA 3SHXA 4ETRA 2V2PA 4DYXA 3PVTB 2Z5RA 3PVRB 1FHAA 1QGHA 4DZ0A 2JD80 4ZTTA 5D8PA 5J93A 2V15A 3KA8A 1LKPA 5ERJA 5FFCA 2C2JA 4LYUA 1SOFA 2W0OA 2F7NA 2HR5A 5JACA 3ISFA 2CHPA 4RC7B 4TOAA 5ERKA 3R2OA 1KRQA 3VNXA 3KA3A 2CF7A 4M34A 3O7RA 4LPMA 2YJKA 4DE6A 3IS8A 1BG7A 2V2MA 1DVBA 4OYNA 4ZMCA 2CIHA 3E6RA 2XJMA 5LG2A 1L8IA 1TJOA 1JI4A 2BKCA 3T9JA 3WVVA 4ZJKA 2FJCA 4II4B 4LQNA 5LBHA 5GU1X 1Z4AA 3KA6A 3NOZX 3QHCA 1JI5A 1L8HA 2ZG7X 1QYBA 3E1NA 5FFDA 3RE7A 3HIUA 5CMQA 4ITWA 3F33A 2V2OA 2ZA6A 3F38A 2ITBA 2HTNA 2YW6A 3PVYA 3QD8A 5D8QA 4RC6B 4XGSA 1YV1A 4TOEA 3F32A 5GN8B 4M35A 4IWKA 2ZG9X 2C6RA 5HQOA 5HJFA 2ZURX 2V2NA 3H7GA 3R2RA 3PVRA 4Z3BA 1VEIA 3PW8A 3F35A 3Q4RA 3Q4NA 2WLAA 2X170 4R42A 3PWQC 2JD60 2XJOA 2Y3QA 2XKQA 1VELA 2IY4A 2V2JA 5D8YA 4CVRA 3PW8C 3BT5A 4CVTA 1YUZA 3UOIA 4MUDA 1JIGA 3E2CA 4TO9A 2GYQA 2CN6A 4RC7A 3F34A 3RD0A 1DATA 1RCGA 3A68A 3WNWA 4A25A 4XKTA 2PYBA 4ISMA 4LPJA 5JKMG 1H96A 1S30A 4RC8A 3R2KA 5D8SA 2WTLA 5GU2X 4CVPA 3SIDA 4ZKXA 4CMYV 3BVFA 1F33A 5LG8A 1S2ZA 3R2MA 3PW1B 1EUMA 2FZFA 4KVQA 1RCIA 4EVDA 1NF6A 3MPSA 2VXIA 4LQJA 1RCDA 3KX9A 4XKUA 2C2FA 4TOFA 2UX1A 5J9VA 3EZ0A 3NP2X 2V2SA 3EGMA 3EZUA 4DYYA 1YUXA 5FFEA 2CLBA 2V2IA 4PG0A 4REUA 2WLUA 3Q4OA 3AF8X 2QF9A 4ERUA 4IXKA 4Y08A 2GS4A 2CEIA 4ISPA 1SQ3A 5E2DA 1JKUA 3WVUA 1Z6OM 3E1JA 2Z5PA 5C6FA 1JGCA 4RC6A 5GN8A 5D8OA 3RGDA 3AJPA 1JTSA 1DPSA 1JKVA 2FL0A 5JKLG 3GHQA 4U3GA 4TOBA 1B71A 3ERZA 4MN9A 4ML5A 1LB3A 3FVBA 4RC5A 4ZLWA 4KVSA 4LQVA 1O9IA 3BVEA 4TOHA 3QZ3A 1F30A 4ZL6A 1ZUJA 1VJXA 2VZBA 2FKZA 2VXXA 5E1UA 4EVEA 1S3QA 4PG1A 1VLGA 3SE1A 2YW7A 3U90A 4MKUA 1AEWA 5FEJA 1O9RA 3PVTA 5FFBA 2ZA7A 3E1OA 2CLUA 4CYAA 1JYBA 1J30A 1LKMA 4KVRA 1GWGA 1MOJA 3UOFA 3E1MA 3TA8A 2ZG8X 1IERA 3RBCA 4TOCA 5K52A 4TODA 1ZS3A 3BVLA 5GU0X 4TW3A 1VEQA 3KA4A 4DASA 2JD70 3A9QA 4CMYA 1UVHA 3PW1A 2XGWA 2V2RA 4TOGA 4AM2A 5IX6A 1XZ1A 2FG4A 5FFAA 5JKMA 2ZA8A 5HJHA 3RAVA 3GE4A 4LYXA 5GU3X 1BCFA 3Q4QA 1TKPA 5J8WA 3E1PA 4IWJA 2IU2A 4ZL5A 3FI6A 1UMNA 2Z90A 3BVKA 4ZKWA 2BK6A 1LKOA 4AM5A 3KA9A 4Z5SA 2FFXJ 3E6SA 3R2HA 4M33A 3R2SA 3HL1A 1RYTA 3IS7A 2OH3A 4LPNA 4M32A 3NP0X 2BW1A 1N1QA 2FHAA 4II4A 1XZ3A 3QB9A 4EVBA 5LS9A 3FSEA 4DI0A 2G4HA 4LQHA 4P18A 1RCEA 3KXUA 3O7SA 3E1QA 3BKNA 2C2UA 4CY9A 4MY7A 5D8XA 3ES3A 5I4JA 3E1LA 5K53A 4DYUA 3F39A 4CVSA 2GYDA 3WVWA 3IQ1A 5JKLA 3R2LA 3F37A 2C41A 3BVIA 4QUWA 3AJOA 4XKSA 3AK9A 4CYBA 3PZAA 3SH6A
chains in the Genus database with same CATH superfamily
