4XKSA

E. coli bfr variant y45f
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
157
structure length
157
Chain Sequence
MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEFHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDWLETELDLIQKMGLQNYLQAQIREE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterioferritin
publication title Three Aromatic Residues are Required for Electron Transfer during Iron Mineralization in Bacterioferritin.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Oxidoreductase
total genus 75
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2015-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4xksA00
4PGKA 4AM4A 4CVTA 4LQJA 2PYBA 3O7RA 4KVSA 1L8HA 2C41A 2OH3A 2XGWA 4EVCA 3PW8C 4DYUA 2V2PA 2CN7A 3OGHA 4EVDA 1RCDA 5J93A 4DYXA 4RC7B 3R2KA 2C2JA 3TA8A 3QD8A 4XGSA 4RC6B 2FJCA 2IU2A 4TODA 2X170 3AJPA 5D8YA 2GS4A 3F32A 1JREA 4II4B 3IQ1A 3ISFA 3R2OA 3BVKA 3SIDA 5D8QA 2V2RA 1VEQA 2V2JA 4IWJA 1OTKA 4ZKWA 3RAVA 2WLUA 3F38A 4M35A 4E6KA 3U90A 3EGMA 4CVPA 5HQOA 5CMRA 1VELA 3BVIA 1JGCA 4LYXA 2VXXA 2ZA7A 4ZTTA 2ZG8X 4LQVA 4ITWA 2FKZA 4ISPA 3PWQA 3MPSA 5K52A 5LS9A 1TK6A 3WNWA 2BJYA 3PVRA 5AXSA 4PGIA 3QVDA 4LQNA 2GYDA 1H96A 3PWFA 2YJJA 4R42A 1IERA 5ERJA 1MOJA 3WVWA 2FL0A 3AK8A 4ML5A 1RYTA 3Q4NA 5GU0X 3ISEA 4ITTA 3SHXA 3NOZX 5FFBA 3UNOA 1S2ZA 1O9RA 3PVYA 3F36A 4KVRA 4AM2A 3E1QA 3PVRB 5D8RA 3GVYA 3PWQC 3A68A 1VLGA 4Z5SA 3NP2X 5ERKA 1TJOA 4PG1A 4TOEA 3VNXA 2C2UA 3IS7A 5CZUA 4IWKA 4CYBA 5D8SA 4EVEA 4OYNA 1RCCA 4TOGA 2Z5QA 2FZFA 2YW6A 1JKVA 3R2RA 3AJOA 4ZLWA 3RD0A 3F34A 2QQYA 4RC8A 1JIGA 5FFAA 2ZA8A 2HR5A 3F35A 2C2FA 1QGHA 1BCFA 3E1MA 2D5KA 3E6RA 3E1NA 2OC5A 2V2OA 4ZJKA 4CMYV 3ES3A 5CMQA 3E1LA 4MY7A 4ZMCA 4CVRA 5J8WA 3KA9A 3OJ5A 1UMNA 3QZ3A 3E1PA 4CY9A 3NP0X 3HL1A 4ISMA 4ETRA 2V2SA 5GU1X 1QYBA 1LKMA 3E1OA 4EVBA 1TKPA 2IB0A 3T9JA 4DYZA 1KRQA 1RCEA 3Q4OA 5D8PA 3BKNA 1L8IA 2CF7A 2F7NA 5JKLG 3EZUA 1UVHA 5C6FA 2CEIA 1YV1A 3WVVA 5JKMG 5JACA 1ZUJA 1LB3A 3SH6A 4MJYA 5LBHA 2G4HA 4ZL6A 1TKOA 5IX6A 1AEWA 4LQHA 4M34A 1EUMA 2CHIA 3R2SA 1BG7A 3KA8A 3AJQA 3E1JA 2VXIA 3FI6A 3FVBA 3PZAA 2BW1A 3RGDA 2ZURX 1DPSA 2FFXJ 1F33A 1SOFA 3F37A 5D8OA 2JD60 2BK6A 1NF4A 3O7SA 1NNQA 3QHBA 1F30A 4ERUA 4MN9A 5K53A 1O9IA 3AF7X 3PW8A 1Z4AA 4M32A 2FG8A 2V2LA 3GE4A 3F39A 4YKHA 5FFDA 3FSEA 1N1QA 2WTLA 2Z90A 3UOIA 5E2DA 2V15A 1JI4A 2CLUA 2XJMA 2RBDA 3PVYB 4Z3BA 5GOUA 5J9VA 2VZBA 4A25A 4XKSA 2QF9A 4CVSA 2V2IA 4ZL5A 4II4A 4ZKXA 1YUZA 2UX1A 2WLAA 4LYUA 3EZ0A 1SQ3A 3BVFA 4M33A 3AF8X 3KXUA 5GU3X 5LG2A 2XKQA 4PG0A 3QHCA 3KA3A 1XZ3A 3F33A 1RCIA 2ITBA 1NF6A 4XKTA 1YUXA 2C6RA 3A9QA 4CYAA 1MFRA 2XJOA 1S30A 1JI5A 4DE6A 2JD80 4CMYA 2V2MA 1GWGA 5LG8A 5J8SA 2FHAA 4LPNA 4RC5A 2HTNA 3R2LA 2Z5PA 3E2CA 2GYQA 4DZ0A 1FHAA 1HRSA 3E6SA 2CHPA 2YW7A 4XKUA 2CN6A 1R03A 3BVLA 1VEIA 3GHQA 1JYBA 4IXKA 2V2NA 5E1UA 5HJHA 1NFVA 3AF9X 2BKCA 5FFCA 2Z6MA 3UOFA 4MKUA 