1JIGA

Dlp-2 from bacillus anthracis
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
146
structure length
146
Chain Sequence
STKTNVVEVLNKQVANWNVLYVKLHNYHWYVTGPHFFTLHEKFEEFYNEAGTYIDELAERILALEGKPLATMKEYLATSSVNEGTSKESAEEMVQTLVNDYSALIQELKEGMEVAGEAGDATSADMLLAIHTTLEQHVWMLSAFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Dlp-2
publication title Structure of two iron-binding proteins from Bacillus anthracis.
pubmed doi rcsb
source organism Bacillus anthracis
total genus 66
structure length 146
sequence length 146
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1jigA00
2FZFA 2Z6MA 1JKVA 3RAVA 2CLBA 2OH3A 4RC6A 3RBCA 4CY9A 1VJXA 4CMYV 1Z4AA 5GU3X 4PGKA 3U90A 4ETRA 3E1JA 1SQ3A 2XJMA 1VEIA 5GOUA 4LQJA 2IB0A 4DYXA 1QGHA 3E6RA 3ERZA 4ZL5A 2ZG7X 3ISEA 2CF7A 2GYQA 5ERKA 1JREA 3F39A 5HJHA 5GN8A 1JKUA 5I4JA 2G4HA 4CVTA 2ZG8X 2UX1A 3PWFA 3AJQA 3R2MA 2FJCA 1B71A 1AEWA 3AK9A 3E1OA 3AF9X 1S3QA 5D8SA 4ZKXA 2Z5QA 4LPMA 2YJKA 3KA4A 2C2JA 2QQYA 3IS7A 3F36A 4Z5SA 3PW1B 3BVIA 1NF4A 3PVTA 4CYBA 5CMRA 5K52A 4XGSA 3UOFA 5D8RA 1SOFA 1RCGA 2CHIA 1S30A 5FEJA 5IX6A 1LB3A 4TOFA 4LPJA 2F7NA 3GVYA 1S2ZA 4MKUA 1RCIA 4ZMCA 4ISPA 5FFEA 1TJOA 2V2PA 4LQNA 4ML5A 3AJOA 1RCCA 3PVYA 2OC5A 3A9QA 2ZG9X 1N1QA 2VXXA 1O9IA 4II4B 2ZA8A 3WVWA 4TODA 3FSEA 1LKOA 3UNOA 5GU1X 3Q4NA 3OJ5A 2ZA7A 4TOHA 1ZS3A 3QZ3A 1NFVA 2YJJA 4LQHA 2C41A 4AM5A 4CVPA 1NNQA 2Z5RA 2JD70 3EZUA 3KA8A 3R2RA 4EVBA 3Q4OA 3F33A 5FFBA 3BVLA 1TKPA 3KA9A 3E1PA 3WVVA 2ITBA 3QVDA 3SH6A 1BG7A 3FI6A 4RC5B 1TKOA 3Q4QA 2C2UA 1JTSA 4MY7A 1RCDA 5JKMG 5GU0X 3IQ1A 1QYBA 4M32A 2BK6A 5HJFA 3MPSA 3AF7X 3E2CA 2V2MA 3BVEA 1LKMA 3SE1A 2QF9A 3F37A 2V2IA 2IU2A 1KRQA 3A68A 2BKCA 1L8IA 4ITWA 1IESA 1UMNA 2FL0A 4PG1A 2V2OA 2XJOA 3E6SA 5D8YA 3KWOA 2Y3QA 3QD8A 4DYZA 2ZURX 2Z5PA 1LKPA 2V2SA 2VZBA 2CLUA 3AK8A 2Z90A 4RC6B 5LG2A 4RC7A 4LQVA 3KXUA 4DI0A 3BVFA 5FFDA 1JGCA 3EZ0A 5J8SA 1DPSA 1MFRA 3FVBA 3PWQC 4KVRA 4TOAA 4TOBA 1JIGA 4YKHA 5ERJA 4MN9A 1RYTA 4ITTA 5GN8B 5J9VA 3ISFA 4RC8A 1Z6OM 4Z3BA 2CEIA 4LYUA 3HIUA 2D5KA 4MUDA 4XKSA 1VLGA 1GWGA 4EVEA 3RE7A 4M35A 5D8OA 3RD0A 5GU2X 1YV1A 4M33A 3PW8C 4LYXA 5J8WA 4KVQA 2FG8A 3NOZX 1VEQA 3PVTB 4TOCA 5JKMA 3PVRA 4RC7B 2RBDA 3BVKA 3QHBA 2YW7A 3F34A 3R2HA 5HQOA 5LBHA 2V2JA 4ZL6A 2FG4A 3T9JA 4IWJA 2CN6A 4PGIA 3RGDA 4TW3A 5AXSA 2XJNA 5JKLG 2V2RA 2C6RA 4KVSA 1OTKA 3R2SA 3PVYB 4Y08A 2V2NA 4ZLWA 1JYBA 1XZ3A 5D8QA 4IXKA 2ZA6A 2XKQA 3NP2X 2WLUA 4CVRA 5C6FA 1ZUJA 4CMYA 4DYYA 5E2DA 4EVCA 1H96A 3EGMA 4CVSA 1R03A 2V15A 1RCEA 4ZKWA 3O7SA 1FHAA 1XZ1A 3PW1A 1IERA 2X170 1NF6A 2W0OA 4AM4A 1MOJA 1Z6OA 3F38A 3OGHA 4REUA 5LG8A 4XKTA 2FFXJ 3IS8A 1JI5A 4MJYA 3WVUA 1HRSA 2YW6A 3ES3A 4ISMA 5D8PA 5D8XA 1YUZA 5LS9A 3AF8X 3HL1A 1YUXA 4EVDA 3E1NA 3UOIA 2VXIA 4II4A 3F32A 5FFCA 2WTLA 2BJYA 4P18A 2PYBA 2CIHA 3R2LA 1F33A 5JACA 5K53A 2GS4A 3GHQA 2FHAA 5CMQA 4IWKA 3VNXA 4CYAA 4AM2A 3KA3A 3O7RA 3PZAA 4ERUA 