3UNOA 3GVYA 3AJQA 3C1YA 1TKOA 4E6KA 1JREA 3AF7X 4W4LB 5GOUA 3ISEA 2V2LA 4AM4A 2RBDA 1NFVA 2FG8A 2IB0A 3F36A 1R03A 4YKHA 3OGHA 4PGKA 1Z6OA 3OJ5A 2XJNA 1RCCA 3AK8A 2CN7A 1NNQA 1MFRA 4DYZA 5CMRA 1IESA 1BFRA 1NF4A 2Z6MA 5J8SA 3PWQA 4KXRB 2D5KA 2YJJA 4ITTA 4RC5B 2BJYA 3PVYB 3QHBA 3AF9X 3QVDA 2OC5A 1TK6A 1HRSA 3PWFA 4MJYA 4PGIA 2QQYA 5CZUA 2Z5QA 4EVCA 5AXSA 5D8RA 3KWOA 3LKDA 4ZKHA 2CHIA 1OTKA 2Y44A 3SHXA 4ETRA 2V2PA 4DYXA 3PVTB 2Z5RA 3PVRB 1FHAA 1QGHA 4DZ0A 2JD80 4ZTTA 5D8PA 5J93A 2V15A 5JDOA 3KA8A 1LKPA 5ERJA 5FFCA 2C2JA 4LYUA 1SOFA 2W0OA 2F7NA 2HR5A 5JACA 3C23A 3UFBA 3ISFA 2CHPA 4RC7B 4TOAA 5ERKA 3R2OA 1KRQA 3VNXA 3KA3A 2CF7A 4M34A 3O7RA 4LPMA 2YJKA 4DE6A 3C21A 2N02A 3IS8A 1BG7A 2V2MA 1DVBA 4OYNA 4ZMCA 2CIHA 3W54A 3E6RA 2XJMA 5LG2A 1L8IA 1TJOA 1JI4A 4E40A 2BKCA 3T9JA 3WVVA 4ZJKA 2FJCA 4II4B 4LQNA 5LBHA 5GU1X 1Z4AA 3KA6A 3NOZX 3QHCA 1JI5A 1L8HA 2ZG7X 1QYBA 3E1NA 5FFDA 3RE7A 3VVAA 3HIUA 5CMQA 4ITWA 3F33A 2V2OA 2ZA6A 3F38A 2ITBA 2HTNA 2YW6A 3PVYA 3QD8A 5D8QA 4RC6B 4XGSA 1YV1A 4TOEA 3F32A 5GN8B 4M35A 4IWKA 2ZG9X 2C6RA 5HQOA 5HJFA 2ZURX 3D19A 2V2NA 3H7GA 3R2RA 3PVRA 4Z3BA 1VEIA 3PW8A 3F35A 3Q4RA 3Q4NA 2WLAA 2X170 4R42A 3PWQC 2JD60 2XJOA 2Y3QA 2XKQA 1VELA 2IY4A 2V2JA 3JZ9A 5D8YA 4CVRA 3PW8C 3BT5A 4CVTA 1YUZA 3UOIA 4MUDA 3KHKA 1JIGA 3E2CA 4TO9A 2GYQA 2CN6A 4RC7A 3F34A 3GGZA 3RD0A 1DATA 2V8UA 1RCGA 3A68A 3WNWA 4A25A 4XKTA 2PYBA 4ISMA 4LPJA 5JKMG 1H96A 1S30A 4RC8A 3R2KA 5D8SA 5HU6D 2WTLA 5GU2X 4CVPA 3SIDA 2V8TA 4ZKXA 4CMYV 3BVFA 3FRRA 1F33A 5LG8A 1S2ZA 3R2MA 3PW1B 1EUMA 2FZFA 4KVQA 1RCIA 4EVDA 1NF6A 3MPSA 2VXIA 4LQJA 1RCDA 3KX9A 4XKUA 4WJG4 2C2FA 4TOFA 2UX1A 5J9VA 3EZ0A 4YXJA 3NP2X 2V2SA 3EGMA 3EZUA 4DYYA 1YUXA 5FFEA 2CLBA 2V2IA 4PG0A 4REUA 2WLUA 3Q4OA 3AF8X 2QF9A 4ERUA 4IXKA 4Y08A 2GS4A 2CEIA 4ISPA 1SQ3A 5E2DA 1JKUA 3WVUA 1Z6OM 3E1JA 2Z5PA 5C6FA 1JGCA 4RC6A 2WWXB 5GN8A 5D8OA 3RGDA 3AJPA 1JTSA 1DPSA 1JKVA 2FL0A 5JKLG 3GHQA 4U3GA 4TOBA 1B71A 3ERZA 4MN9A 3JZAB 3M6JA 4ML5A 1LB3A 3FVBA 4RC5A 4ZLWA 4KVSA 4LQVA 1O9IA 3N6OA 3BVEA 4TOHA 3QZ3A 1F30A 4ZL6A 1ZUJA 1VJXA 2VZBA 2FKZA 2VXXA 5E1UA 4EVEA 3V3KB 1S3QA 4PG1A 1VLGA 3SE1A 2YW7A 3U90A 4W4KB 4MKUA 1AEWA 5FEJA 1O9RA 3PVTA 5FFBA 2ZA7A 3E1OA 2CLUA 4CYAA 1JYBA 4YXMA 1J30A 1LKMA 4KVRA 1GWGA 3FRSA 1MOJA 3UOFA 3E1MA 3L0MA 2ZG8X 3TA8A 1IERA 2MGYA 3KDQA 4TOCA 3RBCA 5K52A 4TODA 1ZS3A 3BVLA 5GU0X 4TW3A 1VEQA 3KA4A 2AR0A 4DASA 2JD70 3A9QA 4CMYA 1UVHA 4YVZA 3PW1A 2XGWA 2V2RA 4TOGA 4AM2A 5IX6A 1XZ1A 2FG4A 5FFAA 5JKMA 2ZA8A 5HJHA 3C1ZA 3RAVA 4X0JA 2G38B 3GE4A 4LYXA 5GU3X 1BCFA 3Q4QA 1TKPA 3DBYA 5J8WA 3E1PA 4IWJA 2IU2A 4MXPA 4ZL5A 3FI6A 1UMNA 2Z90A 3BVKA 4ZKWA 2BK6A 1LKOA 4AM5A 3KA9A 4Z5SA 2FFXJ 3E6SA 3R2HA 4M33A 3R2SA 3HL1A 1RYTA 3IS7A 2OH3A 4LPNA 4M32A 3NP0X 2BW1A 1N1QA 2FHAA 4II4A 1XZ3A 3QB9A 4EVBA 5LS9A 3FSEA 4DI0A 2G4HA 3VV9A 4LQHA 4P18A 5JDOB 1RCEA 3KXUA 3O7SA 3E1QA 3BKNA 2C2UA 4CY9A 4MY7A 3GGYA 5D8XA 2OKCA 3ES3A 5I4JA 3E1LA 2CWLA 5K53A 4DYUA 3F39A 4CVSA 2GYDA 3WVWA 3IQ1A 5JKLA 3R2LA 3F37A 2C41A 3BVIA 4QUWA 3AJOA 4XKSA 3AK9A 4CYBA 3PZAA 3SH6A
chains in the Genus database with same CATH topology