3PVTA 2XJNA 5HJFA 1JTSA 3KX9A 5FEJA 3R2MA 1LKPA 4TO9A 1J30A 5GN8A 1XZ1A 3IS8A 1DVBA 4U3GA 2JD70 4TOHA 3AK9A 4TOAA 1B71A 1VJXA 2W0OA 4RC5B 2CIHA 4DASA 4DI0A 3SE1A 5JKLA 3BT5A 1RCGA 2Y3QA 4TW3A 2CLBA 2YJKA 3KA6A 3PVTB 3PW1A 5GU2X 5JKMA 1ZS3A 4LPJA 3QB9A 3KA4A 5GN8B 4ZKHA 1Z6OM 3HIUA 4TOBA 1DATA 4Y08A 2ZG7X 1Z6OA 4REUA 2IY4A 2Z5RA 3Q4RA 3R2HA 4QUWA 1JKUA 5I4JA 4AM5A 3H7GA 3Q4QA 3WVUA 4RC7A 1LKOA 4TOFA 4P18A 3RBCA 5FFEA 4RC6A 4DYYA 2ZA6A 4MUDA 4TOCA 3PW1B 3RE7A 1IESA 4KVQA 1S3QA 2ZG9X 1BFRA 2FG4A 3KWOA 4LPMA 3BVEA 5D8XA 3ERZA
chains in the Genus database with same CATH superfamily
4PGKA 4AM4A 4CVTA 4LQJA 2PYBA 3O7RA 4KVSA 1L8HA 2C41A 2OH3A 2XGWA 4EVCA 3PW8C 4DYUA 2V2PA 2CN7A 3OGHA 4EVDA 1RCDA 5J93A 4DYXA 4RC7B 3R2KA 2C2JA 3TA8A 3QD8A 4XGSA 4RC6B 2FJCA 2IU2A 4TODA 2X170 3M6JA 4YXJA 3AJPA 5D8YA 2GS4A 3F32A 1JREA 4II4B 3IQ1A 3ISFA 3R2OA 3BVKA 3SIDA 5D8QA 4KXRB 3JZAB 3D19A 2V2RA 3C1ZA 1VEQA 2V2JA 4IWJA 1OTKA 4ZKWA 3RAVA 2G38B 2Y44A 2WLUA 4X0JA 3F38A 4M35A 4E6KA 3U90A 3EGMA 4CVPA 5HQOA 5CMRA 1VELA 3BVIA 1JGCA 4LYXA 2VXXA 2ZA7A 4ZTTA 2ZG8X 4LQVA 4ITWA 2FKZA 4ISPA 3PWQA 3MPSA 5K52A 5LS9A 1TK6A 3WNWA 3N6OA 2BJYA 2V8UA 3PVRA 5AXSA 4PGIA 3QVDA 4LQNA 2GYDA 4YVZA 3VVAA 1H96A 2V8TA 3PWFA 2YJJA 4R42A 1IERA 3FRRA 5ERJA 1MOJA 3WVWA 2FL0A 3AK8A 4ML5A 1RYTA 3Q4NA 5GU0X 3ISEA 4ITTA 3SHXA 3NOZX 5FFBA 3UNOA 1S2ZA 1O9RA 3PVYA 2OKCA 3F36A 4KVRA 2AR0A 5HU6D 4AM2A 3E1QA 3PVRB 5D8RA 3GVYA 3PWQC 3A68A 1VLGA 4Z5SA 3NP2X 5ERKA 1TJOA 4E40A 4PG1A 4TOEA 3VNXA 2C2UA 3IS7A 5CZUA 4IWKA 4CYBA 4WJG4 5D8SA 4EVEA 4OYNA 1RCCA 4TOGA 2Z5QA 2FZFA 2YW6A 1JKVA 3R2RA 3AJOA 4ZLWA 3RD0A 3F34A 2QQYA 4RC8A 1JIGA 5FFAA 2ZA8A 2HR5A 3F35A 2C2FA 1QGHA 1BCFA 3E1MA 2D5KA 3E6RA 3E1NA 2OC5A 2V2OA 4ZJKA 4CMYV 3ES3A 3GGYA 5CMQA 3E1LA 4MY7A 4ZMCA 4CVRA 5J8WA 3KA9A 3OJ5A 1UMNA 3KHKA 3QZ3A 3E1PA 4CY9A 3NP0X 3HL1A 4ISMA 4ETRA 2V2SA 5GU1X 1QYBA 1LKMA 3E1OA 4YXMA 4EVBA 1TKPA 2IB0A 3T9JA 4DYZA 3C1YA 1KRQA 3UFBA 1RCEA 3Q4OA 5D8PA 3BKNA 1L8IA 2CF7A 2F7NA 5JKLG 3EZUA 1UVHA 3C23A 5C6FA 2CEIA 1YV1A 3WVVA 3VV9A 5JKMG 5JACA 3JZ9A 1ZUJA 1LB3A 3SH6A 4MJYA 5LBHA 2G4HA 4ZL6A 1TKOA 3KDQA 5IX6A 1AEWA 4LQHA 4M34A 1EUMA 2CHIA 3R2SA 1BG7A 3KA8A 3AJQA 3E1JA 2VXIA 3FI6A 4W4KB 3FVBA 3PZAA 2BW1A 3RGDA 3W54A 2ZURX 3LKDA 1DPSA 2FFXJ 1F33A 1SOFA 3F37A 5D8OA 2JD60 2BK6A 1NF4A 3O7SA 1NNQA 3QHBA 1F30A 4ERUA 4MN9A 5K53A 1O9IA 3AF7X 3PW8A 1Z4AA 4M32A 2FG8A 2V2LA 3GE4A 3V3KB 3F39A 4YKHA 5FFDA 3FSEA 1N1QA 2WTLA 2Z90A 3UOIA 3GGZA 5E2DA 2V15A 3FRSA 1JI4A 2CLUA 2XJMA 2RBDA 3PVYB 4Z3BA 5GOUA 5J9VA 2VZBA 4A25A 4XKSA 2QF9A 4CVSA 2V2IA 4ZL5A 4II4A 4ZKXA 1YUZA 2UX1A 2WLAA 4LYUA 5JDOA 3EZ0A 1SQ3A 3BVFA 4M33A 3AF8X 3KXUA 5GU3X 5LG2A 2XKQA 4PG0A 3QHCA 3KA3A 1XZ3A 3F33A 1RCIA 2ITBA 1NF6A 4XKTA 1YUXA 2C6RA 3A9QA 4CYAA 1MFRA 2XJOA 1S30A 1JI5A 4DE6A 2JD80 4CMYA 2V2MA 1GWGA 5LG8A 5J8SA 2FHAA 4LPNA 4RC5A 2HTNA 3R2LA 2Z5PA 3E2CA 2GYQA 2N02A 