4XKSA

E. coli bfr variant y45f
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
157
structure length
157
Chain Sequence
MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEFHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDWLETELDLIQKMGLQNYLQAQIREE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterioferritin
publication title Three Aromatic Residues are Required for Electron Transfer during Iron Mineralization in Bacterioferritin.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Oxidoreductase
total genus 75
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2015-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4xksA00
1RCIA 3R2LA 4LPJA 4LQVA 1JI4A 3F36A 4MJYA 2V2OA 4CMYV 2IB0A 4M35A 3O7RA 2Z5QA 4TOBA 1TJOA 4ZKXA 3WVUA 3A9QA 4REUA 5FFAA 1JI5A 2V2MA 2IY4A 3KXUA 3UNOA 3QHCA 4LQHA 4DI0A 1DPSA 2CLUA 3H7GA 3EZ0A 1R03A 2CEIA 1N1QA 3F37A 1NF4A 1LKOA 2ZA7A 3R2MA 4ETRA 5LG2A 5FFEA 4ITWA 3E2CA 5HQOA 2CLBA 5K53A 5LS9A 3GE4A 3EZUA 3SHXA 4ML5A 3HL1A 3SH6A 3R2HA 4QUWA 3TA8A 2BJYA 3QB9A 2RBDA 4KVSA 3KA4A 3WVVA 2FKZA 2C6RA 3KX9A 1GWGA 4EVDA 4ISPA 4U3GA 5D8OA 2GS4A 1LKPA 3Q4NA 3SE1A 2C2FA 3BVFA 3AF9X 2ITBA 4DYXA 2BW1A 4TOFA 3AF8X 5J9VA 4IXKA 1VJXA 3PWFA 4XGSA 2V2JA 1MFRA 1NNQA 3PVTA 3FVBA 1S3QA 3Q4RA 3ERZA 3PVYA 4TODA 5E1UA 2V2PA 3E1JA 1LKMA 3IS8A 2FHAA 1JREA 2YJJA 4CYAA 3IQ1A 5J8WA 4KVRA 2WLAA 4TOHA 2VXIA 2FFXJ 3KWOA 4RC6B 5GU2X 3UOIA 2Z6MA 3NP0X 5E2DA 3GVYA 5J93A 2XJNA 3Q4QA 1H96A 1QYBA 2YJKA 3RAVA 3PVRB 5GU3X 2CF7A 2VXXA 2HR5A 4TOEA 1SOFA 3E1NA 3RD0A 1S30A 4LPNA 5J8SA 3U90A 1JYBA 2W0OA 5JACA 2JD70 5HJHA 2CN7A 5CMQA 2V2SA 4E6KA 4M34A 3QD8A 1B71A 3E1QA 1ZUJA 3FSEA 1VEQA 5GN8B 5FEJA 1XZ3A 1IERA 3EGMA 1UMNA 3BT5A 1MOJA 4AM2A 3AJOA 1TK6A 1DVBA 3AF7X 5AXSA 4DASA 3QHBA 4AM5A 3E1MA 4IWKA 4CVSA 3F39A 4Y08A 2ZG8X 4DYUA 1AEWA 1VELA 1BG7A 3R2OA 2JD80 3ES3A 1QGHA 4ERUA 3SIDA 3BVIA 2V15A 5D8QA 4DZ0A 4DYYA 2XGWA 1J30A 2VZBA 1XZ1A 5GU0X 3ISFA 3OGHA 2CHIA 3NOZX 5LG8A 4MY7A 4IWJA 2WLUA 3BVLA 4TOAA 5CMRA 2JD60 2PYBA 3FI6A 2HTNA 3PZAA 2Z5RA 1YUXA 1L8IA 3GHQA 1IESA 5JKMA 4ZL5A 4LYUA 3OJ5A 4PG0A 4ISMA 2FG4A 2V2IA 1RCGA 2OC5A 5D8RA 1JIGA 2FL0A 1JKUA 2V2LA 4ZL6A 5IX6A 4CMYA 3AK9A 1RYTA 4EVBA 5ERJA 4RC6A 1KRQA 2C41A 2Y3QA 4TO9A 4TOGA 1O9IA 3BVKA 5CZUA 4RC5A 4YKHA 1Z4AA 4TOCA 2CIHA 3ISEA 2QF9A 1JGCA 3E1OA 3PVRA 3RE7A 3F34A 3IS7A 3F32A 3KA8A 1UVHA 1NFVA 5K52A 2FZFA 1BCFA 4M33A 4PGIA 1YUZA 3BKNA 1VLGA 4ZJKA 2C2UA 4R42A 3WVWA 2XKQA 1OTKA 1EUMA 2IU2A 2C2JA 4MKUA 4LYXA 4RC8A 4EVEA 5LBHA 4CVPA 2BKCA 4CVRA 2Z5PA 5ERKA 2V2RA 5GN8A 5D8YA 5JKLA 1L8HA 1TKOA 4LQNA 5FFDA 3T9JA 3F33A 3MPSA 2ZG9X 1F33A 3RBCA 1YV1A 3R2RA 3UOFA 1FHAA 2G4HA 3F38A 4II4B 1Z6OA 2XJOA 1S2ZA 2XJMA 3QZ3A 5FFBA 2UX1A 4P18A 3WNWA 2QQYA 3E6SA 1JKVA 3AJPA 3PWQA 4DYZA 4MUDA 2GYQA 4DE6A 5JKMG 5I4JA 4RC7B 4ZKHA 4XKTA 4PGKA 5D8PA 3PW1B 2D5KA 3Q4OA 2Z90A 3E6RA 4LPMA 3HIUA 1RCEA 