5JKLA 2WLAA 3SIDA 3AJPA 3Q4RA 3E1MA 3GE4A 1TK6A 2HR5A 4DYUA 4DASA 1O9RA 4RC5A 1JI4A 1DATA 1EUMA 3KX9A 4DE6A 1BFRA 4TO9A 1DVBA 3KA6A 2XGWA 4TOGA 4TOEA 3PWQA 4QUWA 3R2KA 4A25A 3R2OA 2CHPA 2JD80 2HTNA 2BW1A 1BCFA 4ZJKA 1VELA 4M34A 3E1QA 3F35A 2FKZA 3SHXA 4E6KA 3BT5A 5J93A 4R42A 3WNWA 1UVHA 3QHCA 3BKNA 4OYNA 4LPNA 2IY4A 4ZKHA 5CZUA 1F30A 5FFAA 2V2LA 3NP0X 3PW8A 4PG0A 2CN7A 2JD60 3H7GA 4DZ0A 4U3GA 2GYDA 1L8HA 3TA8A 4XKUA 5E1UA 2C2FA 4ZTTA 3QB9A 1J30A 3E1LA 3PVRB
chains in the Genus database with same CATH superfamily
2FZFA 2Z6MA 1JKVA 2V8UA 3RAVA 2CLBA 2OH3A 4RC6A 3RBCA 4CY9A 1VJXA 4W4LB 4CMYV 1Z4AA 5GU3X 3C1ZA 4PGKA 3U90A 4ETRA 3E1JA 1SQ3A 2XJMA 3LKDA 1VEIA 5GOUA 4LQJA 2IB0A 4KXRB 4DYXA 1QGHA 3E6RA 3ERZA 4ZL5A 2ZG7X 3ISEA 2CF7A 2GYQA 5ERKA 1JREA 3F39A 5HJHA 4W4KB 5GN8A 1JKUA 5I4JA 2G4HA 4CVTA 2ZG8X 2UX1A 3PWFA 3AJQA 3R2MA 2FJCA 1B71A 1AEWA 3AK9A 3E1OA 3AF9X 1S3QA 3C1YA 5D8SA 4ZKXA 2Z5QA 4LPMA 2YJKA 3KA4A 2C2JA 4E40A 2QQYA 3IS7A 3F36A 4Z5SA 3PW1B 3BVIA 1NF4A 3PVTA 4CYBA 5CMRA 5K52A 4XGSA 4MXPA 2G38B 3UOFA 5D8RA 1SOFA 1RCGA 2CHIA 1S30A 5FEJA 5IX6A 1LB3A 4TOFA 4LPJA 2F7NA 3GVYA 1S2ZA 4MKUA 1RCIA 4YXMA 4ZMCA 5JDOA 4ISPA 5FFEA 1TJOA 2V2PA 4LQNA 4ML5A 3AJOA 1RCCA 3PVYA 2OC5A 3A9QA 2ZG9X 1N1QA 2VXXA 1O9IA 4II4B 2ZA8A 3WVWA 4X0JA 2CWLA 4TODA 3FSEA 1LKOA 3UNOA 5GU1X 3Q4NA 3OJ5A 2ZA7A 4TOHA 4YVZA 1ZS3A 3QZ3A 1NFVA 2YJJA 3FRRA 4LQHA 2C41A 4AM5A 4CVPA 1NNQA 2Z5RA 2JD70 3EZUA 3KA8A 3R2RA 2OKCA 4EVBA 3Q4OA 3F33A 5FFBA 3BVLA 1TKPA 3KA9A 3E1PA 3WVVA 2ITBA 3QVDA 3SH6A 2V8TA 1BG7A 3FI6A 4RC5B 1TKOA 3Q4QA 2C2UA 1JTSA 4MY7A 1RCDA 5JKMG 5GU0X 3IQ1A 1QYBA 4M32A 2BK6A 5HJFA 3MPSA 3AF7X 3E2CA 2V2MA 3BVEA 1LKMA 3SE1A 2QF9A 3F37A 2V2IA 2IU2A 1KRQA 3A68A 2BKCA 3JZ9A 1L8IA 4ITWA 1IESA 3L0MA 3JZAB 1UMNA 2FL0A 4PG1A 2V2OA 2XJOA 3E6SA 5D8YA 3KWOA 2Y3QA 3QD8A 3W54A 4DYZA 2ZURX 2Z5PA 1LKPA 2V2SA 2VZBA 2CLUA 3AK8A 2Z90A 3C23A 4RC6B 5LG2A 3GGZA 4RC7A 4LQVA 3KXUA 3KDQA 4DI0A 3BVFA 5FFDA 1JGCA 3EZ0A 3N6OA 5J8SA 1DPSA 1MFRA 3FVBA 3PWQC 4KVRA 4TOAA 4TOBA 1JIGA 4YKHA 5ERJA 4MN9A 1RYTA 4ITTA 5GN8B 5J9VA 3ISFA 4RC8A 1Z6OM 4Z3BA 2CEIA 4LYUA 3HIUA 2D5KA 4MUDA 4XKSA 1VLGA 3VV9A 1GWGA 4EVEA 3RE7A 4M35A 5D8OA 3RD0A 5GU2X 1YV1A 4M33A 3PW8C 4LYXA 5J8WA 4KVQA 2FG8A 3NOZX 1VEQA 3PVTB 4TOCA 5JKMA 3PVRA 4RC7B 2RBDA 3BVKA 3QHBA 2YW7A 3DBYA 3F34A 3R2HA 5HQOA 2WWXB 2V2JA 5LBHA 4ZL6A 2FG4A 3T9JA 4IWJA 2CN6A 4PGIA 3RGDA 4TW3A 5AXSA 2XJNA 5JDOB 5JKLG 2V2RA 2C6RA 4KVSA 1OTKA 3R2SA 3PVYB 4Y08A 3GGYA 2V2NA 3VVAA 4ZLWA 1JYBA 3D19A 1XZ3A 5D8QA 4IXKA 2ZA6A 3NP2X 2XKQA 3FRSA 2WLUA 4CVRA 5C6FA 1ZUJA 4CMYA 4DYYA 5E2DA 4EVCA 1H96A 3EGMA 3KHKA 4CVSA 1R03A 2V15A 1RCEA 4ZKWA 3O7SA 1FHAA 1XZ1A 3PW1A 2Y44A 1IERA 2X170 1NF6A 2W0OA 4AM4A 1MOJA 1Z6OA 3F38A 3OGHA 4REUA 5LG8A 4XKTA 2FFXJ 3IS8A 1JI5A 4MJYA 3WVUA 1HRSA 2YW6A 3ES3A 4ISMA 5D8PA 5D8XA 1YUZA 5LS9A 3AF8X 3HL1A 1YUXA 4EVDA 3E1NA 