4DZ0A 1FHAA 5JDOB 1HRSA 3E6SA 2CHPA 2YW7A 4XKUA 2CN6A 1R03A 3BVLA 1VEIA 3GHQA 1JYBA 4IXKA 2V2NA 5E1UA 5HJHA 1NFVA 3AF9X 2BKCA 5FFCA 2Z6MA 4W4LB 3UOFA 4MKUA 3C21A 2XJNA 3PVTA 5HJFA 1JTSA 3KX9A 5FEJA 3R2MA 1LKPA 4TO9A 1J30A 5GN8A 1XZ1A 3IS8A 1DVBA 4U3GA 2JD70 4TOHA 3AK9A 4TOAA 1B71A 1VJXA 2W0OA 4RC5B 2WWXB 2CIHA 2CWLA 4DASA 4DI0A 3SE1A 5JKLA 3BT5A 1RCGA 2Y3QA 3DBYA 4TW3A 2CLBA 2YJKA 3KA6A 3PVTB 3PW1A 5GU2X 5JKMA 1ZS3A 3L0MA 4LPJA 3QB9A 3KA4A 5GN8B 4ZKHA 1Z6OM 3HIUA 4TOBA 1DATA 4Y08A 2ZG7X 1Z6OA 4REUA 4MXPA 2IY4A 2Z5RA 3Q4RA 3R2HA 4QUWA 1JKUA 5I4JA 4AM5A 3H7GA 3Q4QA 3WVUA 4RC7A 1LKOA 4TOFA 4P18A 3RBCA 5FFEA 4RC6A 4DYYA 2ZA6A 2MGYA 4MUDA 4TOCA 3PW1B 3RE7A 1IESA 4KVQA 1S3QA 2ZG9X 1BFRA 2FG4A 3KWOA 4LPMA 3BVEA 5D8XA 3ERZA
chains in the Genus database with same CATH topology
4PGKA 4AM4A 4CVTA 4LQJA 2PYBA 3O7RA 4KVSA 1L8HA 2C41A 2OH3A 2XGWA 4EVCA 3PW8C 4DYUA 2V2PA 2CN7A 3OGHA 4EVDA 1RCDA 5J93A 4DYXA 4RC7B 3R2KA 2C2JA 3TA8A 3QD8A 4XGSA 4RC6B 2FJCA 2IU2A 4TODA 2X170 3M6JA 4YXJA 3AJPA 5D8YA 2GS4A 3F32A 1JREA 4II4B 3IQ1A 3ISFA 3R2OA 3BVKA 3SIDA 5D8QA 4KXRB 3JZAB 3D19A 2V2RA 3C1ZA 1VEQA 2V2JA 4IWJA 1OTKA 4ZKWA 3RAVA 2G38B 2Y44A 2WLUA 4X0JA 3F38A 4M35A 4E6KA 3U90A 3EGMA 4CVPA 5HQOA 5CMRA 1VELA 3BVIA 1JGCA 4LYXA 2VXXA 2ZA7A 4ZTTA 2ZG8X 4LQVA 4ITWA 2FKZA 4ISPA 3PWQA 3MPSA 5K52A 5LS9A 1TK6A 3WNWA 3N6OA 2BJYA 2V8UA 3PVRA 5AXSA 4PGIA 3QVDA 4LQNA 2GYDA 4YVZA 3VVAA 1H96A 2V8TA 3PWFA 2YJJA 4R42A 1IERA 3FRRA 5ERJA 1MOJA 3WVWA 2FL0A 3AK8A 4ML5A 1RYTA 3Q4NA 5GU0X 3ISEA 4ITTA 3SHXA 3NOZX 5FFBA 3UNOA 1S2ZA 1O9RA 3PVYA 2OKCA 3F36A 4KVRA 2AR0A 5HU6D 4AM2A 3E1QA 3PVRB 5D8RA 3GVYA 3PWQC 3A68A 1VLGA 4Z5SA 3NP2X 5ERKA 1TJOA 4E40A 4PG1A 4TOEA 3VNXA 2C2UA 3IS7A 5CZUA 4IWKA 4CYBA 4WJG4 5D8SA 4EVEA 4OYNA 1RCCA 4TOGA 2Z5QA 2FZFA 2YW6A 1JKVA 3R2RA 3AJOA 4ZLWA 3RD0A 3F34A 2QQYA 4RC8A 1JIGA 5FFAA 2ZA8A 2HR5A 3F35A 2C2FA 1QGHA 1BCFA 3E1MA 2D5KA 3E6RA 3E1NA 2OC5A 2V2OA 4ZJKA 4CMYV 3ES3A 3GGYA 5CMQA 3E1LA 4MY7A 4ZMCA 4CVRA 5J8WA 3KA9A 3OJ5A 1UMNA 3KHKA 3QZ3A 3E1PA 4CY9A 3NP0X 3HL1A 4ISMA 4ETRA 2V2SA 5GU1X 1QYBA 1LKMA 3E1OA 4YXMA 4EVBA 1TKPA 2IB0A 3T9JA 4DYZA 3C1YA 1KRQA 3UFBA 1RCEA 3Q4OA 5D8PA 3BKNA 1L8IA 2CF7A 2F7NA 5JKLG 3EZUA 1UVHA 3C23A 5C6FA 2CEIA 1YV1A 3WVVA 3VV9A 5JKMG 5JACA 3JZ9A 1ZUJA 1LB3A 3SH6A 4MJYA 5LBHA 2G4HA 4ZL6A 1TKOA 3KDQA 5IX6A 1AEWA 4LQHA 4M34A 1EUMA 2CHIA 3R2SA 1BG7A 3KA8A 3AJQA 3E1JA 2VXIA 3FI6A 4W4KB 3FVBA 3PZAA 2BW1A 3RGDA 3W54A 2ZURX 3LKDA 1DPSA 2FFXJ 1F33A 1SOFA 3F37A 5D8OA 2JD60 2BK6A 1NF4A 3O7SA 1NNQA 3QHBA 1F30A 4ERUA 4MN9A 5K53A 1O9IA 3AF7X 3PW8A 1Z4AA 4M32A 2FG8A 2V2LA 3GE4A 3V3KB 3F39A 4YKHA 5FFDA 3FSEA 1N1QA 2WTLA 2Z90A 3UOIA 3GGZA 5E2DA 2V15A 3FRSA 1JI4A 2CLUA 2XJMA 2RBDA 3PVYB 4Z3BA 5GOUA 5J9VA 2VZBA 4A25A 4XKSA 2QF9A 4CVSA 2V2IA 4ZL5A 4II4A 4ZKXA 1YUZA 2UX1A 2WLAA 4LYUA 5JDOA 3EZ0A 1SQ3A 3BVFA 4M33A 3AF8X 3KXUA 5GU3X 5LG2A 