2WTLA 3KA6A 3AK8A 1SQ3A 4ITTA 1JTSA 2CHPA 4MN9A 1DATA 4XKUA 1NF6A 3R2KA 1TKPA 4AM4A 1HRSA 2ZA8A 4A25A 1LB3A 3BVEA 4CYBA 3PWQC 4ZTTA 4EVCA 5FFCA 4KVQA 4ZKWA 5C6FA 4ZLWA 5D8SA 3QVDA 3E1PA 3O7SA 2F7NA 1Z6OM 3PW8A 1RCDA 4CVTA 3F35A 3A68A 4TW3A 3KA9A 1BFRA 2CN6A 5D8XA 5JKLG 3RGDA 4ZMCA 2FG8A 1RCCA 3NP2X 4CY9A 4LQJA 4XKSA 3R2SA 5GU1X 3VNXA 2OH3A 4PG1A 2V2NA 2YW6A 3E1LA 1O9RA 4II4A 1ZS3A 2GYDA 2BK6A 3AJQA 2FJCA 4OYNA 3PW8C 3KA3A 4M32A 5HJFA 2ZG7X 3PVTB 4RC5B 1VEIA 2ZA6A 4Z5SA 2ZURX 3PVYB 4RC7A 1F30A 4Z3BA 2X170 3PW1A 5GOUA 2YW7A
chains in the Genus database with same CATH superfamily
1RCIA 3R2LA 4LPJA 4LQVA 1JI4A 3F36A 4MJYA 2V2OA 4CMYV 2IB0A 2WWXB 4M35A 3O7RA 2Z5QA 4TOBA 4YVZA 1TJOA 4ZKXA 3WVUA 3A9QA 4REUA 3JZAB 5FFAA 1JI5A 2V2MA 2IY4A 3KXUA 3UNOA 3QHCA 5JDOA 4LQHA 3UFBA 1DPSA 4DI0A 2CLUA 2CWLA 3H7GA 3EZ0A 1R03A 2CEIA 1N1QA 3F37A 1NF4A 1LKOA 2ZA7A 3R2MA 4ETRA 5LG2A 5FFEA 4ITWA 3E2CA 3C1ZA 5HQOA 2CLBA 5K53A 5LS9A 3GE4A 3EZUA 3SHXA 4ML5A 3HL1A 3V3KB 3SH6A 3R2HA 4QUWA 3TA8A 2BJYA 3QB9A 2RBDA 4KVSA 3KA4A 4X0JA 3WVVA 2FKZA 2C6RA 3KX9A 1GWGA 4EVDA 4ISPA 4U3GA 5D8OA 2GS4A 1LKPA 3Q4NA 3SE1A 2C2FA 3BVFA 3AF9X 2ITBA 3LKDA 4DYXA 2BW1A 4TOFA 3AF8X 5J9VA 4IXKA 1VJXA 3PWFA 4XGSA 2V2JA 1MFRA 1NNQA 3PVTA 4YXMA 3FVBA 1S3QA 3Q4RA 3ERZA 3PVYA 4TODA 5E1UA 2V2PA 3E1JA 1LKMA 3IS8A 2FHAA 1JREA 2YJJA 4CYAA 3IQ1A 3L0MA 5J8WA 4KVRA 2WLAA 4TOHA 3KDQA 2VXIA 2FFXJ 3KWOA 4RC6B 5GU2X 3UOIA 2Z6MA 3NP0X 5E2DA 3JZ9A 3GVYA 5J93A 2XJNA 3Q4QA 1H96A 1QYBA 2YJKA 3RAVA 3PVRB 3GGZA 5GU3X 2CF7A 2VXXA 2HR5A 4MXPA 4TOEA 1SOFA 3E1NA 3RD0A 1S30A 4LPNA 5J8SA 3U90A 1JYBA 2W0OA 5JACA 4KXRB 2JD70 5HJHA 2CN7A 5CMQA 2V2SA 4E6KA 4M34A 3QD8A 1B71A 3E1QA 1ZUJA 3FSEA 1VEQA 5GN8B 5FEJA 1XZ3A 1IERA 3EGMA 1UMNA 3BT5A 1MOJA 4AM2A 3AJOA 1TK6A 1DVBA 3AF7X 5AXSA 4DASA 3QHBA 4AM5A 3E1MA 4IWKA 4CVSA 3F39A 4Y08A 2ZG8X 4DYUA 1AEWA 1VELA 1BG7A 3R2OA 2JD80 3ES3A 1QGHA 4ERUA 3KHKA 3SIDA 3BVIA 2V15A 2V8UA 5D8QA 4DZ0A 4DYYA 2XGWA 1J30A 2VZBA 1XZ1A 5GU0X 3ISFA 3OGHA 2CHIA 3NOZX 5LG8A 4MY7A 4IWJA 2WLUA 3BVLA 2V8TA 4TOAA 5CMRA 2JD60 2PYBA 3FI6A 2HTNA 3PZAA 2Z5RA 1YUXA 1L8IA 3GHQA 1IESA 5JKMA 4ZL5A 4LYUA 3OJ5A 4PG0A 4ISMA 2FG4A 2V2IA 1RCGA 2OC5A 5D8RA 1JIGA 3C21A 2FL0A 1JKUA 2V2LA 4ZL6A 5IX6A 4CMYA 3AK9A 1RYTA 4EVBA 5ERJA 4RC6A 1KRQA 2C41A 3FRRA 2Y3QA 4TO9A 4TOGA 1O9IA 3BVKA 5CZUA 4RC5A 4YKHA 1Z4AA 4TOCA 2CIHA 3ISEA 2QF9A 1JGCA 3E1OA 3C1YA 3PVRA 3VVAA 3RE7A 3F34A 3IS7A 3F32A 3KA8A 1UVHA 3D19A 1NFVA 5K52A 2FZFA 1BCFA 4M33A 4PGIA 1YUZA 3BKNA 1VLGA 4ZJKA 3C23A 2N02A 2C2UA 4R42A 3WVWA 2XKQA 1OTKA 1EUMA 2AR0A 2Y44A 2IU2A 2C2JA 4MKUA 4LYXA 4RC8A 4EVEA 5LBHA 4CVPA 3W54A 2BKCA 4CVRA 2Z5PA 5ERKA 2V2RA 5GN8A 5D8YA 4YXJA 5JKLA 1L8HA 1TKOA 4LQNA 5FFDA 3T9JA 3F33A 3MPSA 2ZG9X 1F33A 3RBCA 1YV1A 3R2RA 3UOFA 1FHAA 2G4HA 3F38A 4II4B 1Z6OA 2XJOA 1S2ZA 2XJMA 3QZ3A 5FFBA 2UX1A 4P18A 3WNWA 2QQYA 3E6SA 1JKVA 3AJPA 3PWQA 4DYZA 