3UNOA 3GVYA 3AJQA 3C1YA 1TKOA 4E6KA 1JREA 3AF7X 4W4LB 5GOUA 3ISEA 2V2LA 4AM4A 2RBDA 1NFVA 2FG8A 2IB0A 3F36A 1R03A 4YKHA 3OGHA 4PGKA 1Z6OA 3OJ5A 2XJNA 1RCCA 3AK8A 2CN7A 1NNQA 1MFRA 4DYZA 5CMRA 1IESA 1BFRA 1NF4A 2Z6MA 5J8SA 3PWQA 4KXRB 2D5KA 2YJJA 4ITTA 4RC5B 2BJYA 3PVYB 3QHBA 3AF9X 3QVDA 2OC5A 1TK6A 1HRSA 3PWFA 4MJYA 4PGIA 2QQYA 5CZUA 2Z5QA 4EVCA 5AXSA 5D8RA 3KWOA 3LKDA 4ZKHA 2CHIA 1OTKA 2Y44A 3SHXA 4ETRA 2V2PA 4DYXA 3PVTB 2Z5RA 3PVRB 1FHAA 1QGHA 4DZ0A 2JD80 4ZTTA 5D8PA 5J93A 2V15A 5JDOA 3KA8A 1LKPA 5ERJA 5FFCA 2C2JA 4LYUA 1SOFA 2W0OA 2F7NA 2HR5A 5JACA 3C23A 3UFBA 3ISFA 2CHPA 4RC7B 4TOAA 5ERKA 3R2OA 1KRQA 3VNXA 3KA3A 2CF7A 4M34A 3O7RA 4LPMA 2YJKA 4DE6A 3C21A 2N02A 3IS8A 1BG7A 2V2MA 1DVBA 4OYNA 4ZMCA 2CIHA 3W54A 3E6RA 2XJMA 5LG2A 1L8IA 1TJOA 1JI4A 4E40A 2BKCA 3T9JA 3WVVA 4ZJKA 2FJCA 4II4B 4LQNA 5LBHA 5GU1X 1Z4AA 3KA6A 3NOZX 3QHCA 1JI5A 1L8HA 2ZG7X 1QYBA 3E1NA 5FFDA 3RE7A 3VVAA 3HIUA 5CMQA 4ITWA 3F33A 2V2OA 2ZA6A 3F38A 2ITBA 2HTNA 2YW6A 3PVYA 3QD8A 5D8QA 4RC6B 4XGSA 1YV1A 4TOEA 3F32A 5GN8B 4M35A 4IWKA 2ZG9X 2C6RA 5HQOA 5HJFA 2ZURX 3D19A 2V2NA 3H7GA 3R2RA 3PVRA 4Z3BA 1VEIA 3PW8A 3F35A 3Q4RA 3Q4NA 2WLAA 2X170 4R42A 3PWQC 2JD60 2XJOA 2Y3QA 2XKQA 1VELA 2IY4A 2V2JA 3JZ9A 5D8YA 4CVRA 3PW8C 3BT5A 4CVTA 1YUZA 3UOIA 4MUDA 3KHKA 1JIGA 3E2CA 4TO9A 2GYQA 2CN6A 4RC7A 3F34A 3GGZA 3RD0A 1DATA 2V8UA 1RCGA 3A68A 3WNWA 4A25A 4XKTA 2PYBA 4ISMA 4LPJA 5JKMG 1H96A 1S30A 4RC8A 3R2KA 5D8SA 5HU6D 2WTLA 5GU2X 4CVPA 3SIDA 2V8TA 4ZKXA 4CMYV 3BVFA 3FRRA 1F33A 5LG8A 1S2ZA 3R2MA 3PW1B 1EUMA 2FZFA 4KVQA 1RCIA 4EVDA 1NF6A 3MPSA 2VXIA 4LQJA 1RCDA 3KX9A 4XKUA 4WJG4 2C2FA 4TOFA 2UX1A 5J9VA 3EZ0A 4YXJA 3NP2X 2V2SA 3EGMA 3EZUA 4DYYA 1YUXA 5FFEA 2CLBA 2V2IA 4PG0A 4REUA 2WLUA 3Q4OA 3AF8X 2QF9A 4ERUA 4IXKA 4Y08A 2GS4A 2CEIA 4ISPA 1SQ3A 5E2DA 1JKUA 3WVUA 1Z6OM 3E1JA 2Z5PA 5C6FA 1JGCA 4RC6A 2WWXB 5GN8A 5D8OA 3RGDA 3AJPA 1JTSA 1DPSA 1JKVA 2FL0A 5JKLG 3GHQA 4U3GA 4TOBA 1B71A 3ERZA 4MN9A 3JZAB 3M6JA 4ML5A 1LB3A 3FVBA 4RC5A 4ZLWA 4KVSA 4LQVA 1O9IA 3N6OA 3BVEA 4TOHA 3QZ3A 1F30A 4ZL6A 1ZUJA 1VJXA 2VZBA 2FKZA 2VXXA 5E1UA 4EVEA 3V3KB 1S3QA 4PG1A 1VLGA 3SE1A 2YW7A 3U90A 4W4KB 4MKUA 1AEWA 5FEJA 1O9RA 3PVTA 5FFBA 2ZA7A 3E1OA 2CLUA 4CYAA 1JYBA 4YXMA 1J30A 1LKMA 4KVRA 1GWGA 3FRSA 1MOJA 3UOFA 3E1MA 3L0MA 2ZG8X 3TA8A 1IERA 2MGYA 3KDQA 4TOCA 3RBCA 5K52A 4TODA 1ZS3A 3BVLA 5GU0X 4TW3A 1VEQA 3KA4A 2AR0A 4DASA 2JD70 3A9QA 4CMYA 1UVHA 4YVZA 3PW1A 2XGWA 2V2RA 4TOGA 4AM2A 5IX6A 1XZ1A 2FG4A 5FFAA 5JKMA 2ZA8A 5HJHA 3C1ZA 3RAVA 4X0JA 2G38B 3GE4A 4LYXA 5GU3X 1BCFA 3Q4QA 1TKPA 3DBYA 5J8WA 3E1PA 4IWJA 2IU2A 4MXPA 4ZL5A 3FI6A 1UMNA 2Z90A 3BVKA 4ZKWA 2BK6A 1LKOA 4AM5A 3KA9A 4Z5SA 2FFXJ 3E6SA 3R2HA 4M33A 3R2SA 3HL1A 1RYTA 3IS7A 2OH3A 4LPNA 4M32A 3NP0X 