2XKQA 4PG0A 3QHCA 3KA3A 1XZ3A 3F33A 1RCIA 2ITBA 1NF6A 4XKTA 1YUXA 2C6RA 3A9QA 4CYAA 1MFRA 2XJOA 1S30A 1JI5A 4DE6A 2JD80 4CMYA 2V2MA 1GWGA 5LG8A 5J8SA 2FHAA 4LPNA 4RC5A 2HTNA 3R2LA 2Z5PA 3E2CA 2GYQA 2N02A 4DZ0A 1FHAA 5JDOB 1HRSA 3E6SA 2CHPA 2YW7A 4XKUA 2CN6A 1R03A 3BVLA 1VEIA 3GHQA 1JYBA 4IXKA 2V2NA 5E1UA 5HJHA 1NFVA 3AF9X 2BKCA 5FFCA 2Z6MA 4W4LB 3UOFA 4MKUA 3C21A 2XJNA 3PVTA 5HJFA 1JTSA 3KX9A 5FEJA 3R2MA 1LKPA 4TO9A 1J30A 5GN8A 1XZ1A 3IS8A 1DVBA 4U3GA 2JD70 4TOHA 3AK9A 4TOAA 1B71A 1VJXA 2W0OA 4RC5B 2WWXB 2CIHA 2CWLA 4DASA 4DI0A 3SE1A 5JKLA 3BT5A 1RCGA 2Y3QA 3DBYA 4TW3A 2CLBA 2YJKA 3KA6A 3PVTB 3PW1A 5GU2X 5JKMA 1ZS3A 3L0MA 4LPJA 3QB9A 3KA4A 5GN8B 4ZKHA 1Z6OM 3HIUA 4TOBA 1DATA 4Y08A 2ZG7X 1Z6OA 4REUA 4MXPA 2IY4A 2Z5RA 3Q4RA 3R2HA 4QUWA 1JKUA 5I4JA 4AM5A 3H7GA 3Q4QA 3WVUA 4RC7A 1LKOA 4TOFA 4P18A 3RBCA 5FFEA 4RC6A 4DYYA 2ZA6A 2MGYA 4MUDA 4TOCA 3PW1B 3RE7A 1IESA 4KVQA 1S3QA 2ZG9X 1BFRA 2FG4A 3KWOA 4LPMA 3BVEA 5D8XA 3ERZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PGK A;  4AM4 A;  4CVT A;  4LQJ A;  2PYB A;  3O7R A;  4KVS A;  1L8H A;  2C41 A;  2OH3 A;  2XGW A;  4EVC A;  3PW8 C;  4DYU A;  2V2P A;  2CN7 A;  3OGH A;  4EVD A;  1RCD A;  5J93 A;  4DYX A;  4RC7 B;  3R2K A;  2C2J A;  3TA8 A;  3QD8 A;  4XGS A;  4RC6 B;  2FJC A;  2IU2 A;  4TOD A;  2X17 0;  3AJP A;  5D8Y A;  2GS4 A;  3F32 A;  1JRE A;  4II4 B;  3IQ1 A;  3ISF A;  3R2O A;  3BVK A;  3SID A;  5D8Q A;  2V2R A;  1VEQ A;  2V2J A;  4IWJ A;  1OTK A;  4ZKW A;  3RAV A;  2WLU A;  3F38 A;  4M35 A;  4E6K A;  3U90 A;  3EGM A;  4CVP A;  5HQO A;  5CMR A;  1VEL A;  3BVI A;  1JGC A;  4LYX A;  2VXX A;  2ZA7 A;  4ZTT A;  2ZG8 X;  4LQV A;  4ITW A;  2FKZ A;  4ISP A;  3PWQ A;  3MPS A;  5K52 A;  5LS9 A;  1TK6 A;  3WNW A;  2BJY A;  3PVR A;  5AXS A;  4PGI A;  3QVD A;  4LQN A;  2GYD A;  1H96 A;  3PWF A;  2YJJ A;  4R42 A;  1IER A;  5ERJ A;  1MOJ A;  3WVW A;  2FL0 A;  3AK8 A;  4ML5 A;  1RYT A;  3Q4N A;  5GU0 X;  3ISE A;  4ITT A;  3SHX A;  3NOZ X;  5FFB A;  3UNO A;  1S2Z A;  1O9R A;  3PVY A;  3F36 A;  4KVR A;  4AM2 A;  3E1Q A;  3PVR B;  5D8R A;  3GVY A;  3PWQ C;  3A68 A;  1VLG A;  4Z5S A;  3NP2 X;  5ERK A;  1TJO A;  4PG1 A;  4TOE A;  3VNX A;  2C2U A;  3IS7 A;  5CZU A;  4IWK A;  4CYB A;  5D8S A;  4EVE A;  4OYN A;  1RCC A;  4TOG A;  2Z5Q A;  2FZF A;  2YW6 A;  1JKV A;  3R2R A;  3AJO A;  4ZLW A;  3RD0 A;  3F34 A;  2QQY A;  4RC8 A;  1JIG A;  5FFA A;  2ZA8 A;  2HR5 A;  3F35 A;  2C2F A;  1QGH A;  1BCF A;  3E1M A;  2D5K A;  3E6R A;  3E1N A;  2OC5 A;  2V2O A;  4ZJK A;  4CMY V;  3ES3 A;  5CMQ A;  3E1L A;  4MY7 A;  4ZMC A;  4CVR A;  5J8W A;  3KA9 A;  3OJ5 A;  1UMN A;  3QZ3 A;  3E1P A;  4CY9 A;  3NP0 X;  3HL1 A;  4ISM A;  4ETR A;  2V2S A;  5GU1 X;  1QYB A;  1LKM A;  3E1O A;  4EVB A;  1TKP A;  2IB0 A;  3T9J A;  4DYZ A;  1KRQ A;  1RCE A;  3Q4O A;  5D8P A;  3BKN A;  1L8I A;  2CF7 A;  2F7N A;  5JKL G;  3EZU A;  