3UOIA 3C21A 2VXIA 4II4A 3F32A 3UFBA 5FFCA 2WTLA 2BJYA 4P18A 2PYBA 2CIHA 3R2LA 1F33A 5JACA 5K53A 2GS4A 3GHQA 2FHAA 5CMQA 4IWKA 3VNXA 4CYAA 4AM2A 3KA3A 4YXJA 3O7RA 3PZAA 4ERUA 5JKLA 2WLAA 3SIDA 3AJPA 3Q4RA 3E1MA 3GE4A 1TK6A 2HR5A 3V3KB 4DYUA 4DASA 1O9RA 4RC5A 1JI4A 5HU6D 1DATA 1EUMA 3KX9A 4DE6A 1BFRA 2MGYA 4TO9A 1DVBA 3M6JA 3KA6A 2XGWA 4TOGA 4WJG4 4TOEA 3PWQA 4QUWA 3R2KA 4A25A 3R2OA 2CHPA 2JD80 2HTNA 2BW1A 1BCFA 4ZJKA 1VELA 4M34A 3E1QA 3F35A 2FKZA 3SHXA 4E6KA 2AR0A 3BT5A 5J93A 4R42A 3WNWA 1UVHA 3QHCA 3BKNA 4OYNA 4LPNA 2IY4A 4ZKHA 5CZUA 1F30A 5FFAA 2V2LA 2N02A 3NP0X 3PW8A 4PG0A 2CN7A 2JD60 3H7GA 4DZ0A 4U3GA 2GYDA 1L8HA 3TA8A 4XKUA 5E1UA 2C2FA 4ZTTA 3QB9A 1J30A 3E1LA 3PVRB
chains in the Genus database with same CATH topology
2FZFA 2Z6MA 1JKVA 2V8UA 3RAVA 2CLBA 2OH3A 4RC6A 3RBCA 4CY9A 1VJXA 4W4LB 4CMYV 1Z4AA 5GU3X 3C1ZA 4PGKA 3U90A 4ETRA 3E1JA 1SQ3A 2XJMA 3LKDA 1VEIA 5GOUA 4LQJA 2IB0A 4KXRB 4DYXA 1QGHA 3E6RA 3ERZA 4ZL5A 2ZG7X 3ISEA 2CF7A 2GYQA 5ERKA 1JREA 3F39A 5HJHA 4W4KB 5GN8A 1JKUA 5I4JA 2G4HA 4CVTA 2ZG8X 2UX1A 3PWFA 3AJQA 3R2MA 2FJCA 1B71A 1AEWA 3AK9A 3E1OA 3AF9X 1S3QA 3C1YA 5D8SA 4ZKXA 2Z5QA 4LPMA 2YJKA 3KA4A 2C2JA 4E40A 2QQYA 3IS7A 3F36A 4Z5SA 3PW1B 3BVIA 1NF4A 3PVTA 4CYBA 5CMRA 5K52A 4XGSA 4MXPA 2G38B 3UOFA 5D8RA 1SOFA 1RCGA 2CHIA 1S30A 5FEJA 5IX6A 1LB3A 4TOFA 4LPJA 2F7NA 3GVYA 1S2ZA 4MKUA 1RCIA 4YXMA 4ZMCA 5JDOA 4ISPA 5FFEA 1TJOA 2V2PA 4LQNA 4ML5A 3AJOA 1RCCA 3PVYA 2OC5A 3A9QA 2ZG9X 1N1QA 2VXXA 1O9IA 4II4B 2ZA8A 3WVWA 4X0JA 2CWLA 4TODA 3FSEA 1LKOA 3UNOA 5GU1X 3Q4NA 3OJ5A 2ZA7A 4TOHA 4YVZA 1ZS3A 3QZ3A 1NFVA 2YJJA 3FRRA 4LQHA 2C41A 4AM5A 4CVPA 1NNQA 2Z5RA 2JD70 3EZUA 3KA8A 3R2RA 2OKCA 4EVBA 3Q4OA 3F33A 5FFBA 3BVLA 1TKPA 3KA9A 3E1PA 3WVVA 2ITBA 3QVDA 3SH6A 2V8TA 1BG7A 3FI6A 4RC5B 1TKOA 3Q4QA 2C2UA 1JTSA 4MY7A 1RCDA 5JKMG 5GU0X 3IQ1A 1QYBA 4M32A 2BK6A 5HJFA 3MPSA 3AF7X 3E2CA 2V2MA 3BVEA 1LKMA 3SE1A 2QF9A 3F37A 2V2IA 2IU2A 1KRQA 3A68A 2BKCA 3JZ9A 1L8IA 4ITWA 1IESA 3L0MA 3JZAB 1UMNA 2FL0A 4PG1A 2V2OA 2XJOA 3E6SA 5D8YA 3KWOA 2Y3QA 3QD8A 3W54A 4DYZA 2ZURX 2Z5PA 1LKPA 2V2SA 2VZBA 2CLUA 3AK8A 2Z90A 3C23A 4RC6B 5LG2A 3GGZA 4RC7A 4LQVA 3KXUA 3KDQA 4DI0A 3BVFA 5FFDA 1JGCA 3EZ0A 3N6OA 5J8SA 1DPSA 1MFRA 3FVBA 3PWQC 4KVRA 4TOAA 4TOBA 1JIGA 4YKHA 5ERJA 4MN9A 1RYTA 4ITTA 5GN8B 5J9VA 3ISFA 4RC8A 1Z6OM 4Z3BA 2CEIA 4LYUA 3HIUA 2D5KA 4MUDA 4XKSA 1VLGA 3VV9A 1GWGA 4EVEA 3RE7A 4M35A 5D8OA 3RD0A 5GU2X 1YV1A 4M33A 3PW8C 4LYXA 5J8WA 4KVQA 2FG8A 3NOZX 1VEQA 3PVTB 4TOCA 5JKMA 3PVRA 4RC7B 2RBDA 3BVKA 3QHBA 2YW7A 3DBYA 3F34A 3R2HA 5HQOA 2WWXB 2V2JA 5LBHA 4ZL6A 2FG4A 3T9JA 4IWJA 2CN6A 4PGIA 3RGDA 4TW3A 5AXSA 2XJNA 5JDOB 5JKLG 2V2RA 2C6RA 4KVSA 1OTKA 3R2SA 3PVYB 4Y08A 3GGYA 2V2NA 3VVAA 4ZLWA 1JYBA 3D19A 1XZ3A 5D8QA 4IXKA 2ZA6A 3NP2X 2XKQA 3FRSA 2WLUA 4CVRA 5C6FA 1ZUJA 4CMYA 4DYYA 5E2DA 4EVCA 1H96A 3EGMA 3KHKA 4CVSA 1R03A 2V15A 1RCEA 4ZKWA 3O7SA 