4MUDA 2GYQA 2OKCA 4DE6A 5JKMG 5I4JA 4RC7B 4ZKHA 4XKTA 4PGKA 5D8PA 3PW1B 2D5KA 3Q4OA 5HU6D 2Z90A 3E6RA 4LPMA 3HIUA 1RCEA 2WTLA 3KA6A 3AK8A 1SQ3A 4ITTA 1JTSA 2CHPA 4MN9A 1DATA 4XKUA 1NF6A 3R2KA 1TKPA 4AM4A 1HRSA 2ZA8A 5JDOB 4A25A 1LB3A 3BVEA 4CYBA 3PWQC 4ZTTA 4EVCA 5FFCA 4KVQA 3VV9A 4ZKWA 4W4KB 5C6FA 4ZLWA 4W4LB 5D8SA 3N6OA 3QVDA 3E1PA 3O7SA 2F7NA 1Z6OM 3PW8A 1RCDA 3FRSA 4CVTA 3F35A 3A68A 4TW3A 3KA9A 1BFRA 2CN6A 5D8XA 5JKLG 3DBYA 3RGDA 4ZMCA 2FG8A 1RCCA 3NP2X 3M6JA 4CY9A 4LQJA 2G38B 4XKSA 3R2SA 5GU1X 3VNXA 2OH3A 4PG1A 2V2NA 2YW6A 3E1LA 1O9RA 4II4A 1ZS3A 2GYDA 4WJG4 2BK6A 3AJQA 2FJCA 4E40A 4OYNA 3PW8C 3KA3A 4M32A 5HJFA 2ZG7X 3PVTB 4RC5B 1VEIA 2MGYA 2ZA6A 3GGYA 4Z5SA 2ZURX 3PVYB 4RC7A 1F30A 4Z3BA 2X170 3PW1A 5GOUA 2YW7A
chains in the Genus database with same CATH topology
1RCIA 3R2LA 4LPJA 4LQVA 1JI4A 3F36A 4MJYA 2V2OA 4CMYV 2IB0A 2WWXB 4M35A 3O7RA 2Z5QA 4TOBA 4YVZA 1TJOA 4ZKXA 3WVUA 3A9QA 4REUA 3JZAB 5FFAA 1JI5A 2V2MA 2IY4A 3KXUA 3UNOA 3QHCA 5JDOA 4LQHA 3UFBA 1DPSA 4DI0A 2CLUA 2CWLA 3H7GA 3EZ0A 1R03A 2CEIA 1N1QA 3F37A 1NF4A 1LKOA 2ZA7A 3R2MA 4ETRA 5LG2A 5FFEA 4ITWA 3E2CA 3C1ZA 5HQOA 2CLBA 5K53A 5LS9A 3GE4A 3EZUA 3SHXA 4ML5A 3HL1A 3V3KB 3SH6A 3R2HA 4QUWA 3TA8A 2BJYA 3QB9A 2RBDA 4KVSA 3KA4A 4X0JA 3WVVA 2FKZA 2C6RA 3KX9A 1GWGA 4EVDA 4ISPA 4U3GA 5D8OA 2GS4A 1LKPA 3Q4NA 3SE1A 2C2FA 3BVFA 3AF9X 2ITBA 3LKDA 4DYXA 2BW1A 4TOFA 3AF8X 5J9VA 4IXKA 1VJXA 3PWFA 4XGSA 2V2JA 1MFRA 1NNQA 3PVTA 4YXMA 3FVBA 1S3QA 3Q4RA 3ERZA 3PVYA 4TODA 5E1UA 2V2PA 3E1JA 1LKMA 3IS8A 2FHAA 1JREA 2YJJA 4CYAA 3IQ1A 3L0MA 5J8WA 4KVRA 2WLAA 4TOHA 3KDQA 2VXIA 2FFXJ 3KWOA 4RC6B 5GU2X 3UOIA 2Z6MA 3NP0X 5E2DA 3JZ9A 3GVYA 5J93A 2XJNA 3Q4QA 1H96A 1QYBA 2YJKA 3RAVA 3PVRB 3GGZA 5GU3X 2CF7A 2VXXA 2HR5A 4MXPA 4TOEA 1SOFA 3E1NA 3RD0A 1S30A 4LPNA 5J8SA 3U90A 1JYBA 2W0OA 5JACA 4KXRB 2JD70 5HJHA 2CN7A 5CMQA 2V2SA 4E6KA 4M34A 3QD8A 1B71A 3E1QA 1ZUJA 3FSEA 1VEQA 5GN8B 5FEJA 1XZ3A 1IERA 3EGMA 1UMNA 3BT5A 1MOJA 4AM2A 3AJOA 1TK6A 1DVBA 3AF7X 5AXSA 4DASA 3QHBA 4AM5A 3E1MA 4IWKA 4CVSA 3F39A 4Y08A 2ZG8X 4DYUA 1AEWA 1VELA 1BG7A 3R2OA 2JD80 3ES3A 1QGHA 4ERUA 3KHKA 3SIDA 3BVIA 2V15A 2V8UA 5D8QA 4DZ0A 4DYYA 2XGWA 1J30A 2VZBA 1XZ1A 5GU0X 3ISFA 3OGHA 2CHIA 3NOZX 5LG8A 4MY7A 4IWJA 2WLUA 3BVLA 2V8TA 4TOAA 5CMRA 2JD60 2PYBA 3FI6A 2HTNA 3PZAA 2Z5RA 1YUXA 1L8IA 3GHQA 1IESA 5JKMA 4ZL5A 4LYUA 3OJ5A 4PG0A 4ISMA 2FG4A 2V2IA 1RCGA 2OC5A 5D8RA 1JIGA 3C21A 2FL0A 1JKUA 2V2LA 4ZL6A 5IX6A 4CMYA 3AK9A 1RYTA 4EVBA 5ERJA 4RC6A 1KRQA 2C41A 3FRRA 2Y3QA 4TO9A 4TOGA 1O9IA 3BVKA 5CZUA 4RC5A 4YKHA 1Z4AA 4TOCA 2CIHA 3ISEA 2QF9A 1JGCA 3E1OA 3C1YA 3PVRA 3VVAA 3RE7A 3F34A 3IS7A 3F32A 3KA8A 1UVHA 3D19A 1NFVA 5K52A 2FZFA 1BCFA 4M33A 4PGIA 1YUZA 3BKNA 1VLGA 4ZJKA 3C23A 2N02A 2C2UA 4R42A 3WVWA 2XKQA 1OTKA 1EUMA 2AR0A 2Y44A 2IU2A 2C2JA 4MKUA 4LYXA 4RC8A 4EVEA 5LBHA 4CVPA 3W54A 2BKCA 4CVRA 2Z5PA 5ERKA 2V2RA 5GN8A 5D8YA 