3UOIA

Mycobacterium tuberculosis bacterioferritin, bfra
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
159
structure length
159
Chain Sequence
MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQDNWGFTELAAHTRAESFDEMRHAEEITDRILLLDGLPNYQRIGSLRIGQTLREQFEADLAIEYDVLNRLKPGIVMCREKQDTTSAVLLEKIVADEEEHIDYLETQLELMDKLGEELYSAQCVSRPPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Bacterioferritin
publication title Mycobacterium tuberculosis bacterioferritin, BfrA
rcsb
source organism Mycobacterium tuberculosis
total genus 73
structure length 159
sequence length 159
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, a, b, c, d, e, f, g, h, i, j, k, l, m, n, o, p, q, r, s, t, u, v, w, x
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3uoiA00
1UVHA 3TA8A 3F39A 2ZG9X 5JKMA 1JI5A 3F36A 3F34A 2FKZA 4XKSA 1IERA 2CEIA 3QZ3A 2YJKA 5LS9A 4Z3BA 4ZTTA 3E1LA 4LQJA 4AM2A 3UOFA 5E1UA 2YW6A 4M33A 4AM5A 3QVDA 3UNOA 2GYDA 2YW7A 2V2NA 4CY9A 2D5KA 4LYUA 3PWFA 4ERUA 3NP2X 5JKMG 3F38A 4XGSA 2JD80 1OTKA 4OYNA 4CVSA 4ISPA 3SH6A 1LKPA 4DYZA 2ZA7A 4YKHA 4ITTA 1J30A 5JACA 4DZ0A 4ITWA 2QQYA 5GOUA 4ZKXA 3PVTA 4RC7A 3E6SA 4ZMCA 3AJOA 2GS4A 3GVYA 2HR5A 1O9RA 3FVBA 3Q4NA 3E1MA 4RC6A 2FFXJ 2Z90A 5HQOA 2F7NA 4ML5A 2HTNA 2C6RA 3FSEA 2FZFA 3NP0X 3BVFA 4RC8A 2V15A 3PVRB 2W0OA 3RGDA 1JTSA 2XJOA 4XKTA 2CHIA 3AJPA 5LG8A 4CVRA 3R2OA 2BJYA 3R2MA 3KX9A 2V2LA 1SOFA 5CZUA 5K52A 4A25A 1JKVA 4TOCA 2IB0A 4DI0A 5ERKA 5D8SA 2Z6MA 2WLAA 3O7SA 3KA9A 4IXKA 3BT5A 3GHQA 3MPSA 1MFRA 2JD70 3AJQA 2OC5A 4DYYA 3O7RA 3WVUA 5ERJA 1F33A 4CMYA 4LPJA 2JD60 5IX6A 1O9IA 4E6KA 3QHBA 1HRSA 5AXSA 4REUA 5C6FA 5D8XA 4TOAA 2G4HA 1L8HA 2IY4A 3PVTB 5J8WA 1RCIA 3E1OA 3PWQC 4KVSA 1JI4A 5D8PA 4RC7B 1UMNA 1B71A 3BVEA 2FG4A 3KA8A 2PYBA 3R2KA 2ZG7X 3AF7X 5JKLA 3ISFA 3RAVA 5GN8A 4TO9A 4EVBA 2XJMA 4RC6B 3U90A 4AM4A 2Z5RA 4TOHA 4MUDA 1RYTA 1JGCA 4RC5B 1GWGA 2V2OA 3IQ1A 2BK6A 4TOBA 1IESA 1TK6A 2QF9A 1LKMA 3T9JA 4DE6A 3F32A 4QUWA 5K53A 5JKLG 3BVLA 2BKCA 4PGKA 1VJXA 3F35A 1N1QA 