2BW1A 1N1QA 2FHAA 4II4A 1XZ3A 3QB9A 4EVBA 5LS9A 3FSEA 4DI0A 2G4HA 3VV9A 4LQHA 4P18A 5JDOB 1RCEA 3KXUA 3O7SA 3E1QA 3BKNA 2C2UA 4CY9A 4MY7A 3GGYA 5D8XA 2OKCA 3ES3A 5I4JA 3E1LA 2CWLA 5K53A 4DYUA 3F39A 4CVSA 2GYDA 3WVWA 3IQ1A 5JKLA 3R2LA 3F37A 2C41A 3BVIA 4QUWA 3AJOA 4XKSA 3AK9A 4CYBA 3PZAA 3SH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UNO A;  3GVY A;  3AJQ A;  1TKO A;  4E6K A;  1JRE A;  3AF7 X;  5GOU A;  3ISE A;  2V2L A;  4AM4 A;  2RBD A;  1NFV A;  2FG8 A;  2IB0 A;  3F36 A;  1R03 A;  4YKH A;  3OGH A;  4PGK A;  1Z6O A;  3OJ5 A;  2XJN A;  1RCC A;  3AK8 A;  2CN7 A;  1NNQ A;  1MFR A;  4DYZ A;  5CMR A;  1IES A;  1BFR A;  1NF4 A;  2Z6M A;  5J8S A;  3PWQ A;  2D5K A;  2YJJ A;  4ITT A;  4RC5 B;  2BJY A;  3PVY B;  3QHB A;  3AF9 X;  3QVD A;  2OC5 A;  1TK6 A;  1HRS A;  3PWF A;  4MJY A;  4PGI A;  2QQY A;  5CZU A;  2Z5Q A;  4EVC A;  5AXS A;  5D8R A;  3KWO A;  4ZKH A;  2CHI A;  1OTK A;  3SHX A;  4ETR A;  2V2P A;  4DYX A;  3PVT B;  2Z5R A;  3PVR B;  1FHA A;  1QGH A;  4DZ0 A;  2JD8 0;  4ZTT A;  5D8P A;  5J93 A;  2V15 A;  3KA8 A;  1LKP A;  5ERJ A;  5FFC A;  2C2J A;  4LYU A;  1SOF A;  2W0O A;  2F7N A;  2HR5 A;  5JAC A;  3ISF A;  2CHP A;  4RC7 B;  4TOA A;  5ERK A;  3R2O A;  1KRQ A;  3VNX A;  3KA3 A;  2CF7 A;  4M34 A;  3O7R A;  4LPM A;  2YJK A;  4DE6 A;  3IS8 A;  1BG7 A;  2V2M A;  1DVB A;  4OYN A;  4ZMC A;  2CIH A;  3E6R A;  2XJM A;  5LG2 A;  1L8I A;  1TJO A;  1JI4 A;  2BKC A;  3T9J A;  3WVV A;  4ZJK A;  2FJC A;  4II4 B;  4LQN A;  5LBH A;  5GU1 X;  1Z4A A;  3KA6 A;  3NOZ X;  3QHC A;  1JI5 A;  1L8H A;  2ZG7 X;  1QYB A;  3E1N A;  5FFD A;  3RE7 A;  3HIU A;  5CMQ A;  4ITW A;  3F33 A;  2V2O A;  2ZA6 A;  3F38 A;  2ITB A;  2HTN A;  2YW6 A;  3PVY A;  3QD8 A;  5D8Q A;  4RC6 B;  4XGS A;  1YV1 A;  4TOE A;  3F32 A;  5GN8 B;  4M35 A;  4IWK A;  2ZG9 X;  2C6R A;  5HQO A;  5HJF A;  2ZUR X;  2V2N A;  3H7G A;  3R2R A;  3PVR A;  4Z3B A;  1VEI A;  3PW8 A;  3F35 A;  3Q4R A;  3Q4N A;  2WLA A;  2X17 0;  4R42 A;  3PWQ C;  2JD6 0;  2XJO A;  2Y3Q A;  2XKQ A;  1VEL A;  2IY4 A;  2V2J A;  5D8Y A;  4CVR A;  3PW8 C;  3BT5 A;  4CVT A;  1YUZ A;  3UOI A;  4MUD A;  1JIG A;  3E2C A;  4TO9 A;  2GYQ A;  2CN6 A;  4RC7 A;  3F34 A;  3RD0 A;  1DAT A;  1RCG A;  3A68 A;  3WNW A;  4A25 A;  4XKT A;  2PYB A;  4ISM A;  4LPJ A;  5JKM G;  1H96 A;  1S30 A;  4RC8 A;  3R2K A;  5D8S A;  2WTL A;  5GU2 X;  4CVP A;  3SID A;  4ZKX A;  4CMY V;  3BVF A;  1F33 A;  5LG8 A;  1S2Z A;  3R2M A;  3PW1 B;  1EUM A;  2FZF A;  4KVQ A;  1RCI A;  4EVD A;  1NF6 A;  3MPS A;  2VXI A;  4LQJ A;  1RCD A;  3KX9 A;  4XKU A;  2C2F A;  4TOF A;  2UX1 A;  5J9V A;  3EZ0 A;  3NP2 X;  2V2S A;  3EGM A;  3EZU A;  4DYY A;  1YUX A;  5FFE A;  2CLB A;  2V2I A;  4PG0 A;  4REU A;  2WLU A;  3Q4O A;  3AF8 