4YXJA 5JKLA 1L8HA 1TKOA 4LQNA 5FFDA 3T9JA 3F33A 3MPSA 2ZG9X 1F33A 3RBCA 1YV1A 3R2RA 3UOFA 1FHAA 2G4HA 3F38A 4II4B 1Z6OA 2XJOA 1S2ZA 2XJMA 3QZ3A 5FFBA 2UX1A 4P18A 3WNWA 2QQYA 3E6SA 1JKVA 3AJPA 3PWQA 4DYZA 4MUDA 2GYQA 2OKCA 4DE6A 5JKMG 5I4JA 4RC7B 4ZKHA 4XKTA 4PGKA 5D8PA 3PW1B 2D5KA 3Q4OA 5HU6D 2Z90A 3E6RA 4LPMA 3HIUA 1RCEA 2WTLA 3KA6A 3AK8A 1SQ3A 4ITTA 1JTSA 2CHPA 4MN9A 1DATA 4XKUA 1NF6A 3R2KA 1TKPA 4AM4A 1HRSA 2ZA8A 5JDOB 4A25A 1LB3A 3BVEA 4CYBA 3PWQC 4ZTTA 4EVCA 5FFCA 4KVQA 3VV9A 4ZKWA 4W4KB 5C6FA 4ZLWA 4W4LB 5D8SA 3N6OA 3QVDA 3E1PA 3O7SA 2F7NA 1Z6OM 3PW8A 1RCDA 3FRSA 4CVTA 3F35A 3A68A 4TW3A 3KA9A 1BFRA 2CN6A 5D8XA 5JKLG 3DBYA 3RGDA 4ZMCA 2FG8A 1RCCA 3NP2X 3M6JA 4CY9A 4LQJA 2G38B 4XKSA 3R2SA 5GU1X 3VNXA 2OH3A 4PG1A 2V2NA 2YW6A 3E1LA 1O9RA 4II4A 1ZS3A 2GYDA 4WJG4 2BK6A 3AJQA 2FJCA 4E40A 4OYNA 3PW8C 3KA3A 4M32A 5HJFA 2ZG7X 3PVTB 4RC5B 1VEIA 2MGYA 2ZA6A 3GGYA 4Z5SA 2ZURX 3PVYB 4RC7A 1F30A 4Z3BA 2X170 3PW1A 5GOUA 2YW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RCI A;  3R2L A;  4LPJ A;  4LQV A;  1JI4 A;  3F36 A;  4MJY A;  2V2O A;  4CMY V;  2IB0 A;  4M35 A;  3O7R A;  2Z5Q A;  4TOB A;  1TJO A;  4ZKX A;  3WVU A;  3A9Q A;  4REU A;  5FFA A;  1JI5 A;  2V2M A;  2IY4 A;  3KXU A;  3UNO A;  3QHC A;  4LQH A;  4DI0 A;  1DPS A;  2CLU A;  3H7G A;  3EZ0 A;  1R03 A;  2CEI A;  1N1Q A;  3F37 A;  1NF4 A;  1LKO A;  2ZA7 A;  3R2M A;  4ETR A;  5LG2 A;  5FFE A;  4ITW A;  3E2C A;  5HQO A;  2CLB A;  5K53 A;  5LS9 A;  3GE4 A;  3EZU A;  3SHX A;  4ML5 A;  3HL1 A;  3SH6 A;  3R2H A;  4QUW A;  3TA8 A;  2BJY A;  3QB9 A;  2RBD A;  4KVS A;  3KA4 A;  3WVV A;  2FKZ A;  2C6R A;  3KX9 A;  1GWG A;  4EVD A;  4ISP A;  4U3G A;  5D8O A;  2GS4 A;  1LKP A;  3Q4N A;  3SE1 A;  2C2F A;  3BVF A;  3AF9 X;  2ITB A;  4DYX A;  2BW1 A;  4TOF A;  3AF8 X;  5J9V A;  4IXK A;  1VJX A;  3PWF A;  4XGS A;  2V2J A;  1MFR A;  1NNQ A;  3PVT A;  3FVB A;  1S3Q A;  3Q4R A;  3ERZ A;  3PVY A;  4TOD A;  5E1U A;  2V2P A;  3E1J A;  1LKM A;  3IS8 A;  2FHA A;  1JRE A;  2YJJ A;  4CYA A;  3IQ1 A;  5J8W A;  4KVR A;  2WLA A;  4TOH A;  2VXI A;  2FFX J;  3KWO A;  4RC6 B;  5GU2 X;  3UOI A;  2Z6M A;  3NP0 X;  5E2D A;  3GVY A;  5J93 A;  2XJN A;  3Q4Q A;  1H96 A;  1QYB A;  2YJK A;  3RAV A;  3PVR B;  5GU3 X;  2CF7 A;  2VXX A;  2HR5 A;  4TOE A;  1SOF A;  3E1N A;  3RD0 A;  1S30 A;  4LPN A;  5J8S A;  3U90 A;  1JYB A;  2W0O A;  5JAC A;  2JD7 0;  5HJH A;  2CN7 A;  5CMQ A;  2V2S A;  4E6K A;  4M34 A;  3QD8 A;  1B71 A;  3E1Q A;  1ZUJ A;  3FSE A;  1VEQ A;  5GN8 B;  5FEJ A;  1XZ3 A;  1IER A;  3EGM A;  1UMN A;  3BT5 A;  1MOJ A;  4AM2 A;  3AJO A;  1TK6 A;  1DVB A;  3AF7 X;  5AXS A;  4DAS A;  3QHB A;  4AM5 A;  3E1M A;  4IWK A;  4CVS A;  3F39 A;  4Y08 A;  2ZG8 X;  4DYU A;  1AEW A;  1VEL A;  1BG7 A;  3R2O A;  2JD8 0;  3ES3 A;  1QGH A;  4ERU A;  3SID A;  3BVI A;  2V15 A;  5D8Q A;  4DZ0 A;  4DYY A;  2XGW A;  1J30 A;  