1UVH A;  5C6F A;  2CEI A;  1YV1 A;  3WVV A;  5JKM G;  5JAC A;  1ZUJ A;  1LB3 A;  3SH6 A;  4MJY A;  5LBH A;  2G4H A;  4ZL6 A;  1TKO A;  5IX6 A;  1AEW A;  4LQH A;  4M34 A;  1EUM A;  2CHI A;  3R2S A;  1BG7 A;  3KA8 A;  3AJQ A;  3E1J A;  2VXI A;  3FI6 A;  3FVB A;  3PZA A;  2BW1 A;  3RGD A;  2ZUR X;  1DPS A;  2FFX J;  1F33 A;  1SOF A;  3F37 A;  5D8O A;  2JD6 0;  2BK6 A;  1NF4 A;  3O7S A;  1NNQ A;  3QHB A;  1F30 A;  4ERU A;  4MN9 A;  5K53 A;  1O9I A;  3AF7 X;  3PW8 A;  1Z4A A;  4M32 A;  2FG8 A;  2V2L A;  3GE4 A;  3F39 A;  4YKH A;  5FFD A;  3FSE A;  1N1Q A;  2WTL A;  2Z90 A;  3UOI A;  5E2D A;  2V15 A;  1JI4 A;  2CLU A;  2XJM A;  2RBD A;  3PVY B;  4Z3B A;  5GOU A;  5J9V A;  2VZB A;  4A25 A;  4XKS A;  2QF9 A;  4CVS A;  2V2I A;  4ZL5 A;  4II4 A;  4ZKX A;  1YUZ A;  2UX1 A;  2WLA A;  4LYU A;  3EZ0 A;  1SQ3 A;  3BVF A;  4M33 A;  3AF8 X;  3KXU A;  5GU3 X;  5LG2 A;  2XKQ A;  4PG0 A;  3QHC A;  3KA3 A;  1XZ3 A;  3F33 A;  1RCI A;  2ITB A;  1NF6 A;  4XKT A;  1YUX A;  2C6R A;  3A9Q A;  4CYA A;  1MFR A;  2XJO A;  1S30 A;  1JI5 A;  4DE6 A;  2JD8 0;  4CMY A;  2V2M A;  1GWG A;  5LG8 A;  5J8S A;  2FHA A;  4LPN A;  4RC5 A;  2HTN A;  3R2L A;  2Z5P A;  3E2C A;  2GYQ A;  4DZ0 A;  1FHA A;  1HRS A;  3E6S A;  2CHP A;  2YW7 A;  4XKU A;  2CN6 A;  1R03 A;  3BVL A;  1VEI A;  3GHQ A;  1JYB A;  4IXK A;  2V2N A;  5E1U A;  5HJH A;  1NFV A;  3AF9 X;  2BKC A;  5FFC A;  2Z6M A;  3UOF A;  4MKU A;  3PVT A;  2XJN A;  5HJF A;  1JTS A;  3KX9 A;  5FEJ A;  3R2M A;  1LKP A;  4TO9 A;  1J30 A;  5GN8 A;  1XZ1 A;  3IS8 A;  1DVB A;  4U3G A;  2JD7 0;  4TOH A;  3AK9 A;  4TOA A;  1B71 A;  1VJX A;  2W0O A;  4RC5 B;  2CIH A;  4DAS A;  4DI0 A;  3SE1 A;  5JKL A;  3BT5 A;  1RCG A;  2Y3Q A;  4TW3 A;  2CLB A;  2YJK A;  3KA6 A;  3PVT B;  3PW1 A;  5GU2 X;  5JKM A;  1ZS3 A;  4LPJ A;  3QB9 A;  3KA4 A;  5GN8 B;  4ZKH A;  1Z6O M;  3HIU A;  4TOB A;  1DAT A;  4Y08 A;  2ZG7 X;  1Z6O A;  4REU A;  2IY4 A;  2Z5R A;  3Q4R A;  3R2H A;  4QUW A;  1JKU A;  5I4J A;  4AM5 A;  3H7G A;  3Q4Q A;  3WVU A;  4RC7 A;  1LKO A;  4TOF A;  4P18 A;  3RBC A;  5FFE A;  4RC6 A;  4DYY A;  2ZA6 A;  4MUD A;  4TOC A;  3PW1 B;  3RE7 A;  1IES A;  4KVQ A;  1S3Q A;  2ZG9 X;  1BFR A;  2FG4 A;  3KWO A;  4LPM A;  3BVE A;  5D8X A;  3ERZ A; 
#chains in the Genus database with same CATH topology
 4PGK A;  4AM4 A;  4CVT A;  4LQJ A;  2PYB A;  3O7R A;  4KVS A;  1L8H A;  2C41 A;  2OH3 A;  2XGW A;  4EVC A;  3PW8 C;  4DYU A;  2V2P A;  2CN7 A;  3OGH A;  4EVD A;  1RCD A;  5J93 A;  4DYX A;  4RC7 B;  3R2K A;  2C2J A;  3TA8 A;  3QD8 A;  4XGS A;  4RC6 B;  2FJC A;  2IU2 A;  4TOD A;  2X17 0;  3M6J A;  4YXJ A;  3AJP A;  5D8Y A;  2GS4 A;  3F32 A;  1JRE A;  4II4 B;  3IQ1 A;  3ISF A;  3R2O A;  3BVK A;  3SID A;  5D8Q A;  4KXR B;  3JZA B;  3D19 A;  2V2R A;  3C1Z A;  1VEQ A;  2V2J A;  4IWJ A;  1OTK A;  4ZKW A;  3RAV A;  2G38 B;  2Y44 A;  2WLU A;  4X0J