1TJOA 3IS8A 1AEWA 1BCFA 3AK8A 2C41A 1F30A 2XKQA 5D8QA 3KWOA 2CLBA 2XJNA 4EVCA 5GU0X 3EZ0A 2V2JA 1RCEA 3ISEA 3SHXA 3FI6A 1VLGA 1DATA 5GU1X 4LPNA 1DPSA 3Q4OA 1NF6A 4RC5A 3SE1A 4XKUA 3ES3A 3IS7A 1BG7A 3AF9X 1YUXA 4MKUA 5E2DA 5GU3X 3Q4RA 3WVVA 4M35A 2UX1A 1JIGA 2FJCA 1S2ZA 1BFRA 2OH3A 2C2UA 1VEQA 3AK9A 3PW1A 2Z5QA 5J93A 3PWQA 1VEIA 2YJJA 2Z5PA 4PGIA 3SIDA 2ZURX 3GE4A 3WVWA 4LQVA 3R2LA 4LQHA 1XZ3A 3KA4A 5GN8B 2Y3QA 1LKOA 2CLUA 2WTLA 4LYXA 4Y08A 4CVPA 4LQNA 1TKPA 2FG8A 3PVYA 3E2CA 1VELA 4KVQA 3E1QA 5HJFA 4ZKHA 3F33A 2V2MA 3KA3A 3WNWA 3QHCA 4PG0A 2ZA8A 5FFEA 5FFBA 1R03A 4TOEA 3EGMA 5D8RA 5FEJA 1JREA 5J8SA 4MY7A 3OGHA 3EZUA 1QGHA 1FHAA 2CIHA 3PZAA 2VXIA 4ZJKA 4ZL5A 2XGWA 1JYBA 1XZ1A 2ITBA 2CN6A 3PW8A 3QB9A 4LPMA 1NNQA 4II4B 1RCGA 5D8YA 2IU2A 2ZA6A 4EVEA 2X170 4ZKWA 3H7GA 3BKNA 3HIUA 5FFAA 2GYQA 2CHPA 3AF8X 1LB3A 3KA6A 3PW1B 4MJYA 1ZS3A 5GU2X 2FHAA 2V2IA 3R2RA 4KVRA 4CVTA 4U3GA 1MOJA 3R2SA 3VNXA 4DYUA 2WLUA 3A68A 2BW1A 5FFDA 4M34A 2CN7A 3F37A 1ZUJA 5LBHA 1DVBA 5D8OA 3OJ5A 1L8IA 5CMRA 4DYXA 3PVYB 5CMQA 3PW8C 3RD0A 3NOZX 4II4A 4ISMA 2CF7A 3RE7A 3ERZA 5HJHA 2ZG8X 2V2SA 4P18A 4DASA 1Z4AA 4TOGA 3RBCA 4ZL6A 1S30A 4ETRA 1EUMA 1JKUA 4IWJA 5FFCA 3KXUA 5LG2A 4CMYV 1SQ3A 3BVIA 3QD8A 3Q4QA 1YV1A 4IWKA 5J9VA 4CYAA 4TOFA 4EVDA 1RCDA 2V2RA 1RCCA 1NF4A 4ZLWA 3R2HA 1Z6OA 3E6RA 2RBDA 3E1JA 1YUZA 3UOIA 4Z5SA 4R42A 2FL0A 3E1PA 3E1NA 2C2FA 2V2PA 4TODA 1KRQA 4CYBA 2VZBA 2C2JA 1Z6OM 1S3QA 4PG1A 4MN9A 1TKOA 3BVKA 4TW3A 2VXXA 1NFVA 5I4JA 4M32A 3PVRA 1QYBA 3HL1A 3A9QA 1H96A
chains in the Genus database with same CATH superfamily
1UVHA 3GGYA 3TA8A 3F39A 2ZG9X 5JKMA 1JI5A 3F36A 3F34A 2FKZA 4XKSA 1IERA 2CEIA 3QZ3A 2YJKA 3LKDA 5LS9A 4Z3BA 4ZTTA 3E1LA 4LQJA 4AM2A 3UOFA 5E1UA 2YW6A 4M33A 4AM5A 3QVDA 3UNOA 2GYDA 2YW7A 3DBYA 2MGYA 2V2NA 4CY9A 2D5KA 4LYUA 3PWFA 4ERUA 3NP2X 5JKMG 3F38A 4XGSA 2JD80 1OTKA 3C23A 4OYNA 4CVSA 4ISPA 3SH6A 1LKPA 4DYZA 2ZA7A 4YKHA 4ITTA 1J30A 5JACA 3UFBA 4DZ0A 4ITWA 2QQYA 5GOUA 4ZKXA 3PVTA 5JDOB 4RC7A 3E6SA 4ZMCA 3AJOA 