X;  2QF9 A;  4ERU A;  4IXK A;  4Y08 A;  2GS4 A;  2CEI A;  4ISP A;  1SQ3 A;  5E2D A;  1JKU A;  3WVU A;  1Z6O M;  3E1J A;  2Z5P A;  5C6F A;  1JGC A;  4RC6 A;  5GN8 A;  5D8O A;  3RGD A;  3AJP A;  1JTS A;  1DPS A;  1JKV A;  2FL0 A;  5JKL G;  3GHQ A;  4U3G A;  4TOB A;  1B71 A;  3ERZ A;  4MN9 A;  4ML5 A;  1LB3 A;  3FVB A;  4RC5 A;  4ZLW A;  4KVS A;  4LQV A;  1O9I A;  3BVE A;  4TOH A;  3QZ3 A;  1F30 A;  4ZL6 A;  1ZUJ A;  1VJX A;  2VZB A;  2FKZ A;  2VXX A;  5E1U A;  4EVE A;  1S3Q A;  4PG1 A;  1VLG A;  3SE1 A;  2YW7 A;  3U90 A;  4MKU A;  1AEW A;  5FEJ A;  1O9R A;  3PVT A;  5FFB A;  2ZA7 A;  3E1O A;  2CLU A;  4CYA A;  1JYB A;  1J30 A;  1LKM A;  4KVR A;  1GWG A;  1MOJ A;  3UOF A;  3E1M A;  3TA8 A;  2ZG8 X;  1IER A;  3RBC A;  4TOC A;  5K52 A;  4TOD A;  1ZS3 A;  3BVL A;  5GU0 X;  4TW3 A;  1VEQ A;  3KA4 A;  4DAS A;  2JD7 0;  3A9Q A;  4CMY A;  1UVH A;  3PW1 A;  2XGW A;  2V2R A;  4TOG A;  4AM2 A;  5IX6 A;  1XZ1 A;  2FG4 A;  5FFA A;  5JKM A;  2ZA8 A;  5HJH A;  3RAV A;  3GE4 A;  4LYX A;  5GU3 X;  1BCF A;  3Q4Q A;  1TKP A;  5J8W A;  3E1P A;  4IWJ A;  2IU2 A;  4ZL5 A;  3FI6 A;  1UMN A;  2Z90 A;  3BVK A;  4ZKW A;  2BK6 A;  1LKO A;  4AM5 A;  3KA9 A;  4Z5S A;  2FFX J;  3E6S A;  3R2H A;  4M33 A;  3R2S A;  3HL1 A;  1RYT A;  3IS7 A;  2OH3 A;  4LPN A;  4M32 A;  3NP0 X;  2BW1 A;  1N1Q A;  2FHA A;  4II4 A;  1XZ3 A;  3QB9 A;  4EVB A;  5LS9 A;  3FSE A;  4DI0 A;  2G4H A;  4LQH A;  4P18 A;  1RCE A;  3KXU A;  3O7S A;  3E1Q A;  3BKN A;  2C2U A;  4CY9 A;  4MY7 A;  5D8X A;  3ES3 A;  5I4J A;  3E1L A;  5K53 A;  4DYU A;  3F39 A;  4CVS A;  2GYD A;  3WVW A;  3IQ1 A;  5JKL A;  3R2L A;  3F37 A;  2C41 A;  3BVI A;  4QUW A;  3AJO A;  4XKS A;  3AK9 A;  4CYB A;  3PZA A;  3SH6 A; 
#chains in the Genus database with same CATH topology
 3UNO A;  3GVY A;  3AJQ A;  3C1Y A;  1TKO A;  4E6K A;  1JRE A;  3AF7 X;  4W4L B;  5GOU A;  3ISE A;  2V2L A;  4AM4 A;  2RBD A;  1NFV A;  2FG8 A;  2IB0 A;  3F36 A;  1R03 A;  4YKH A;  3OGH A;  4PGK A;  1Z6O A;  3OJ5 A;  2XJN A;  1RCC A;  3AK8 A;  2CN7 A;  1NNQ A;  1MFR A;  4DYZ A;  5CMR A;  1IES A;  1BFR A;  1NF4 A;  2Z6M A;  5J8S A;  3PWQ A;  4KXR B;  2D5K A;  2YJJ A;  4ITT A;  4RC5 B;  2BJY A;  3PVY B;  3QHB A;  3AF9 X;  3QVD A;  2OC5 A;  1TK6 A;  1HRS A;  3PWF A;  4MJY A;  4PGI A;  2QQY A;  5CZU A;  2Z5Q A;  4EVC A;  5AXS A;  5D8R A;  3KWO A;  3LKD A;  4ZKH A;  2CHI A;  1OTK A;  2Y44 A;  3SHX A;  4ETR A;  2V2P A;  4DYX A;  3PVT B;  2Z5R A;  3PVR B;  1FHA A;  1QGH A;  4DZ0 A;  2JD8 0;  4ZTT A;  5D8P A;  5J93 A;  2V15 A;  5JDO A;  3KA8 A;  1LKP A;  5ERJ A;  5FFC A;  2C2J A;  4LYU A;  1SOF A;  2W0O A;  2F7N A;  2HR5 A;  5JAC A;  3C23 A;  3UFB A;  3ISF A;  2CHP A;  4RC7 B;  4TOA A;  5ERK A;  3R2O A;  1KRQ A;  3VNX A;  