2VZB A;  1XZ1 A;  5GU0 X;  3ISF A;  3OGH A;  2CHI A;  3NOZ X;  5LG8 A;  4MY7 A;  4IWJ A;  2WLU A;  3BVL A;  4TOA A;  5CMR A;  2JD6 0;  2PYB A;  3FI6 A;  2HTN A;  3PZA A;  2Z5R A;  1YUX A;  1L8I A;  3GHQ A;  1IES A;  5JKM A;  4ZL5 A;  4LYU A;  3OJ5 A;  4PG0 A;  4ISM A;  2FG4 A;  2V2I A;  1RCG A;  2OC5 A;  5D8R A;  1JIG A;  2FL0 A;  1JKU A;  2V2L A;  4ZL6 A;  5IX6 A;  4CMY A;  3AK9 A;  1RYT A;  4EVB A;  5ERJ A;  4RC6 A;  1KRQ A;  2C41 A;  2Y3Q A;  4TO9 A;  4TOG A;  1O9I A;  3BVK A;  5CZU A;  4RC5 A;  4YKH A;  1Z4A A;  4TOC A;  2CIH A;  3ISE A;  2QF9 A;  1JGC A;  3E1O A;  3PVR A;  3RE7 A;  3F34 A;  3IS7 A;  3F32 A;  3KA8 A;  1UVH A;  1NFV A;  5K52 A;  2FZF A;  1BCF A;  4M33 A;  4PGI A;  1YUZ A;  3BKN A;  1VLG A;  4ZJK A;  2C2U A;  4R42 A;  3WVW A;  2XKQ A;  1OTK A;  1EUM A;  2IU2 A;  2C2J A;  4MKU A;  4LYX A;  4RC8 A;  4EVE A;  5LBH A;  4CVP A;  2BKC A;  4CVR A;  2Z5P A;  5ERK A;  2V2R A;  5GN8 A;  5D8Y A;  5JKL A;  1L8H A;  1TKO A;  4LQN A;  5FFD A;  3T9J A;  3F33 A;  3MPS A;  2ZG9 X;  1F33 A;  3RBC A;  1YV1 A;  3R2R A;  3UOF A;  1FHA A;  2G4H A;  3F38 A;  4II4 B;  1Z6O A;  2XJO A;  1S2Z A;  2XJM A;  3QZ3 A;  5FFB A;  2UX1 A;  4P18 A;  3WNW A;  2QQY A;  3E6S A;  1JKV A;  3AJP A;  3PWQ A;  4DYZ A;  4MUD A;  2GYQ A;  4DE6 A;  5JKM G;  5I4J A;  4RC7 B;  4ZKH A;  4XKT A;  4PGK A;  5D8P A;  3PW1 B;  2D5K A;  3Q4O A;  2Z90 A;  3E6R A;  4LPM A;  3HIU A;  1RCE A;  2WTL A;  3KA6 A;  3AK8 A;  1SQ3 A;  4ITT A;  1JTS A;  2CHP A;  4MN9 A;  1DAT A;  4XKU A;  1NF6 A;  3R2K A;  1TKP A;  4AM4 A;  1HRS A;  2ZA8 A;  4A25 A;  1LB3 A;  3BVE A;  4CYB A;  3PWQ C;  4ZTT A;  4EVC A;  5FFC A;  4KVQ A;  4ZKW A;  5C6F A;  4ZLW A;  5D8S A;  3QVD A;  3E1P A;  3O7S A;  2F7N A;  1Z6O M;  3PW8 A;  1RCD A;  4CVT A;  3F35 A;  3A68 A;  4TW3 A;  3KA9 A;  1BFR A;  2CN6 A;  5D8X A;  5JKL G;  3RGD A;  4ZMC A;  2FG8 A;  1RCC A;  3NP2 X;  4CY9 A;  4LQJ A;  4XKS A;  3R2S A;  5GU1 X;  3VNX A;  2OH3 A;  4PG1 A;  2V2N A;  2YW6 A;  3E1L A;  1O9R A;  4II4 A;  1ZS3 A;  2GYD A;  2BK6 A;  3AJQ A;  2FJC A;  4OYN A;  3PW8 C;  3KA3 A;  4M32 A;  5HJF A;  2ZG7 X;  3PVT B;  4RC5 B;  1VEI A;  2ZA6 A;  4Z5S A;  2ZUR X;  3PVY B;  4RC7 A;  1F30 A;  4Z3B A;  2X17 0;  3PW1 A;  5GOU A;  2YW7 A; 
#chains in the Genus database with same CATH topology
 1RCI A;  3R2L A;  4LPJ A;  4LQV A;  1JI4 A;  3F36 A;  4MJY A;  2V2O A;  4CMY V;  2IB0 A;  2WWX B;  4M35 A;  3O7R A;  2Z5Q A;  4TOB A;  4YVZ A;  1TJO A;  4ZKX A;  3WVU A;  3A9Q A;  4REU A;  3JZA B;  5FFA A;  1JI5 A;  2V2M A;  2IY4 A;  3KXU A;  3UNO A;  3QHC A;  5JDO A;  4LQH A;  3UFB A;  1DPS A;  4DI0 A;  2CLU A;  2CWL A;  3H7G A;  3EZ0 A;  1R03 A;  2CEI A;  1N1Q A;  3F37 A;  1NF4 A;  1LKO A;  2ZA7 A;  3R2M A;  4ETR A;  5LG2 A;  5FFE A;  4ITW A;  3E2C A;  3C1Z A;  5HQO A;  2CLB A;  5K53 A;  5LS9 A;  3GE4 A;  3EZU A;  3SHX A;  4ML5 A;  3HL1 