2GS4A 3GVYA 2HR5A 1O9RA 3FVBA 3KDQA 3Q4NA 3E1MA 4RC6A 2FFXJ 2Z90A 5HQOA 2F7NA 4ML5A 2HTNA 2C6RA 3FSEA 2FZFA 3NP0X 3BVFA 4RC8A 2V15A 3PVRB 2W0OA 3RGDA 2V8TA 3W54A 1JTSA 2XJOA 4XKTA 2CHIA 3AJPA 4E40A 5LG8A 4CVRA 3R2OA 2BJYA 3R2MA 3KX9A 2V2LA 1SOFA 5CZUA 2N02A 5K52A 4A25A 2AR0A 1JKVA 4TOCA 2IB0A 4DI0A 5ERKA 5D8SA 2Z6MA 2WLAA 3O7SA 3KA9A 4IXKA 3BT5A 3GHQA 3MPSA 1MFRA 2JD70 3AJQA 2OC5A 4DYYA 3O7RA 3WVUA 5ERJA 1F33A 4CMYA 4LPJA 4YXJA 2JD60 5IX6A 1O9IA 4E6KA 3QHBA 1HRSA 2OKCA 3L0MA 5AXSA 4REUA 5C6FA 5D8XA 4TOAA 2G4HA 2WWXB 1L8HA 2IY4A 3PVTB 5J8WA 1RCIA 3E1OA 3PWQC 4KVSA 1JI4A 5D8PA 4RC7B 1UMNA 1B71A 3BVEA 2FG4A 3KA8A 2PYBA 3R2KA 2ZG7X 3JZ9A 3AF7X 5JKLA 3ISFA 3RAVA 5GN8A 4TO9A 4EVBA 3GGZA 2XJMA 4RC6B 3U90A 4AM4A 2Z5RA 4TOHA 4MUDA 1RYTA 1JGCA 4RC5B 1GWGA 2V2OA 3IQ1A 2BK6A 4TOBA 3KHKA 1IESA 1TK6A 2QF9A 1LKMA 3T9JA 4DE6A 3F32A 4QUWA 4X0JA 5K53A 5JKLG 3BVLA 2BKCA 4PGKA 1VJXA 3F35A 1N1QA 1TJOA 3IS8A 1AEWA 1BCFA 3AK8A 2C41A 1F30A 2XKQA 5D8QA 3KWOA 3V3KB 2CLBA 2XJNA 3VVAA 4EVCA 5GU0X 3EZ0A 2V2JA 1RCEA 3ISEA 3SHXA 3FI6A 1VLGA 1DATA 5GU1X 4LPNA 1DPSA 3Q4OA 1NF6A 4RC5A 3SE1A 4XKUA 3ES3A 3IS7A 1BG7A 3AF9X 3JZAB 1YUXA 4MKUA 5E2DA 5GU3X 3Q4RA 3WVVA 4M35A 2UX1A 1JIGA 2FJCA 1S2ZA 1BFRA 2OH3A 2C2UA 1VEQA 3AK9A 3PW1A 2Z5QA 5J93A 3PWQA 1VEIA 2YJJA 2Z5PA 4PGIA 3SIDA 2ZURX 3GE4A 3WVWA 4LQVA 3R2LA 4LQHA 1XZ3A 3KA4A 5GN8B 2Y3QA 1LKOA 2CLUA 2WTLA 4LYXA 4Y08A 4CVPA 4LQNA 1TKPA 2FG8A 3PVYA 2CWLA 3E2CA 2G38B 1VELA 4KVQA 3E1QA 5HJFA 4ZKHA 3F33A 2V2MA 3KA3A 3WNWA 3QHCA 4PG0A 2ZA8A 5FFEA 3VV9A 5FFBA 1R03A 4W4KB 5HU6D 4TOEA 3EGMA 5D8RA 5FEJA 1JREA 5J8SA 4MY7A 3OGHA 3EZUA 1QGHA 1FHAA 2CIHA 3PZAA 2VXIA 4ZJKA 4ZL5A 3D19A 2XGWA 1JYBA 1XZ1A 2ITBA 2CN6A 3PW8A 3C1ZA 4W4LB 4YVZA 3QB9A 4LPMA 1NNQA 4II4B 1RCGA 5D8YA 2IU2A 2ZA6A 4EVEA 2X170 4ZKWA 3H7GA 3BKNA 3HIUA 5FFAA 2GYQA 2CHPA 3AF8X 4MXPA 2Y44A 1LB3A 3KA6A 3PW1B 4MJYA 1ZS3A 5GU2X 2FHAA 2V2IA 3R2RA 4KVRA 4CVTA 4U3GA 1MOJA 3R2SA 3VNXA 4DYUA 2WLUA 3A68A 2BW1A 5FFDA 4M34A 2CN7A 3F37A 4WJG4 1ZUJA 