1FHAA 1XZ1A 3PW1A 2Y44A 1IERA 2X170 1NF6A 2W0OA 4AM4A 1MOJA 1Z6OA 3F38A 3OGHA 4REUA 5LG8A 4XKTA 2FFXJ 3IS8A 1JI5A 4MJYA 3WVUA 1HRSA 2YW6A 3ES3A 4ISMA 5D8PA 5D8XA 1YUZA 5LS9A 3AF8X 3HL1A 1YUXA 4EVDA 3E1NA 3UOIA 3C21A 2VXIA 4II4A 3F32A 3UFBA 5FFCA 2WTLA 2BJYA 4P18A 2PYBA 2CIHA 3R2LA 1F33A 5JACA 5K53A 2GS4A 3GHQA 2FHAA 5CMQA 4IWKA 3VNXA 4CYAA 4AM2A 3KA3A 4YXJA 3O7RA 3PZAA 4ERUA 5JKLA 2WLAA 3SIDA 3AJPA 3Q4RA 3E1MA 3GE4A 1TK6A 2HR5A 3V3KB 4DYUA 4DASA 1O9RA 4RC5A 1JI4A 5HU6D 1DATA 1EUMA 3KX9A 4DE6A 1BFRA 2MGYA 4TO9A 1DVBA 3M6JA 3KA6A 2XGWA 4TOGA 4WJG4 4TOEA 3PWQA 4QUWA 3R2KA 4A25A 3R2OA 2CHPA 2JD80 2HTNA 2BW1A 1BCFA 4ZJKA 1VELA 4M34A 3E1QA 3F35A 2FKZA 3SHXA 4E6KA 2AR0A 3BT5A 5J93A 4R42A 3WNWA 1UVHA 3QHCA 3BKNA 4OYNA 4LPNA 2IY4A 4ZKHA 5CZUA 1F30A 5FFAA 2V2LA 2N02A 3NP0X 3PW8A 4PG0A 2CN7A 2JD60 3H7GA 4DZ0A 4U3GA 2GYDA 1L8HA 3TA8A 4XKUA 5E1UA 2C2FA 4ZTTA 3QB9A 1J30A 3E1LA 3PVRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FZF A;  2Z6M A;  1JKV A;  3RAV A;  2CLB A;  2OH3 A;  4RC6 A;  3RBC A;  4CY9 A;  1VJX A;  4CMY V;  1Z4A A;  5GU3 X;  4PGK A;  3U90 A;  4ETR A;  3E1J A;  1SQ3 A;  2XJM A;  1VEI A;  5GOU A;  4LQJ A;  2IB0 A;  4DYX A;  1QGH A;  3E6R A;  3ERZ A;  4ZL5 A;  2ZG7 X;  3ISE A;  2CF7 A;  2GYQ A;  5ERK A;  1JRE A;  3F39 A;  5HJH A;  5GN8 A;  1JKU A;  5I4J A;  2G4H A;  4CVT A;  2ZG8 X;  2UX1 A;  3PWF A;  3AJQ A;  3R2M A;  2FJC A;  1B71 A;  1AEW A;  3AK9 A;  3E1O A;  3AF9 X;  1S3Q A;  5D8S A;  4ZKX A;  2Z5Q A;  4LPM A;  2YJK A;  3KA4 A;  2C2J A;  2QQY A;  3IS7 A;  3F36 A;  4Z5S A;  3PW1 B;  3BVI A;  1NF4 A;  3PVT A;  4CYB A;  5CMR A;  5K52 A;  4XGS A;  3UOF A;  5D8R A;  1SOF A;  1RCG A;  2CHI A;  1S30 A;  5FEJ A;  5IX6 A;  1LB3 A;  4TOF A;  4LPJ A;  2F7N A;  3GVY A;  1S2Z A;  4MKU A;  1RCI A;  4ZMC A;  4ISP A;  5FFE A;  1TJO A;  2V2P A;  4LQN A;  4ML5 A;  3AJO A;  1RCC A;  3PVY A;  2OC5 A;  3A9Q A;  2ZG9 X;  1N1Q A;  2VXX A;  1O9I A;  4II4 B;  2ZA8 A;  3WVW A;  4TOD A;  3FSE A;  1LKO A;  3UNO A;  5GU1 X;  3Q4N A;  3OJ5 A;  2ZA7 A;  4TOH A;  1ZS3 A;  3QZ3 A;  1NFV A;  2YJJ A;  4LQH A;  2C41 A;  4AM5 A;  4CVP A;  1NNQ A;  2Z5R A;  2JD7 0;  3EZU A;  3KA8 A;  3R2R A;  4EVB A;  3Q4O A;  3F33 A;  5FFB A;  3BVL A;  1TKP A;  3KA9 A;  3E1P A;  3WVV A;  2ITB A;  3QVD A;  3SH6 A;  1BG7 A;  3FI6 A;  4RC5 B;  1TKO A;  3Q4Q A;  2C2U A;  1JTS A;  4MY7 A;  1RCD A;  5JKM G;  5GU0 X;  3IQ1 A;  1QYB A;  4M32 A;  2BK6 A;  5HJF A;  3MPS A;  3AF7 X;  3E2C A;  2V2M A;  3BVE A;  1LKM A;  3SE1 A;  2QF9 A;  3F37 A;  2V2I A;  2IU2 A;  1KRQ A;  3A68 A;  2BKC A;  1L8I A;  4ITW A;  1IES A;  1UMN A;  2FL0 A;  4PG1 A;  2V2O A;  2XJO A;  3E6S A;  5D8Y A;  3KWO A;  2Y3Q A;  3QD8 A;  4DYZ A;  2ZUR X;  2Z5P A;  1LKP A;  2V2S A;  2VZB A;  2CLU A;  3AK8 A;  2Z90 A;  4RC6 B;  5LG2 A;  4RC7 A;  4LQV A;  3KXU A;  4DI0 A;  3BVF A;  5FFD A;  1JGC A;  