A;  3V3K B;  3SH6 A;  3R2H A;  4QUW A;  3TA8 A;  2BJY A;  3QB9 A;  2RBD A;  4KVS A;  3KA4 A;  4X0J A;  3WVV A;  2FKZ A;  2C6R A;  3KX9 A;  1GWG A;  4EVD A;  4ISP A;  4U3G A;  5D8O A;  2GS4 A;  1LKP A;  3Q4N A;  3SE1 A;  2C2F A;  3BVF A;  3AF9 X;  2ITB A;  3LKD A;  4DYX A;  2BW1 A;  4TOF A;  3AF8 X;  5J9V A;  4IXK A;  1VJX A;  3PWF A;  4XGS A;  2V2J A;  1MFR A;  1NNQ A;  3PVT A;  4YXM A;  3FVB A;  1S3Q A;  3Q4R A;  3ERZ A;  3PVY A;  4TOD A;  5E1U A;  2V2P A;  3E1J A;  1LKM A;  3IS8 A;  2FHA A;  1JRE A;  2YJJ A;  4CYA A;  3IQ1 A;  3L0M A;  5J8W A;  4KVR A;  2WLA A;  4TOH A;  3KDQ A;  2VXI A;  2FFX J;  3KWO A;  4RC6 B;  5GU2 X;  3UOI A;  2Z6M A;  3NP0 X;  5E2D A;  3JZ9 A;  3GVY A;  5J93 A;  2XJN A;  3Q4Q A;  1H96 A;  1QYB A;  2YJK A;  3RAV A;  3PVR B;  3GGZ A;  5GU3 X;  2CF7 A;  2VXX A;  2HR5 A;  4MXP A;  4TOE A;  1SOF A;  3E1N A;  3RD0 A;  1S30 A;  4LPN A;  5J8S A;  3U90 A;  1JYB A;  2W0O A;  5JAC A;  4KXR B;  2JD7 0;  5HJH A;  2CN7 A;  5CMQ A;  2V2S A;  4E6K A;  4M34 A;  3QD8 A;  1B71 A;  3E1Q A;  1ZUJ A;  3FSE A;  1VEQ A;  5GN8 B;  5FEJ A;  1XZ3 A;  1IER A;  3EGM A;  1UMN A;  3BT5 A;  1MOJ A;  4AM2 A;  3AJO A;  1TK6 A;  1DVB A;  3AF7 X;  5AXS A;  4DAS A;  3QHB A;  4AM5 A;  3E1M A;  4IWK A;  4CVS A;  3F39 A;  4Y08 A;  2ZG8 X;  4DYU A;  1AEW A;  1VEL A;  1BG7 A;  3R2O A;  2JD8 0;  3ES3 A;  1QGH A;  4ERU A;  3KHK A;  3SID A;  3BVI A;  2V15 A;  2V8U A;  5D8Q A;  4DZ0 A;  4DYY A;  2XGW A;  1J30 A;  2VZB A;  1XZ1 A;  5GU0 X;  3ISF A;  3OGH A;  2CHI A;  3NOZ X;  5LG8 A;  4MY7 A;  4IWJ A;  2WLU A;  3BVL A;  2V8T A;  4TOA A;  5CMR A;  2JD6 0;  2PYB A;  3FI6 A;  2HTN A;  3PZA A;  2Z5R A;  1YUX A;  1L8I A;  3GHQ A;  1IES A;  5JKM A;  4ZL5 A;  4LYU A;  3OJ5 A;  4PG0 A;  4ISM A;  2FG4 A;  2V2I A;  1RCG A;  2OC5 A;  5D8R A;  1JIG A;  3C21 A;  2FL0 A;  1JKU A;  2V2L A;  4ZL6 A;  5IX6 A;  4CMY A;  3AK9 A;  1RYT A;  4EVB A;  5ERJ A;  4RC6 A;  1KRQ A;  2C41 A;  3FRR A;  2Y3Q A;  4TO9 A;  4TOG A;  1O9I A;  3BVK A;  5CZU A;  4RC5 A;  4YKH A;  1Z4A A;  4TOC A;  2CIH A;  3ISE A;  2QF9 A;  1JGC A;  3E1O A;  3C1Y A;  3PVR A;  3VVA A;  3RE7 A;  3F34 A;  3IS7 A;  3F32 A;  3KA8 A;  1UVH A;  3D19 A;  1NFV A;  5K52 A;  2FZF A;  1BCF A;  4M33 A;  4PGI A;  1YUZ A;  3BKN A;  1VLG A;  4ZJK A;  3C23 A;  2N02 A;  2C2U A;  4R42 A;  3WVW A;  2XKQ A;  1OTK A;  1EUM A;  2AR0 A;  2Y44 A;  2IU2 A;  2C2J A;  4MKU A;  4LYX A;  4RC8 A;  4EVE A;  5LBH A;  4CVP A;  3W54 A;  2BKC A;  4CVR A;  2Z5P A;  5ERK A;  2V2R A;  5GN8 A;  5D8Y A;  4YXJ A;  5JKL A;  1L8H A;  1TKO A;  4LQN A;  5FFD A;  3T9J A;  3F33 A;  3MPS A;  2ZG9 X;  1F33 A;  3RBC A;  1YV1 A;  3R2R A;  3UOF A;  1FHA A;  2G4H A;  3F38 A;  4II4 B;  1Z6O A;  2XJO A;  1S2Z A;  2XJM A;  3QZ3 A;  5FFB A;  2UX1 A;  4P18 A;  3WNW A;  2QQY A;  3E6S A;  1JKV A;  3AJP A;  3PWQ A;  4DYZ A;  4MUD A;  2GYQ A;  2OKC A;  4DE6 