5LBHA 1DVBA 5D8OA 3OJ5A 4YXMA 1L8IA 5CMRA 4DYXA 3PVYB 5CMQA 3PW8C 3RD0A 3NOZX 4II4A 4ISMA 2CF7A 3RE7A 3ERZA 5HJHA 2ZG8X 2V2SA 4P18A 4DASA 2V8UA 1Z4AA 4TOGA 4KXRB 4ZL6A 3RBCA 1S30A 3FRSA 4ETRA 1EUMA 1JKUA 4IWJA 5FFCA 3KXUA 5LG2A 4CMYV 1SQ3A 3BVIA 3QD8A 3Q4QA 1YV1A 4IWKA 5J9VA 3FRRA 4CYAA 4TOFA 4EVDA 1RCDA 3N6OA 2V2RA 1RCCA 1NF4A 4ZLWA 3R2HA 1Z6OA 3E6RA 5JDOA 2RBDA 3E1JA 1YUZA 3UOIA 4Z5SA 4R42A 2FL0A 3E1PA 3E1NA 2C2FA 2V2PA 3C1YA 4TODA 1KRQA 4CYBA 2VZBA 2C2JA 1Z6OM 3C21A 1S3QA 4PG1A 4MN9A 1TKOA 3BVKA 3M6JA 4TW3A 2VXXA 1NFVA 5I4JA 4M32A 3PVRA 1QYBA 3HL1A 3A9QA 1H96A
chains in the Genus database with same CATH topology
1UVHA 3GGYA 3TA8A 3F39A 2ZG9X 5JKMA 1JI5A 3F36A 3F34A 2FKZA 4XKSA 1IERA 2CEIA 3QZ3A 2YJKA 3LKDA 5LS9A 4Z3BA 4ZTTA 3E1LA 4LQJA 4AM2A 3UOFA 5E1UA 2YW6A 4M33A 4AM5A 3QVDA 3UNOA 2GYDA 2YW7A 3DBYA 2MGYA 2V2NA 4CY9A 2D5KA 4LYUA 3PWFA 4ERUA 3NP2X 5JKMG 3F38A 4XGSA 2JD80 1OTKA 3C23A 4OYNA 4CVSA 4ISPA 3SH6A 1LKPA 4DYZA 2ZA7A 4YKHA 4ITTA 1J30A 5JACA 3UFBA 4DZ0A 4ITWA 2QQYA 5GOUA 4ZKXA 3PVTA 5JDOB 4RC7A 3E6SA 4ZMCA 3AJOA 2GS4A 3GVYA 2HR5A 1O9RA 3FVBA 3KDQA 3Q4NA 3E1MA 4RC6A 2FFXJ 2Z90A 5HQOA 2F7NA 4ML5A 2HTNA 2C6RA 3FSEA 2FZFA 3NP0X 3BVFA 4RC8A 2V15A 3PVRB 2W0OA 3RGDA 2V8TA 3W54A 1JTSA 2XJOA 4XKTA 2CHIA 3AJPA 4E40A 5LG8A 4CVRA 3R2OA 2BJYA 3R2MA 3KX9A 2V2LA 1SOFA 5CZUA 2N02A 5K52A 4A25A 2AR0A 1JKVA 4TOCA 2IB0A 4DI0A 5ERKA 5D8SA 2Z6MA 2WLAA 3O7SA 3KA9A 4IXKA 3BT5A 3GHQA 3MPSA 1MFRA 2JD70 3AJQA 2OC5A 4DYYA 3O7RA 3WVUA 5ERJA 1F33A 4CMYA 4LPJA 4YXJA 2JD60 5IX6A 1O9IA 4E6KA 3QHBA 1HRSA 2OKCA 3L0MA 5AXSA 4REUA 5C6FA 5D8XA 4TOAA 2G4HA 2WWXB 1L8HA 2IY4A 3PVTB 5J8WA 1RCIA 3E1OA 3PWQC 4KVSA 1JI4A 5D8PA 4RC7B 1UMNA 1B71A 3BVEA 2FG4A 3KA8A 2PYBA 3R2KA 2ZG7X 3JZ9A 3AF7X 5JKLA 3ISFA 3RAVA 5GN8A 4TO9A 4EVBA 3GGZA 2XJMA 4RC6B 3U90A 4AM4A 2Z5RA 4TOHA 4MUDA 1RYTA 1JGCA 4RC5B 1GWGA 2V2OA 3IQ1A 2BK6A 4TOBA 3KHKA 1IESA 1TK6A 2QF9A 1LKMA 3T9JA 4DE6A 3F32A 4QUWA 4X0JA 5K53A 5JKLG 3BVLA 2BKCA 4PGKA 1VJXA 3F35A 1N1QA 1TJOA 3IS8A 