3KA3 A;  2CF7 A;  4M34 A;  3O7R A;  4LPM A;  2YJK A;  4DE6 A;  3C21 A;  2N02 A;  3IS8 A;  1BG7 A;  2V2M A;  1DVB A;  4OYN A;  4ZMC A;  2CIH A;  3W54 A;  3E6R A;  2XJM A;  5LG2 A;  1L8I A;  1TJO A;  1JI4 A;  4E40 A;  2BKC A;  3T9J A;  3WVV A;  4ZJK A;  2FJC A;  4II4 B;  4LQN A;  5LBH A;  5GU1 X;  1Z4A A;  3KA6 A;  3NOZ X;  3QHC A;  1JI5 A;  1L8H A;  2ZG7 X;  1QYB A;  3E1N A;  5FFD A;  3RE7 A;  3VVA A;  3HIU A;  5CMQ A;  4ITW A;  3F33 A;  2V2O A;  2ZA6 A;  3F38 A;  2ITB A;  2HTN A;  2YW6 A;  3PVY A;  3QD8 A;  5D8Q A;  4RC6 B;  4XGS A;  1YV1 A;  4TOE A;  3F32 A;  5GN8 B;  4M35 A;  4IWK A;  2ZG9 X;  2C6R A;  5HQO A;  5HJF A;  2ZUR X;  3D19 A;  2V2N A;  3H7G A;  3R2R A;  3PVR A;  4Z3B A;  1VEI A;  3PW8 A;  3F35 A;  3Q4R A;  3Q4N A;  2WLA A;  2X17 0;  4R42 A;  3PWQ C;  2JD6 0;  2XJO A;  2Y3Q A;  2XKQ A;  1VEL A;  2IY4 A;  2V2J A;  3JZ9 A;  5D8Y A;  4CVR A;  3PW8 C;  3BT5 A;  4CVT A;  1YUZ A;  3UOI A;  4MUD A;  3KHK A;  1JIG A;  3E2C A;  4TO9 A;  2GYQ A;  2CN6 A;  4RC7 A;  3F34 A;  3GGZ A;  3RD0 A;  1DAT A;  2V8U A;  1RCG A;  3A68 A;  3WNW A;  4A25 A;  4XKT A;  2PYB A;  4ISM A;  4LPJ A;  5JKM G;  1H96 A;  1S30 A;  4RC8 A;  3R2K A;  5D8S A;  5HU6 D;  2WTL A;  5GU2 X;  4CVP A;  3SID A;  2V8T A;  4ZKX A;  4CMY V;  3BVF A;  3FRR A;  1F33 A;  5LG8 A;  1S2Z A;  3R2M A;  3PW1 B;  1EUM A;  2FZF A;  4KVQ A;  1RCI A;  4EVD A;  1NF6 A;  3MPS A;  2VXI A;  4LQJ A;  1RCD A;  3KX9 A;  4XKU A;  4WJG 4;  2C2F A;  4TOF A;  2UX1 A;  5J9V A;  3EZ0 A;  4YXJ A;  3NP2 X;  2V2S A;  3EGM A;  3EZU A;  4DYY A;  1YUX A;  5FFE A;  2CLB A;  2V2I A;  4PG0 A;  4REU A;  2WLU A;  3Q4O A;  3AF8 X;  2QF9 A;  4ERU A;  4IXK A;  4Y08 A;  2GS4 A;  2CEI A;  4ISP A;  1SQ3 A;  5E2D A;  1JKU A;  3WVU A;  1Z6O M;  3E1J A;  2Z5P A;  5C6F A;  1JGC A;  4RC6 A;  2WWX B;  5GN8 A;  5D8O A;  3RGD A;  3AJP A;  1JTS A;  1DPS A;  1JKV A;  2FL0 A;  5JKL G;  3GHQ A;  4U3G A;  4TOB A;  1B71 A;  3ERZ A;  4MN9 A;  3JZA B;  3M6J A;  4ML5 A;  1LB3 A;  3FVB A;  4RC5 A;  4ZLW A;  4KVS A;  4LQV A;  1O9I A;  3N6O A;  3BVE A;  4TOH A;  3QZ3 A;  1F30 A;  4ZL6 A;  1ZUJ A;  1VJX A;  2VZB A;  2FKZ A;  2VXX A;  5E1U A;  4EVE A;  3V3K B;  1S3Q A;  4PG1 A;  1VLG A;  3SE1 A;  2YW7 A;  3U90 A;  4W4K B;  4MKU A;  1AEW A;  5FEJ A;  1O9R A;  3PVT A;  5FFB A;  2ZA7 A;  3E1O A;  2CLU A;  4CYA A;  1JYB A;  4YXM A;  1J30 A;  1LKM A;  4KVR A;  1GWG A;  3FRS A;  1MOJ A;  3UOF A;  3E1M A;  3L0M A;  2ZG8 X;  3TA8 A;  1IER A;  2MGY A;  3KDQ A;  4TOC A;  3RBC A;  5K52 A;  4TOD A;  1ZS3 A;  3BVL A;  5GU0 X;  4TW3 A;  1VEQ A;  3KA4 A;  2AR0 A;  4DAS A;  2JD7 0;  3A9Q A;  4CMY A;  1UVH A;  4YVZ A;  3PW1 A;  2XGW A;  2V2R A;  4TOG A;  4AM2 A;  5IX6 A;  1XZ1 A;  2FG4 A;  5FFA A;  5JKM A;  2ZA8 