A;  3F38 A;  4M35 A;  4E6K A;  3U90 A;  3EGM A;  4CVP A;  5HQO A;  5CMR A;  1VEL A;  3BVI A;  1JGC A;  4LYX A;  2VXX A;  2ZA7 A;  4ZTT A;  2ZG8 X;  4LQV A;  4ITW A;  2FKZ A;  4ISP A;  3PWQ A;  3MPS A;  5K52 A;  5LS9 A;  1TK6 A;  3WNW A;  3N6O A;  2BJY A;  2V8U A;  3PVR A;  5AXS A;  4PGI A;  3QVD A;  4LQN A;  2GYD A;  4YVZ A;  3VVA A;  1H96 A;  2V8T A;  3PWF A;  2YJJ A;  4R42 A;  1IER A;  3FRR A;  5ERJ A;  1MOJ A;  3WVW A;  2FL0 A;  3AK8 A;  4ML5 A;  1RYT A;  3Q4N A;  5GU0 X;  3ISE A;  4ITT A;  3SHX A;  3NOZ X;  5FFB A;  3UNO A;  1S2Z A;  1O9R A;  3PVY A;  2OKC A;  3F36 A;  4KVR A;  2AR0 A;  5HU6 D;  4AM2 A;  3E1Q A;  3PVR B;  5D8R A;  3GVY A;  3PWQ C;  3A68 A;  1VLG A;  4Z5S A;  3NP2 X;  5ERK A;  1TJO A;  4E40 A;  4PG1 A;  4TOE A;  3VNX A;  2C2U A;  3IS7 A;  5CZU A;  4IWK A;  4CYB A;  4WJG 4;  5D8S A;  4EVE A;  4OYN A;  1RCC A;  4TOG A;  2Z5Q A;  2FZF A;  2YW6 A;  1JKV A;  3R2R A;  3AJO A;  4ZLW A;  3RD0 A;  3F34 A;  2QQY A;  4RC8 A;  1JIG A;  5FFA A;  2ZA8 A;  2HR5 A;  3F35 A;  2C2F A;  1QGH A;  1BCF A;  3E1M A;  2D5K A;  3E6R A;  3E1N A;  2OC5 A;  2V2O A;  4ZJK A;  4CMY V;  3ES3 A;  3GGY A;  5CMQ A;  3E1L A;  4MY7 A;  4ZMC A;  4CVR A;  5J8W A;  3KA9 A;  3OJ5 A;  1UMN A;  3KHK A;  3QZ3 A;  3E1P A;  4CY9 A;  3NP0 X;  3HL1 A;  4ISM A;  4ETR A;  2V2S A;  5GU1 X;  1QYB A;  1LKM A;  3E1O A;  4YXM A;  4EVB A;  1TKP A;  2IB0 A;  3T9J A;  4DYZ A;  3C1Y A;  1KRQ A;  3UFB A;  1RCE A;  3Q4O A;  5D8P A;  3BKN A;  1L8I A;  2CF7 A;  2F7N A;  5JKL G;  3EZU A;  1UVH A;  3C23 A;  5C6F A;  2CEI A;  1YV1 A;  3WVV A;  3VV9 A;  5JKM G;  5JAC A;  3JZ9 A;  1ZUJ A;  1LB3 A;  3SH6 A;  4MJY A;  5LBH A;  2G4H A;  4ZL6 A;  1TKO A;  3KDQ A;  5IX6 A;  1AEW A;  4LQH A;  4M34 A;  1EUM A;  2CHI A;  3R2S A;  1BG7 A;  3KA8 A;  3AJQ A;  3E1J A;  2VXI A;  3FI6 A;  4W4K B;  3FVB A;  3PZA A;  2BW1 A;  3RGD A;  3W54 A;  2ZUR X;  3LKD A;  1DPS A;  2FFX J;  1F33 A;  1SOF A;  3F37 A;  5D8O A;  2JD6 0;  2BK6 A;  1NF4 A;  3O7S A;  1NNQ A;  3QHB A;  1F30 A;  4ERU A;  4MN9 A;  5K53 A;  1O9I A;  3AF7 X;  3PW8 A;  1Z4A A;  4M32 A;  2FG8 A;  2V2L A;  3GE4 A;  3V3K B;  3F39 A;  4YKH A;  5FFD A;  3FSE A;  1N1Q A;  2WTL A;  2Z90 A;  3UOI A;  3GGZ A;  5E2D A;  2V15 A;  3FRS A;  1JI4 A;  2CLU A;  2XJM A;  2RBD A;  3PVY B;  4Z3B A;  5GOU A;  5J9V A;  2VZB A;  4A25 A;  4XKS A;  2QF9 A;  4CVS A;  2V2I A;  4ZL5 A;  4II4 A;  4ZKX A;  1YUZ A;  2UX1 A;  2WLA A;  4LYU A;  5JDO A;  3EZ0 A;  1SQ3 A;  3BVF A;  4M33 A;  3AF8 X;  3KXU A;  5GU3 X;  5LG2 A;  2XKQ A;  4PG0 A;  3QHC A;  3KA3 A;  1XZ3 A;  3F33 A;  1RCI A;  2ITB A;  1NF6 A;  4XKT A;  1YUX A;  2C6R A;  3A9Q A;  4CYA A;  1MFR A;  2XJO A;  1S30 A;  1JI5 A;  4DE6 A;  2JD8 0;  4CMY A;  2V2M A;  1GWG A;  5LG8 A;  5J8S A;  2FHA A;  4LPN A;  4RC5 A;  2HTN A;  3R2L A;  2Z5P A;  3E2C A;  2GYQ A;  2N02 A;  4DZ0 A;  1FHA A;  5JDO B;  1HRS