A;  5JKM G;  5I4J A;  4RC7 B;  4ZKH A;  4XKT A;  4PGK A;  5D8P A;  3PW1 B;  2D5K A;  3Q4O A;  5HU6 D;  2Z90 A;  3E6R A;  4LPM A;  3HIU A;  1RCE A;  2WTL A;  3KA6 A;  3AK8 A;  1SQ3 A;  4ITT A;  1JTS A;  2CHP A;  4MN9 A;  1DAT A;  4XKU A;  1NF6 A;  3R2K A;  1TKP A;  4AM4 A;  1HRS A;  2ZA8 A;  5JDO B;  4A25 A;  1LB3 A;  3BVE A;  4CYB A;  3PWQ C;  4ZTT A;  4EVC A;  5FFC A;  4KVQ A;  3VV9 A;  4ZKW A;  4W4K B;  5C6F A;  4ZLW A;  4W4L B;  5D8S A;  3N6O A;  3QVD A;  3E1P A;  3O7S A;  2F7N A;  1Z6O M;  3PW8 A;  1RCD A;  3FRS A;  4CVT A;  3F35 A;  3A68 A;  4TW3 A;  3KA9 A;  1BFR A;  2CN6 A;  5D8X A;  5JKL G;  3DBY A;  3RGD A;  4ZMC A;  2FG8 A;  1RCC A;  3NP2 X;  3M6J A;  4CY9 A;  4LQJ A;  2G38 B;  4XKS A;  3R2S A;  5GU1 X;  3VNX A;  2OH3 A;  4PG1 A;  2V2N A;  2YW6 A;  3E1L A;  1O9R A;  4II4 A;  1ZS3 A;  2GYD A;  4WJG 4;  2BK6 A;  3AJQ A;  2FJC A;  4E40 A;  4OYN A;  3PW8 C;  3KA3 A;  4M32 A;  5HJF A;  2ZG7 X;  3PVT B;  4RC5 B;  1VEI A;  2MGY A;  2ZA6 A;  3GGY A;  4Z5S A;  2ZUR X;  3PVY B;  4RC7 A;  1F30 A;  4Z3B A;  2X17 0;  3PW1 A;  5GOU A;  2YW7 A; 
#chains in the Genus database with same CATH homology
 1RCI A;  3R2L A;  4LPJ A;  4LQV A;  1JI4 A;  3F36 A;  4MJY A;  2V2O A;  4CMY V;  2IB0 A;  2WWX B;  4M35 A;  3O7R A;  2Z5Q A;  4TOB A;  4YVZ A;  1TJO A;  4ZKX A;  3WVU A;  3A9Q A;  4REU A;  3JZA B;  5FFA A;  1JI5 A;  2V2M A;  2IY4 A;  3KXU A;  3UNO A;  3QHC A;  5JDO A;  4LQH A;  3UFB A;  1DPS A;  4DI0 A;  2CLU A;  2CWL A;  3H7G A;  3EZ0 A;  1R03 A;  2CEI A;  1N1Q A;  3F37 A;  1NF4 A;  1LKO A;  2ZA7 A;  3R2M A;  4ETR A;  5LG2 A;  5FFE A;  4ITW A;  3E2C A;  3C1Z A;  5HQO A;  2CLB A;  5K53 A;  5LS9 A;  3GE4 A;  3EZU A;  3SHX A;  4ML5 A;  3HL1 A;  3V3K B;  3SH6 A;  3R2H A;  4QUW A;  3TA8 A;  2BJY A;  3QB9 A;  2RBD A;  4KVS A;  3KA4 A;  4X0J A;  3WVV A;  2FKZ A;  2C6R A;  3KX9 A;  1GWG A;  4EVD A;  4ISP A;  4U3G A;  5D8O A;  2GS4 A;  1LKP A;  3Q4N A;  3SE1 A;  2C2F A;  3BVF A;  3AF9 X;  2ITB A;  3LKD A;  4DYX A;  2BW1 A;  4TOF A;  3AF8 X;  5J9V A;  4IXK A;  1VJX A;  3PWF A;  4XGS A;  2V2J A;  1MFR A;  1NNQ A;  3PVT A;  4YXM A;  3FVB A;  1S3Q A;  3Q4R A;  3ERZ A;  3PVY A;  4TOD A;  5E1U A;  2V2P A;  3E1J A;  1LKM A;  3IS8 A;  2FHA A;  1JRE A;  2YJJ A;  4CYA A;  3IQ1 A;  3L0M A;  5J8W A;  4KVR A;  2WLA A;  4TOH A;  3KDQ A;  2VXI A;  2FFX J;  3KWO A;  4RC6 B;  5GU2 X;  3UOI A;  2Z6M A;  3NP0 X;  5E2D A;  3JZ9 A;  3GVY A;  5J93 A;  2XJN A;  3Q4Q A;  1H96 A;  1QYB A;  2YJK A;  3RAV A;  3PVR B;  3GGZ A;  5GU3 X;  2CF7 A;  2VXX A;  2HR5 A;  4MXP A;  4TOE A;  1SOF A;  3E1N A;  3RD0 A;  1S30 A;  4LPN A;  5J8S A;  3U90 A;  1JYB A;  2W0O A;  5JAC A;  4KXR B;  2JD7 0;  5HJH A;  2CN7 A;  5CMQ A;  2V2S A;  4E6K A;  4M34 A;  3QD8 A;  1B71 A;  3E1Q A;  1ZUJ A;  3FSE A;  1VEQ A;  5GN8 B;  5FEJ A;  1XZ3 A;  1IER A;  3EGM A;  1UMN A;  3BT5 A;  1MOJ A;  