1AEWA 1BCFA 3AK8A 2C41A 1F30A 2XKQA 5D8QA 3KWOA 3V3KB 2CLBA 2XJNA 3VVAA 4EVCA 5GU0X 3EZ0A 2V2JA 1RCEA 3ISEA 3SHXA 3FI6A 1VLGA 1DATA 5GU1X 4LPNA 1DPSA 3Q4OA 1NF6A 4RC5A 3SE1A 4XKUA 3ES3A 3IS7A 1BG7A 3AF9X 3JZAB 1YUXA 4MKUA 5E2DA 5GU3X 3Q4RA 3WVVA 4M35A 2UX1A 1JIGA 2FJCA 1S2ZA 1BFRA 2OH3A 2C2UA 1VEQA 3AK9A 3PW1A 2Z5QA 5J93A 3PWQA 1VEIA 2YJJA 2Z5PA 4PGIA 3SIDA 2ZURX 3GE4A 3WVWA 4LQVA 3R2LA 4LQHA 1XZ3A 3KA4A 5GN8B 2Y3QA 1LKOA 2CLUA 2WTLA 4LYXA 4Y08A 4CVPA 4LQNA 1TKPA 2FG8A 3PVYA 2CWLA 3E2CA 2G38B 1VELA 4KVQA 3E1QA 5HJFA 4ZKHA 3F33A 2V2MA 3KA3A 3WNWA 3QHCA 4PG0A 2ZA8A 5FFEA 3VV9A 5FFBA 1R03A 4W4KB 5HU6D 4TOEA 3EGMA 5D8RA 5FEJA 1JREA 5J8SA 4MY7A 3OGHA 3EZUA 1QGHA 1FHAA 2CIHA 3PZAA 2VXIA 4ZJKA 4ZL5A 3D19A 2XGWA 1JYBA 1XZ1A 2ITBA 2CN6A 3PW8A 3C1ZA 4W4LB 4YVZA 3QB9A 4LPMA 1NNQA 4II4B 1RCGA 5D8YA 2IU2A 2ZA6A 4EVEA 2X170 4ZKWA 3H7GA 3BKNA 3HIUA 5FFAA 2GYQA 2CHPA 3AF8X 4MXPA 2Y44A 1LB3A 3KA6A 3PW1B 4MJYA 1ZS3A 5GU2X 2FHAA 2V2IA 3R2RA 4KVRA 4CVTA 4U3GA 1MOJA 3R2SA 3VNXA 4DYUA 2WLUA 3A68A 2BW1A 5FFDA 4M34A 2CN7A 3F37A 4WJG4 1ZUJA 5LBHA 1DVBA 5D8OA 3OJ5A 4YXMA 1L8IA 5CMRA 4DYXA 3PVYB 5CMQA 3PW8C 3RD0A 3NOZX 4II4A 4ISMA 2CF7A 3RE7A 3ERZA 5HJHA 2ZG8X 2V2SA 4P18A 4DASA 2V8UA 1Z4AA 4TOGA 4KXRB 4ZL6A 3RBCA 1S30A 3FRSA 4ETRA 1EUMA 1JKUA 4IWJA 5FFCA 3KXUA 5LG2A 4CMYV 1SQ3A 3BVIA 3QD8A 3Q4QA 1YV1A 4IWKA 5J9VA 3FRRA 4CYAA 4TOFA 4EVDA 1RCDA 3N6OA 2V2RA 1RCCA 1NF4A 4ZLWA 3R2HA 1Z6OA 3E6RA 5JDOA 2RBDA 3E1JA 1YUZA 3UOIA 4Z5SA 4R42A 2FL0A 3E1PA 3E1NA 2C2FA 2V2PA 3C1YA 4TODA 1KRQA 4CYBA 2VZBA 2C2JA 1Z6OM 3C21A 1S3QA 4PG1A 4MN9A 1TKOA 3BVKA 3M6JA 4TW3A 2VXXA 1NFVA 5I4JA 4M32A 3PVRA 1QYBA 3HL1A 3A9QA 1H96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UVH A;  3TA8 A;  3F39 A;  2ZG9 X;  5JKM A;  1JI5 A;  3F36 A;  3F34 A;  2FKZ A;  4XKS A;  1IER A;  2CEI A;  3QZ3 A;  2YJK A;  5LS9 A;  4Z3B A;  4ZTT A;  3E1L A;  4LQJ A;  4AM2 A;  3UOF A;  5E1U A;  2YW6 A;  4M33 A;  4AM5 A;  3QVD A;  3UNO A;  2GYD A;  2YW7 A;  2V2N A;  4CY9 A;  