A;  3E6S A;  2CHP A;  2YW7 A;  4XKU A;  2CN6 A;  1R03 A;  3BVL A;  1VEI A;  3GHQ A;  1JYB A;  4IXK A;  2V2N A;  5E1U A;  5HJH A;  1NFV A;  3AF9 X;  2BKC A;  5FFC A;  2Z6M A;  4W4L B;  3UOF A;  4MKU A;  3C21 A;  2XJN A;  3PVT A;  5HJF A;  1JTS A;  3KX9 A;  5FEJ A;  3R2M A;  1LKP A;  4TO9 A;  1J30 A;  5GN8 A;  1XZ1 A;  3IS8 A;  1DVB A;  4U3G A;  2JD7 0;  4TOH A;  3AK9 A;  4TOA A;  1B71 A;  1VJX A;  2W0O A;  4RC5 B;  2WWX B;  2CIH A;  2CWL A;  4DAS A;  4DI0 A;  3SE1 A;  5JKL A;  3BT5 A;  1RCG A;  2Y3Q A;  3DBY A;  4TW3 A;  2CLB A;  2YJK A;  3KA6 A;  3PVT B;  3PW1 A;  5GU2 X;  5JKM A;  1ZS3 A;  3L0M A;  4LPJ A;  3QB9 A;  3KA4 A;  5GN8 B;  4ZKH A;  1Z6O M;  3HIU A;  4TOB A;  1DAT A;  4Y08 A;  2ZG7 X;  1Z6O A;  4REU A;  4MXP A;  2IY4 A;  2Z5R A;  3Q4R A;  3R2H A;  4QUW A;  1JKU A;  5I4J A;  4AM5 A;  3H7G A;  3Q4Q A;  3WVU A;  4RC7 A;  1LKO A;  4TOF A;  4P18 A;  3RBC A;  5FFE A;  4RC6 A;  4DYY A;  2ZA6 A;  2MGY A;  4MUD A;  4TOC A;  3PW1 B;  3RE7 A;  1IES A;  4KVQ A;  1S3Q A;  2ZG9 X;  1BFR A;  2FG4 A;  3KWO A;  4LPM A;  3BVE A;  5D8X A;  3ERZ A; 
#chains in the Genus database with same CATH homology
 4PGK A;  4AM4 A;  4CVT A;  4LQJ A;  2PYB A;  3O7R A;  4KVS A;  1L8H A;  2C41 A;  2OH3 A;  2XGW A;  4EVC A;  3PW8 C;  4DYU A;  2V2P A;  2CN7 A;  3OGH A;  4EVD A;  1RCD A;  5J93 A;  4DYX A;  4RC7 B;  3R2K A;  2C2J A;  3TA8 A;  3QD8 A;  4XGS A;  4RC6 B;  2FJC A;  2IU2 A;  4TOD A;  2X17 0;  3M6J A;  4YXJ A;  3AJP A;  5D8Y A;  2GS4 A;  3F32 A;  1JRE A;  4II4 B;  3IQ1 A;  3ISF A;  3R2O A;  3BVK A;  3SID A;  5D8Q A;  4KXR B;  3JZA B;  3D19 A;  2V2R A;  3C1Z A;  1VEQ A;  2V2J A;  4IWJ A;  1OTK A;  4ZKW A;  3RAV A;  2G38 B;  2Y44 A;  2WLU A;  4X0J A;  3F38 A;  4M35 A;  4E6K A;  3U90 A;  3EGM A;  4CVP A;  5HQO A;  5CMR A;  1VEL A;  3BVI A;  1JGC A;  4LYX A;  2VXX A;  2ZA7 A;  4ZTT A;  2ZG8 X;  4LQV A;  4ITW A;  2FKZ A;  4ISP A;  3PWQ A;  3MPS A;  5K52 A;  5LS9 A;  1TK6 A;  3WNW A;  3N6O A;  2BJY A;  2V8U A;  3PVR A;  5AXS A;  4PGI A;  3QVD A;  4LQN A;  2GYD A;  4YVZ A;  3VVA A;  1H96 A;  2V8T A;  3PWF A;  2YJJ A;  4R42 A;  1IER A;  3FRR A;  5ERJ A;  1MOJ A;  3WVW A;  2FL0 A;  3AK8 A;  4ML5 A;  1RYT A;  3Q4N A;  5GU0 X;  3ISE A;  4ITT A;  3SHX A;  3NOZ X;  5FFB A;  3UNO A;  1S2Z A;  1O9R A;  3PVY A;  2OKC A;  3F36 A;  4KVR A;  2AR0 A;  5HU6 D;  4AM2 A;  3E1Q A;  3PVR B;  5D8R A;  3GVY A;  3PWQ C;  3A68 A;  1VLG A;  4Z5S A;  3NP2 X;  5ERK A;  1TJO A;  4E40 A;  4PG1 A;  4TOE A;  3VNX A;  2C2U A;  3IS7 A;  5CZU A;  4IWK A;  4CYB A;  4WJG 4;  5D8S A;  4EVE A;  4OYN A;  1RCC A;  4TOG A;  2Z5Q A;  2FZF A;  2YW6 A;  1JKV A;  3R2R A;  3AJO A;  4ZLW A;  3RD0 A;  3F34 A;  2QQY A;  4RC8 A;  1JIG A;  5FFA A;  2ZA8 A;  2HR5 A;  3F35 A;  2C2F A;  1QGH A;  1BCF A;  3E1M A;  2D5K A;  3E6R A;  3E1N A;  2OC5 A;  2V2O A;  4ZJK A;  4CMY V;  3ES3 A;  3GGY A;  