4AM2 A;  3AJO A;  1TK6 A;  1DVB A;  3AF7 X;  5AXS A;  4DAS A;  3QHB A;  4AM5 A;  3E1M A;  4IWK A;  4CVS A;  3F39 A;  4Y08 A;  2ZG8 X;  4DYU A;  1AEW A;  1VEL A;  1BG7 A;  3R2O A;  2JD8 0;  3ES3 A;  1QGH A;  4ERU A;  3KHK A;  3SID A;  3BVI A;  2V15 A;  2V8U A;  5D8Q A;  4DZ0 A;  4DYY A;  2XGW A;  1J30 A;  2VZB A;  1XZ1 A;  5GU0 X;  3ISF A;  3OGH A;  2CHI A;  3NOZ X;  5LG8 A;  4MY7 A;  4IWJ A;  2WLU A;  3BVL A;  2V8T A;  4TOA A;  5CMR A;  2JD6 0;  2PYB A;  3FI6 A;  2HTN A;  3PZA A;  2Z5R A;  1YUX A;  1L8I A;  3GHQ A;  1IES A;  5JKM A;  4ZL5 A;  4LYU A;  3OJ5 A;  4PG0 A;  4ISM A;  2FG4 A;  2V2I A;  1RCG A;  2OC5 A;  5D8R A;  1JIG A;  3C21 A;  2FL0 A;  1JKU A;  2V2L A;  4ZL6 A;  5IX6 A;  4CMY A;  3AK9 A;  1RYT A;  4EVB A;  5ERJ A;  4RC6 A;  1KRQ A;  2C41 A;  3FRR A;  2Y3Q A;  4TO9 A;  4TOG A;  1O9I A;  3BVK A;  5CZU A;  4RC5 A;  4YKH A;  1Z4A A;  4TOC A;  2CIH A;  3ISE A;  2QF9 A;  1JGC A;  3E1O A;  3C1Y A;  3PVR A;  3VVA A;  3RE7 A;  3F34 A;  3IS7 A;  3F32 A;  3KA8 A;  1UVH A;  3D19 A;  1NFV A;  5K52 A;  2FZF A;  1BCF A;  4M33 A;  4PGI A;  1YUZ A;  3BKN A;  1VLG A;  4ZJK A;  3C23 A;  2N02 A;  2C2U A;  4R42 A;  3WVW A;  2XKQ A;  1OTK A;  1EUM A;  2AR0 A;  2Y44 A;  2IU2 A;  2C2J A;  4MKU A;  4LYX A;  4RC8 A;  4EVE A;  5LBH A;  4CVP A;  3W54 A;  2BKC A;  4CVR A;  2Z5P A;  5ERK A;  2V2R A;  5GN8 A;  5D8Y A;  4YXJ A;  5JKL A;  1L8H A;  1TKO A;  4LQN A;  5FFD A;  3T9J A;  3F33 A;  3MPS A;  2ZG9 X;  1F33 A;  3RBC A;  1YV1 A;  3R2R A;  3UOF A;  1FHA A;  2G4H A;  3F38 A;  4II4 B;  1Z6O A;  2XJO A;  1S2Z A;  2XJM A;  3QZ3 A;  5FFB A;  2UX1 A;  4P18 A;  3WNW A;  2QQY A;  3E6S A;  1JKV A;  3AJP A;  3PWQ A;  4DYZ A;  4MUD A;  2GYQ A;  2OKC A;  4DE6 A;  5JKM G;  5I4J A;  4RC7 B;  4ZKH A;  4XKT A;  4PGK A;  5D8P A;  3PW1 B;  2D5K A;  3Q4O A;  5HU6 D;  2Z90 A;  3E6R A;  4LPM A;  3HIU A;  1RCE A;  2WTL A;  3KA6 A;  3AK8 A;  1SQ3 A;  4ITT A;  1JTS A;  2CHP A;  4MN9 A;  1DAT A;  4XKU A;  1NF6 A;  3R2K A;  1TKP A;  4AM4 A;  1HRS A;  2ZA8 A;  5JDO B;  4A25 A;  1LB3 A;  3BVE A;  4CYB A;  3PWQ C;  4ZTT A;  4EVC A;  5FFC A;  4KVQ A;  3VV9 A;  4ZKW A;  4W4K B;  5C6F A;  4ZLW A;  4W4L B;  5D8S A;  3N6O A;  3QVD A;  3E1P A;  3O7S A;  2F7N A;  1Z6O M;  3PW8 A;  1RCD A;  3FRS A;  4CVT A;  3F35 A;  3A68 A;  4TW3 A;  3KA9 A;  1BFR A;  2CN6 A;  5D8X A;  5JKL G;  3DBY A;  3RGD A;  4ZMC A;  2FG8 A;  1RCC A;  3NP2 X;  3M6J A;  4CY9 A;  4LQJ A;  2G38 B;  4XKS A;  3R2S A;  5GU1 X;  3VNX A;  2OH3 A;  4PG1 A;  2V2N A;  2YW6 A;  3E1L A;  1O9R A;  4II4 A;  1ZS3 A;  2GYD A;  4WJG 4;  2BK6 A;  3AJQ A;  2FJC A;  4E40 A;  4OYN A;  3PW8 C;  3KA3 A;  4M32 A;  5HJF A;  2ZG7 X;  3PVT B;  4RC5 B;  1VEI A;  2MGY A;  2ZA6 A;  3GGY A;  4Z5S A;  2ZUR X;  3PVY B;  4RC7 A;  1F30 A;  4Z3B A;  2X17 0;  3PW1 A;  5GOU A;  2YW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...