A;  5HJH A;  3C1Z A;  3RAV A;  4X0J A;  2G38 B;  3GE4 A;  4LYX A;  5GU3 X;  1BCF A;  3Q4Q A;  1TKP A;  3DBY A;  5J8W A;  3E1P A;  4IWJ A;  2IU2 A;  4MXP A;  4ZL5 A;  3FI6 A;  1UMN A;  2Z90 A;  3BVK A;  4ZKW A;  2BK6 A;  1LKO A;  4AM5 A;  3KA9 A;  4Z5S A;  2FFX J;  3E6S A;  3R2H A;  4M33 A;  3R2S A;  3HL1 A;  1RYT A;  3IS7 A;  2OH3 A;  4LPN A;  4M32 A;  3NP0 X;  2BW1 A;  1N1Q A;  2FHA A;  4II4 A;  1XZ3 A;  3QB9 A;  4EVB A;  5LS9 A;  3FSE A;  4DI0 A;  2G4H A;  3VV9 A;  4LQH A;  4P18 A;  5JDO B;  1RCE A;  3KXU A;  3O7S A;  3E1Q A;  3BKN A;  2C2U A;  4CY9 A;  4MY7 A;  3GGY A;  5D8X A;  2OKC A;  3ES3 A;  5I4J A;  3E1L A;  2CWL A;  5K53 A;  4DYU A;  3F39 A;  4CVS A;  2GYD A;  3WVW A;  3IQ1 A;  5JKL A;  3R2L A;  3F37 A;  2C41 A;  3BVI A;  4QUW A;  3AJO A;  4XKS A;  3AK9 A;  4CYB A;  3PZA A;  3SH6 A; 
#chains in the Genus database with same CATH homology
 3UNO A;  3GVY A;  3AJQ A;  3C1Y A;  1TKO A;  4E6K A;  1JRE A;  3AF7 X;  4W4L B;  5GOU A;  3ISE A;  2V2L A;  4AM4 A;  2RBD A;  1NFV A;  2FG8 A;  2IB0 A;  3F36 A;  1R03 A;  4YKH A;  3OGH A;  4PGK A;  1Z6O A;  3OJ5 A;  2XJN A;  1RCC A;  3AK8 A;  2CN7 A;  1NNQ A;  1MFR A;  4DYZ A;  5CMR A;  1IES A;  1BFR A;  1NF4 A;  2Z6M A;  5J8S A;  3PWQ A;  4KXR B;  2D5K A;  2YJJ A;  4ITT A;  4RC5 B;  2BJY A;  3PVY B;  3QHB A;  3AF9 X;  3QVD A;  2OC5 A;  1TK6 A;  1HRS A;  3PWF A;  4MJY A;  4PGI A;  2QQY A;  5CZU A;  2Z5Q A;  4EVC A;  5AXS A;  5D8R A;  3KWO A;  3LKD A;  4ZKH A;  2CHI A;  1OTK A;  2Y44 A;  3SHX A;  4ETR A;  2V2P A;  4DYX A;  3PVT B;  2Z5R A;  3PVR B;  1FHA A;  1QGH A;  4DZ0 A;  2JD8 0;  4ZTT A;  5D8P A;  5J93 A;  2V15 A;  5JDO A;  3KA8 A;  1LKP A;  5ERJ A;  5FFC A;  2C2J A;  4LYU A;  1SOF A;  2W0O A;  2F7N A;  2HR5 A;  5JAC A;  3C23 A;  3UFB A;  3ISF A;  2CHP A;  4RC7 B;  4TOA A;  5ERK A;  3R2O A;  1KRQ A;  3VNX A;  3KA3 A;  2CF7 A;  4M34 A;  3O7R A;  4LPM A;  2YJK A;  4DE6 A;  3C21 A;  2N02 A;  3IS8 A;  1BG7 A;  2V2M A;  1DVB A;  4OYN A;  4ZMC A;  2CIH A;  3W54 A;  3E6R A;  2XJM A;  5LG2 A;  1L8I A;  1TJO A;  1JI4 A;  4E40 A;  2BKC A;  3T9J A;  3WVV A;  4ZJK A;  2FJC A;  4II4 B;  4LQN A;  5LBH A;  5GU1 X;  1Z4A A;  3KA6 A;  3NOZ X;  3QHC A;  1JI5 A;  1L8H A;  2ZG7 X;  1QYB A;  3E1N A;  5FFD A;  3RE7 A;  3VVA A;  3HIU A;  5CMQ A;  4ITW A;  3F33 A;  2V2O A;  2ZA6 A;  3F38 A;  2ITB A;  2HTN A;  2YW6 A;  3PVY A;  3QD8 A;  5D8Q A;  4RC6 B;  4XGS A;  1YV1 A;  4TOE A;  3F32 A;  5GN8 B;  4M35 A;  4IWK A;  2ZG9 X;  2C6R A;  5HQO A;  5HJF A;  2ZUR X;  3D19 A;  2V2N A;  3H7G A;  3R2R A;  3PVR A;  4Z3B A;  1VEI A;  3PW8 A;  3F35 A;  3Q4R A;  3Q4N A;  2WLA A;  2X17 0;  4R42 A;  3PWQ C;  2JD6 0;  2XJO A;  2Y3Q A;  2XKQ A;  1VEL A;  2IY4 A;  2V2J A;  3JZ9 A;  5D8Y A;  