5CMQ A;  3E1L A;  4MY7 A;  4ZMC A;  4CVR A;  5J8W A;  3KA9 A;  3OJ5 A;  1UMN A;  3KHK A;  3QZ3 A;  3E1P A;  4CY9 A;  3NP0 X;  3HL1 A;  4ISM A;  4ETR A;  2V2S A;  5GU1 X;  1QYB A;  1LKM A;  3E1O A;  4YXM A;  4EVB A;  1TKP A;  2IB0 A;  3T9J A;  4DYZ A;  3C1Y A;  1KRQ A;  3UFB A;  1RCE A;  3Q4O A;  5D8P A;  3BKN A;  1L8I A;  2CF7 A;  2F7N A;  5JKL G;  3EZU A;  1UVH A;  3C23 A;  5C6F A;  2CEI A;  1YV1 A;  3WVV A;  3VV9 A;  5JKM G;  5JAC A;  3JZ9 A;  1ZUJ A;  1LB3 A;  3SH6 A;  4MJY A;  5LBH A;  2G4H A;  4ZL6 A;  1TKO A;  3KDQ A;  5IX6 A;  1AEW A;  4LQH A;  4M34 A;  1EUM A;  2CHI A;  3R2S A;  1BG7 A;  3KA8 A;  3AJQ A;  3E1J A;  2VXI A;  3FI6 A;  4W4K B;  3FVB A;  3PZA A;  2BW1 A;  3RGD A;  3W54 A;  2ZUR X;  3LKD A;  1DPS A;  2FFX J;  1F33 A;  1SOF A;  3F37 A;  5D8O A;  2JD6 0;  2BK6 A;  1NF4 A;  3O7S A;  1NNQ A;  3QHB A;  1F30 A;  4ERU A;  4MN9 A;  5K53 A;  1O9I A;  3AF7 X;  3PW8 A;  1Z4A A;  4M32 A;  2FG8 A;  2V2L A;  3GE4 A;  3V3K B;  3F39 A;  4YKH A;  5FFD A;  3FSE A;  1N1Q A;  2WTL A;  2Z90 A;  3UOI A;  3GGZ A;  5E2D A;  2V15 A;  3FRS A;  1JI4 A;  2CLU A;  2XJM A;  2RBD A;  3PVY B;  4Z3B A;  5GOU A;  5J9V A;  2VZB A;  4A25 A;  4XKS A;  2QF9 A;  4CVS A;  2V2I A;  4ZL5 A;  4II4 A;  4ZKX A;  1YUZ A;  2UX1 A;  2WLA A;  4LYU A;  5JDO A;  3EZ0 A;  1SQ3 A;  3BVF A;  4M33 A;  3AF8 X;  3KXU A;  5GU3 X;  5LG2 A;  2XKQ A;  4PG0 A;  3QHC A;  3KA3 A;  1XZ3 A;  3F33 A;  1RCI A;  2ITB A;  1NF6 A;  4XKT A;  1YUX A;  2C6R A;  3A9Q A;  4CYA A;  1MFR A;  2XJO A;  1S30 A;  1JI5 A;  4DE6 A;  2JD8 0;  4CMY A;  2V2M A;  1GWG A;  5LG8 A;  5J8S A;  2FHA A;  4LPN A;  4RC5 A;  2HTN A;  3R2L A;  2Z5P A;  3E2C A;  2GYQ A;  2N02 A;  4DZ0 A;  1FHA A;  5JDO B;  1HRS A;  3E6S A;  2CHP A;  2YW7 A;  4XKU A;  2CN6 A;  1R03 A;  3BVL A;  1VEI A;  3GHQ A;  1JYB A;  4IXK A;  2V2N A;  5E1U A;  5HJH A;  1NFV A;  3AF9 X;  2BKC A;  5FFC A;  2Z6M A;  4W4L B;  3UOF A;  4MKU A;  3C21 A;  2XJN A;  3PVT A;  5HJF A;  1JTS A;  3KX9 A;  5FEJ A;  3R2M A;  1LKP A;  4TO9 A;  1J30 A;  5GN8 A;  1XZ1 A;  3IS8 A;  1DVB A;  4U3G A;  2JD7 0;  4TOH A;  3AK9 A;  4TOA A;  1B71 A;  1VJX A;  2W0O A;  4RC5 B;  2WWX B;  2CIH A;  2CWL A;  4DAS A;  4DI0 A;  3SE1 A;  5JKL A;  3BT5 A;  1RCG A;  2Y3Q A;  3DBY A;  4TW3 A;  2CLB A;  2YJK A;  3KA6 A;  3PVT B;  3PW1 A;  5GU2 X;  5JKM A;  1ZS3 A;  3L0M A;  4LPJ A;  3QB9 A;  3KA4 A;  5GN8 B;  4ZKH A;  1Z6O M;  3HIU A;  4TOB A;  1DAT A;  4Y08 A;  2ZG7 X;  1Z6O A;  4REU A;  4MXP A;  2IY4 A;  2Z5R A;  3Q4R A;  3R2H A;  4QUW A;  1JKU A;  5I4J A;  4AM5 A;  3H7G A;  3Q4Q A;  3WVU A;  4RC7 A;  1LKO A;  4TOF A;  4P18 A;  3RBC A;  5FFE A;  4RC6 A;  4DYY A;  2ZA6 A;  2MGY A;  4MUD A;  4TOC A;  3PW1 B;  3RE7 A;  1IES A;  4KVQ A;  1S3Q A;  2ZG9 X;  1BFR A;  2FG4 A;  3KWO A;  4LPM A;  3BVE A;  5D8X A;  3ERZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...