3EZ0 A;  5J8S A;  1DPS A;  1MFR A;  3FVB A;  3PWQ C;  4KVR A;  4TOA A;  4TOB A;  1JIG A;  4YKH A;  5ERJ A;  4MN9 A;  1RYT A;  4ITT A;  5GN8 B;  5J9V A;  3ISF A;  4RC8 A;  1Z6O M;  4Z3B A;  2CEI A;  4LYU A;  3HIU A;  2D5K A;  4MUD A;  4XKS A;  1VLG A;  1GWG A;  4EVE A;  3RE7 A;  4M35 A;  5D8O A;  3RD0 A;  5GU2 X;  1YV1 A;  4M33 A;  3PW8 C;  4LYX A;  5J8W A;  4KVQ A;  2FG8 A;  3NOZ X;  1VEQ A;  3PVT B;  4TOC A;  5JKM A;  3PVR A;  4RC7 B;  2RBD A;  3BVK A;  3QHB A;  2YW7 A;  3F34 A;  3R2H A;  5HQO A;  5LBH A;  2V2J A;  4ZL6 A;  2FG4 A;  3T9J A;  4IWJ A;  2CN6 A;  4PGI A;  3RGD A;  4TW3 A;  5AXS A;  2XJN A;  5JKL G;  2V2R A;  2C6R A;  4KVS A;  1OTK A;  3R2S A;  3PVY B;  4Y08 A;  2V2N A;  4ZLW A;  1JYB A;  1XZ3 A;  5D8Q A;  4IXK A;  2ZA6 A;  2XKQ A;  3NP2 X;  2WLU A;  4CVR A;  5C6F A;  1ZUJ A;  4CMY A;  4DYY A;  5E2D A;  4EVC A;  1H96 A;  3EGM A;  4CVS A;  1R03 A;  2V15 A;  1RCE A;  4ZKW A;  3O7S A;  1FHA A;  1XZ1 A;  3PW1 A;  1IER A;  2X17 0;  1NF6 A;  2W0O A;  4AM4 A;  1MOJ A;  1Z6O A;  3F38 A;  3OGH A;  4REU A;  5LG8 A;  4XKT A;  2FFX J;  3IS8 A;  1JI5 A;  4MJY A;  3WVU A;  1HRS A;  2YW6 A;  3ES3 A;  4ISM A;  5D8P A;  5D8X A;  1YUZ A;  5LS9 A;  3AF8 X;  3HL1 A;  1YUX A;  4EVD A;  3E1N A;  3UOI A;  2VXI A;  4II4 A;  3F32 A;  5FFC A;  2WTL A;  2BJY A;  4P18 A;  2PYB A;  2CIH A;  3R2L A;  1F33 A;  5JAC A;  5K53 A;  2GS4 A;  3GHQ A;  2FHA A;  5CMQ A;  4IWK A;  3VNX A;  4CYA A;  4AM2 A;  3KA3 A;  3O7R A;  3PZA A;  4ERU A;  5JKL A;  2WLA A;  3SID A;  3AJP A;  3Q4R A;  3E1M A;  3GE4 A;  1TK6 A;  2HR5 A;  4DYU A;  4DAS A;  1O9R A;  4RC5 A;  1JI4 A;  1DAT A;  1EUM A;  3KX9 A;  4DE6 A;  1BFR A;  4TO9 A;  1DVB A;  3KA6 A;  2XGW A;  4TOG A;  4TOE A;  3PWQ A;  4QUW A;  3R2K A;  4A25 A;  3R2O A;  2CHP A;  2JD8 0;  2HTN A;  2BW1 A;  1BCF A;  4ZJK A;  1VEL A;  4M34 A;  3E1Q A;  3F35 A;  2FKZ A;  3SHX A;  4E6K A;  3BT5 A;  5J93 A;  4R42 A;  3WNW A;  1UVH A;  3QHC A;  3BKN A;  4OYN A;  4LPN A;  2IY4 A;  4ZKH A;  5CZU A;  1F30 A;  5FFA A;  2V2L A;  3NP0 X;  3PW8 A;  4PG0 A;  2CN7 A;  2JD6 0;  3H7G A;  4DZ0 A;  4U3G A;  2GYD A;  1L8H A;  3TA8 A;  4XKU A;  5E1U A;  2C2F A;  4ZTT A;  3QB9 A;  1J30 A;  3E1L A;  3PVR B; 
#chains in the Genus database with same CATH topology
 2FZF A;  2Z6M A;  1JKV A;  2V8U A;  3RAV A;  2CLB A;  2OH3 A;  4RC6 A;  3RBC A;  4CY9 A;  1VJX A;  4W4L B;  4CMY V;  1Z4A A;  5GU3 X;  3C1Z A;  4PGK A;  3U90 A;  4ETR A;  3E1J A;  1SQ3 A;  2XJM A;  3LKD A;  1VEI A;  5GOU A;  4LQJ A;  2IB0 A;  4KXR B;  4DYX A;  1QGH A;  3E6R A;  3ERZ A;  4ZL5 A;  2ZG7 X;  3ISE A;  2CF7 A;  2GYQ A;  5ERK A;  1JRE A;  3F39 A;  5HJH A;  4W4K B;  5GN8 A;  1JKU A;  5I4J A;  2G4H A;  4CVT A;  2ZG8 X;  2UX1 A;  3PWF A;  3AJQ A;  3R2M A;  2FJC A;  1B71 A;  1AEW A;  3AK9 A;  3E1O A;  3AF9 X;  1S3Q A;  3C1Y A;  5D8S A;  4ZKX A;  2Z5Q A;  4LPM