4CVR A;  3PW8 C;  3BT5 A;  4CVT A;  1YUZ A;  3UOI A;  4MUD A;  3KHK A;  1JIG A;  3E2C A;  4TO9 A;  2GYQ A;  2CN6 A;  4RC7 A;  3F34 A;  3GGZ A;  3RD0 A;  1DAT A;  2V8U A;  1RCG A;  3A68 A;  3WNW A;  4A25 A;  4XKT A;  2PYB A;  4ISM A;  4LPJ A;  5JKM G;  1H96 A;  1S30 A;  4RC8 A;  3R2K A;  5D8S A;  5HU6 D;  2WTL A;  5GU2 X;  4CVP A;  3SID A;  2V8T A;  4ZKX A;  4CMY V;  3BVF A;  3FRR A;  1F33 A;  5LG8 A;  1S2Z A;  3R2M A;  3PW1 B;  1EUM A;  2FZF A;  4KVQ A;  1RCI A;  4EVD A;  1NF6 A;  3MPS A;  2VXI A;  4LQJ A;  1RCD A;  3KX9 A;  4XKU A;  4WJG 4;  2C2F A;  4TOF A;  2UX1 A;  5J9V A;  3EZ0 A;  4YXJ A;  3NP2 X;  2V2S A;  3EGM A;  3EZU A;  4DYY A;  1YUX A;  5FFE A;  2CLB A;  2V2I A;  4PG0 A;  4REU A;  2WLU A;  3Q4O A;  3AF8 X;  2QF9 A;  4ERU A;  4IXK A;  4Y08 A;  2GS4 A;  2CEI A;  4ISP A;  1SQ3 A;  5E2D A;  1JKU A;  3WVU A;  1Z6O M;  3E1J A;  2Z5P A;  5C6F A;  1JGC A;  4RC6 A;  2WWX B;  5GN8 A;  5D8O A;  3RGD A;  3AJP A;  1JTS A;  1DPS A;  1JKV A;  2FL0 A;  5JKL G;  3GHQ A;  4U3G A;  4TOB A;  1B71 A;  3ERZ A;  4MN9 A;  3JZA B;  3M6J A;  4ML5 A;  1LB3 A;  3FVB A;  4RC5 A;  4ZLW A;  4KVS A;  4LQV A;  1O9I A;  3N6O A;  3BVE A;  4TOH A;  3QZ3 A;  1F30 A;  4ZL6 A;  1ZUJ A;  1VJX A;  2VZB A;  2FKZ A;  2VXX A;  5E1U A;  4EVE A;  3V3K B;  1S3Q A;  4PG1 A;  1VLG A;  3SE1 A;  2YW7 A;  3U90 A;  4W4K B;  4MKU A;  1AEW A;  5FEJ A;  1O9R A;  3PVT A;  5FFB A;  2ZA7 A;  3E1O A;  2CLU A;  4CYA A;  1JYB A;  4YXM A;  1J30 A;  1LKM A;  4KVR A;  1GWG A;  3FRS A;  1MOJ A;  3UOF A;  3E1M A;  3L0M A;  2ZG8 X;  3TA8 A;  1IER A;  2MGY A;  3KDQ A;  4TOC A;  3RBC A;  5K52 A;  4TOD A;  1ZS3 A;  3BVL A;  5GU0 X;  4TW3 A;  1VEQ A;  3KA4 A;  2AR0 A;  4DAS A;  2JD7 0;  3A9Q A;  4CMY A;  1UVH A;  4YVZ A;  3PW1 A;  2XGW A;  2V2R A;  4TOG A;  4AM2 A;  5IX6 A;  1XZ1 A;  2FG4 A;  5FFA A;  5JKM A;  2ZA8 A;  5HJH A;  3C1Z A;  3RAV A;  4X0J A;  2G38 B;  3GE4 A;  4LYX A;  5GU3 X;  1BCF A;  3Q4Q A;  1TKP A;  3DBY A;  5J8W A;  3E1P A;  4IWJ A;  2IU2 A;  4MXP A;  4ZL5 A;  3FI6 A;  1UMN A;  2Z90 A;  3BVK A;  4ZKW A;  2BK6 A;  1LKO A;  4AM5 A;  3KA9 A;  4Z5S A;  2FFX J;  3E6S A;  3R2H A;  4M33 A;  3R2S A;  3HL1 A;  1RYT A;  3IS7 A;  2OH3 A;  4LPN A;  4M32 A;  3NP0 X;  2BW1 A;  1N1Q A;  2FHA A;  4II4 A;  1XZ3 A;  3QB9 A;  4EVB A;  5LS9 A;  3FSE A;  4DI0 A;  2G4H A;  3VV9 A;  4LQH A;  4P18 A;  5JDO B;  1RCE A;  3KXU A;  3O7S A;  3E1Q A;  3BKN A;  2C2U A;  4CY9 A;  4MY7 A;  3GGY A;  5D8X A;  2OKC A;  3ES3 A;  5I4J A;  3E1L A;  2CWL A;  5K53 A;  4DYU A;  3F39 A;  4CVS A;  2GYD A;  3WVW A;  3IQ1 A;  5JKL A;  3R2L A;  3F37 A;  2C41 A;  3BVI A;  4QUW A;  3AJO A;  4XKS A;  3AK9 A;  4CYB A;  3PZA A;  3SH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...