A;  2YJK A;  3KA4 A;  2C2J A;  4E40 A;  2QQY A;  3IS7 A;  3F36 A;  4Z5S A;  3PW1 B;  3BVI A;  1NF4 A;  3PVT A;  4CYB A;  5CMR A;  5K52 A;  4XGS A;  4MXP A;  2G38 B;  3UOF A;  5D8R A;  1SOF A;  1RCG A;  2CHI A;  1S30 A;  5FEJ A;  5IX6 A;  1LB3 A;  4TOF A;  4LPJ A;  2F7N A;  3GVY A;  1S2Z A;  4MKU A;  1RCI A;  4YXM A;  4ZMC A;  5JDO A;  4ISP A;  5FFE A;  1TJO A;  2V2P A;  4LQN A;  4ML5 A;  3AJO A;  1RCC A;  3PVY A;  2OC5 A;  3A9Q A;  2ZG9 X;  1N1Q A;  2VXX A;  1O9I A;  4II4 B;  2ZA8 A;  3WVW A;  4X0J A;  2CWL A;  4TOD A;  3FSE A;  1LKO A;  3UNO A;  5GU1 X;  3Q4N A;  3OJ5 A;  2ZA7 A;  4TOH A;  4YVZ A;  1ZS3 A;  3QZ3 A;  1NFV A;  2YJJ A;  3FRR A;  4LQH A;  2C41 A;  4AM5 A;  4CVP A;  1NNQ A;  2Z5R A;  2JD7 0;  3EZU A;  3KA8 A;  3R2R A;  2OKC A;  4EVB A;  3Q4O A;  3F33 A;  5FFB A;  3BVL A;  1TKP A;  3KA9 A;  3E1P A;  3WVV A;  2ITB A;  3QVD A;  3SH6 A;  2V8T A;  1BG7 A;  3FI6 A;  4RC5 B;  1TKO A;  3Q4Q A;  2C2U A;  1JTS A;  4MY7 A;  1RCD A;  5JKM G;  5GU0 X;  3IQ1 A;  1QYB A;  4M32 A;  2BK6 A;  5HJF A;  3MPS A;  3AF7 X;  3E2C A;  2V2M A;  3BVE A;  1LKM A;  3SE1 A;  2QF9 A;  3F37 A;  2V2I A;  2IU2 A;  1KRQ A;  3A68 A;  2BKC A;  3JZ9 A;  1L8I A;  4ITW A;  1IES A;  3L0M A;  3JZA B;  1UMN A;  2FL0 A;  4PG1 A;  2V2O A;  2XJO A;  3E6S A;  5D8Y A;  3KWO A;  2Y3Q A;  3QD8 A;  3W54 A;  4DYZ A;  2ZUR X;  2Z5P A;  1LKP A;  2V2S A;  2VZB A;  2CLU A;  3AK8 A;  2Z90 A;  3C23 A;  4RC6 B;  5LG2 A;  3GGZ A;  4RC7 A;  4LQV A;  3KXU A;  3KDQ A;  4DI0 A;  3BVF A;  5FFD A;  1JGC A;  3EZ0 A;  3N6O A;  5J8S A;  1DPS A;  1MFR A;  3FVB A;  3PWQ C;  4KVR A;  4TOA A;  4TOB A;  1JIG A;  4YKH A;  5ERJ A;  4MN9 A;  1RYT A;  4ITT A;  5GN8 B;  5J9V A;  3ISF A;  4RC8 A;  1Z6O M;  4Z3B A;  2CEI A;  4LYU A;  3HIU A;  2D5K A;  4MUD A;  4XKS A;  1VLG A;  3VV9 A;  1GWG A;  4EVE A;  3RE7 A;  4M35 A;  5D8O A;  3RD0 A;  5GU2 X;  1YV1 A;  4M33 A;  3PW8 C;  4LYX A;  5J8W A;  4KVQ A;  2FG8 A;  3NOZ X;  1VEQ A;  3PVT B;  4TOC A;  5JKM A;  3PVR A;  4RC7 B;  2RBD A;  3BVK A;  3QHB A;  2YW7 A;  3DBY A;  3F34 A;  3R2H A;  5HQO A;  2WWX B;  2V2J A;  5LBH A;  4ZL6 A;  2FG4 A;  3T9J A;  4IWJ A;  2CN6 A;  4PGI A;  3RGD A;  4TW3 A;  5AXS A;  2XJN A;  5JDO B;  5JKL G;  2V2R A;  2C6R A;  4KVS A;  1OTK A;  3R2S A;  3PVY B;  4Y08 A;  3GGY A;  2V2N A;  3VVA A;  4ZLW A;  1JYB A;  3D19 A;  1XZ3 A;  5D8Q A;  4IXK A;  2ZA6 A;  3NP2 X;  2XKQ A;  3FRS A;  2WLU A;  4CVR A;  5C6F A;  1ZUJ A;  4CMY A;  4DYY A;  5E2D A;  4EVC A;  1H96 A;  3EGM A;  3KHK A;  4CVS A;  1R03 A;  2V15 A;  1RCE A;  4ZKW A;  3O7S A;  1FHA A;  1XZ1 A;  3PW1 A;  2Y44 A;  1IER A;  2X17 0;  1NF6 A;  2W0O A;  4AM4 A;  1MOJ A;  1Z6O A;  3F38 A;  3OGH A;  4REU A;  5LG8 A;  4XKT A;  2FFX J;  3IS8 A;  1JI5 A;  4MJY A;  3WVU A;  1HRS A;  2YW6 A;  3ES3 A;  4ISM A;  5D8P A;  5D8X A;  1YUZ A;  5LS9 A;  3AF8 X;  3HL1 A;  1YUX A;  4EVD A;  3E1N A;  3UOI A;  3C21 A;  2VXI A;  4II4 A;  3F32 A;  3UFB A;  5FFC A;  2WTL A;  2BJY A;  4P18 A;  2PYB A;  2CIH A;  3R2L A;  1F33 A;  5JAC A;  5K53 A;  2GS4 A;  3GHQ A;  2FHA A;  5CMQ A;  4IWK A;  3VNX A;  4CYA A;  4AM2 A;  3KA3 A;  4YXJ A;  3O7R A;  3PZA A;  4ERU A;  5JKL A;  2WLA A;  3SID A;  3AJP A;  3Q4R A;  3E1M A;  3GE4 A;  1TK6 A;  2HR5 A;  3V3K B;  4DYU A;  4DAS A;  1O9R A;  4RC5 A;  1JI4 A;  5HU6 D;  1DAT A;  1EUM A;  3KX9 A;  4DE6 A;  1BFR A;  2MGY A;  4TO9 A;  1DVB A;  3M6J A;  3KA6 A;  2XGW A;  4TOG A;  4WJG 4;  4TOE A;  3PWQ A;  4QUW A;  3R2K A;  4A25 A;  3R2O A;  2CHP A;  2JD8 0;  2HTN A;  2BW1 A;  1BCF A;  4ZJK A;  1VEL A;  4M34 A;  3E1Q A;  3F35 A;  2FKZ A;  3SHX A;  4E6K A;  2AR0 A;  3BT5 A;  5J93 A;  4R42 A;  3WNW A;  1UVH A;  3QHC A;  3BKN A;  4OYN A;  4LPN A;  2IY4 A;  4ZKH A;  5CZU A;  1F30 A;  5FFA A;  2V2L A;  2N02 A;  3NP0 X;  3PW8 A;  4PG0 A;  2CN7 A;  2JD6 0;  3H7G A;  4DZ0 A;  4U3G A;  2GYD A;  1L8H A;  3TA8 A;  4XKU A;  5E1U A;  2C2F A;  4ZTT A;  3QB9 A;  1J30 A;  3E1L A;  3PVR B; 
#chains in the Genus database with same CATH homology
 2FZF A;  2Z6M A;  1JKV A;  2V8U A;  3RAV A;  2CLB A;  2OH3 A;  4RC6 A;  3RBC A;  4CY9 A;  1VJX A;  4W4L B;  4CMY V;  1Z4A A;  5GU3 X;  3C1Z A;  4PGK A;  3U90 A;  4ETR A;  3E1J A;  1SQ3 A;  2XJM A;  3LKD A;  1VEI A;  5GOU A;  4LQJ A;  2IB0 A;  4KXR B;  4DYX A;  1QGH A;  3E6R A;  3ERZ A;  4ZL5 A;  2ZG7 X;  3ISE A;  2CF7 A;  2GYQ A;  5ERK A;  1JRE A;  3F39 A;  5HJH A;  4W4K B;  5GN8 A;  1JKU A;  5I4J A;  2G4H A;  4CVT A;  2ZG8 X;  2UX1 A;  3PWF A;  3AJQ A;  3R2M A;  2FJC A;  1B71 A;  1AEW A;  3AK9 A;  3E1O A;  3AF9 X;  1S3Q A;  3C1Y A;  5D8S A;  4ZKX A;  2Z5Q A;  4LPM A;  2YJK A;  3KA4 A;  2C2J A;  4E40 A;  2QQY A;  3IS7 A;  3F36 A;  4Z5S A;  3PW1 B;  3BVI A;  1NF4 A;  3PVT A;  4CYB A;  5CMR A;  5K52 A;  4XGS A;  4MXP A;  2G38 B;  3UOF A;  5D8R A;  1SOF A;  1RCG A;  2CHI A;  1S30 A;  5FEJ A;  5IX6 A;  1LB3 A;  4TOF A;  4LPJ A;  2F7N A;  3GVY A;  1S2Z A;  4MKU A;  1RCI A;  4YXM A;  4ZMC A;  5JDO A;  4ISP A;  5FFE A;  1TJO A;  2V2P A;  4LQN A;  4ML5 A;  3AJO A;  1RCC A;  3PVY A;  2OC5 A;  3A9Q A;  2ZG9 X;  1N1Q A;  2VXX A;  1O9I A;  4II4 B;  2ZA8 A;  3WVW A;  4X0J A;  2CWL A;  4TOD A;  3FSE A;  1LKO A;  3UNO A;  5GU1 X;  3Q4N A;  3OJ5 A;  2ZA7 A;  4TOH A;  4YVZ A;  1ZS3 A;  3QZ3 A;  1NFV A;  2YJJ A;  3FRR A;  4LQH A;  2C41 A;  4AM5 A;  4CVP A;  1NNQ A;  2Z5R A;  2JD7 0;  3EZU A;  3KA8 A;  3R2R A;  2OKC A;  4EVB A;  3Q4O A;  3F33 A;  5FFB A;  3BVL A;  1TKP A;  3KA9 A;  3E1P A;  3WVV A;  2ITB A;  3QVD A;  3SH6 A;  2V8T A;  1BG7 A;  3FI6 A;  4RC5 B;  1TKO A;  3Q4Q A;  2C2U A;  1JTS A;  4MY7 A;  1RCD A;  5JKM G;  5GU0 X;  3IQ1 A;  1QYB A;  4M32 A;  2BK6 A;  5HJF A;  3MPS A;  3AF7 X;  3E2C A;  2V2M A;  3BVE A;  1LKM A;  3SE1 A;  2QF9 A;  3F37 A;  2V2I A;  2IU2 A;  1KRQ A;  3A68 A;  2BKC A;  3JZ9 A;  1L8I A;  4ITW A;  1IES A;  3L0M A;  3JZA B;  1UMN A;  2FL0 A;  4PG1 A;  2V2O A;  2XJO A;  3E6S A;  5D8Y A;  3KWO A;  2Y3Q A;  3QD8 A;  3W54 A;  4DYZ A;  2ZUR X;  2Z5P A;  1LKP A;  2V2S A;  2VZB A;  2CLU A;  3AK8 A;  2Z90 A;  3C23 A;  4RC6 B;  5LG2 A;  3GGZ A;  4RC7 A;  4LQV A;  3KXU A;  3KDQ A;  4DI0 A;  3BVF A;  5FFD A;  1JGC A;  3EZ0 A;  3N6O A;  5J8S A;  1DPS A;  1MFR A;  3FVB A;  3PWQ C;  4KVR A;  4TOA A;  4TOB A;  1JIG A;  4YKH A;  5ERJ A;  4MN9 A;  1RYT A;  4ITT A;  5GN8 B;  5J9V A;  3ISF A;  4RC8 A;  1Z6O M;  4Z3B A;  2CEI A;  4LYU A;  3HIU A;  2D5K A;  4MUD A;  4XKS A;  1VLG A;  3VV9 A;  1GWG A;  4EVE A;  3RE7 A;  4M35 A;  5D8O A;  3RD0 A;  5GU2 X;  1YV1 A;  4M33 A;  3PW8 C;  4LYX A;  5J8W A;  4KVQ A;  2FG8 A;  3NOZ X;  1VEQ A;  3PVT B;  4TOC A;  5JKM A;  3PVR A;  4RC7 B;  2RBD A;  3BVK A;  3QHB A;  2YW7 A;  3DBY A;  3F34 A;  3R2H A;  5HQO A;  2WWX B;  2V2J A;  5LBH A;  4ZL6 A;  2FG4 A;  3T9J A;  4IWJ A;  2CN6 A;  4PGI A;  3RGD A;  4TW3 A;  5AXS A;  2XJN A;  5JDO B;  5JKL G;  2V2R A;  2C6R A;  4KVS A;  1OTK A;  3R2S A;  3PVY B;  4Y08 A;  3GGY A;  2V2N A;  3VVA A;  4ZLW A;  1JYB A;  3D19 A;  1XZ3 A;  5D8Q A;  4IXK A;  2ZA6 A;  3NP2 X;  2XKQ A;  3FRS A;  2WLU A;  4CVR A;  5C6F A;  1ZUJ A;  4CMY A;  4DYY A;  5E2D A;  4EVC A;  1H96 A;  3EGM A;  3KHK A;  4CVS A;  1R03 A;  2V15 A;  1RCE A;  4ZKW A;  3O7S A;  1FHA A;  1XZ1 A;  3PW1 A;  2Y44 A;  1IER A;  2X17 0;  1NF6 A;  2W0O A;  4AM4 A;  1MOJ A;  1Z6O A;  3F38 A;  3OGH A;  4REU A;  5LG8 A;  4XKT A;  2FFX J;  3IS8 A;  1JI5 A;  4MJY A;  3WVU A;  1HRS A;  2YW6 A;  3ES3 A;  4ISM A;  5D8P A;  5D8X A;  1YUZ A;  5LS9 A;  3AF8 X;  3HL1 A;  1YUX A;  4EVD A;  3E1N A;  3UOI A;  3C21 A;  2VXI A;  4II4 A;  3F32 A;  3UFB A;  5FFC A;  2WTL A;  2BJY A;  4P18 A;  2PYB A;  2CIH A;  3R2L A;  1F33 A;  5JAC A;  5K53 A;  2GS4 A;  3GHQ A;  2FHA A;  5CMQ A;  4IWK A;  3VNX A;  4CYA A;  4AM2 A;  3KA3 A;  4YXJ A;  3O7R A;  3PZA A;  4ERU A;  5JKL A;  2WLA A;  3SID A;  3AJP A;  3Q4R A;  3E1M A;  3GE4 A;  1TK6 A;  2HR5 A;  3V3K B;  4DYU A;  4DAS A;  1O9R A;  4RC5 A;  1JI4 A;  5HU6 D;  1DAT A;  1EUM A;  3KX9 A;  4DE6 A;  1BFR A;  2MGY A;  4TO9 A;  1DVB A;  3M6J A;  3KA6 A;  2XGW A;  4TOG A;  4WJG 4;  4TOE A;  3PWQ A;  4QUW A;  3R2K A;  4A25 A;  3R2O A;  2CHP A;  2JD8 0;  2HTN A;  2BW1 A;  1BCF A;  4ZJK A;  1VEL A;  4M34 A;  3E1Q A;  3F35 A;  2FKZ A;  3SHX A;  4E6K A;  2AR0 A;  3BT5 A;  5J93 A;  4R42 A;  3WNW A;  1UVH A;  3QHC A;  3BKN A;  4OYN A;  4LPN A;  2IY4 A;  4ZKH A;  5CZU A;  1F30 A;  5FFA A;  2V2L A;  2N02 A;  3NP0 X;  3PW8 A;  4PG0 A;  2CN7 A;  2JD6 0;  3H7G A;  4DZ0 A;  4U3G A;  2GYD A;  1L8H A;  3TA8 A;  4XKU A;  5E1U A;  2C2F A;  4ZTT A;  3QB9 A;  1J30 A;  3E1L A;  3PVR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...