2D5K A;  4LYU A;  3PWF A;  4ERU A;  3NP2 X;  5JKM G;  3F38 A;  4XGS A;  2JD8 0;  1OTK A;  4OYN A;  4CVS A;  4ISP A;  3SH6 A;  1LKP A;  4DYZ A;  2ZA7 A;  4YKH A;  4ITT A;  1J30 A;  5JAC A;  4DZ0 A;  4ITW A;  2QQY A;  5GOU A;  4ZKX A;  3PVT A;  4RC7 A;  3E6S A;  4ZMC A;  3AJO A;  2GS4 A;  3GVY A;  2HR5 A;  1O9R A;  3FVB A;  3Q4N A;  3E1M A;  4RC6 A;  2FFX J;  2Z90 A;  5HQO A;  2F7N A;  4ML5 A;  2HTN A;  2C6R A;  3FSE A;  2FZF A;  3NP0 X;  3BVF A;  4RC8 A;  2V15 A;  3PVR B;  2W0O A;  3RGD A;  1JTS A;  2XJO A;  4XKT A;  2CHI A;  3AJP A;  5LG8 A;  4CVR A;  3R2O A;  2BJY A;  3R2M A;  3KX9 A;  2V2L A;  1SOF A;  5CZU A;  5K52 A;  4A25 A;  1JKV A;  4TOC A;  2IB0 A;  4DI0 A;  5ERK A;  5D8S A;  2Z6M A;  2WLA A;  3O7S A;  3KA9 A;  4IXK A;  3BT5 A;  3GHQ A;  3MPS A;  1MFR A;  2JD7 0;  3AJQ A;  2OC5 A;  4DYY A;  3O7R A;  3WVU A;  5ERJ A;  1F33 A;  4CMY A;  4LPJ A;  2JD6 0;  5IX6 A;  1O9I A;  4E6K A;  3QHB A;  1HRS A;  5AXS A;  4REU A;  5C6F A;  5D8X A;  4TOA A;  2G4H A;  1L8H A;  2IY4 A;  3PVT B;  5J8W A;  1RCI A;  3E1O A;  3PWQ C;  4KVS A;  1JI4 A;  5D8P A;  4RC7 B;  1UMN A;  1B71 A;  3BVE A;  2FG4 A;  3KA8 A;  2PYB A;  3R2K A;  2ZG7 X;  3AF7 X;  5JKL A;  3ISF A;  3RAV A;  5GN8 A;  4TO9 A;  4EVB A;  2XJM A;  4RC6 B;  3U90 A;  4AM4 A;  2Z5R A;  4TOH A;  4MUD A;  1RYT A;  1JGC A;  4RC5 B;  1GWG A;  2V2O A;  3IQ1 A;  2BK6 A;  4TOB A;  1IES A;  1TK6 A;  2QF9 A;  1LKM A;  3T9J A;  4DE6 A;  3F32 A;  4QUW A;  5K53 A;  5JKL G;  3BVL A;  2BKC A;  4PGK A;  1VJX A;  3F35 A;  1N1Q A;  1TJO A;  3IS8 A;  1AEW A;  1BCF A;  3AK8 A;  2C41 A;  1F30 A;  2XKQ A;  5D8Q A;  3KWO A;  2CLB A;  2XJN A;  4EVC A;  5GU0 X;  3EZ0 A;  2V2J A;  1RCE A;  3ISE A;  3SHX A;  3FI6 A;  1VLG A;  1DAT A;  5GU1 X;  4LPN A;  1DPS A;  3Q4O A;  1NF6 A;  4RC5 A;  3SE1 A;  4XKU A;  3ES3 A;  3IS7 A;  1BG7 A;  3AF9 X;  1YUX A;  4MKU A;  5E2D A;  5GU3 X;  3Q4R A;  3WVV A;  4M35 A;  2UX1 A;  1JIG A;  2FJC A;  1S2Z A;  1BFR A;  2OH3 A;  2C2U A;  1VEQ A;  3AK9 A;  3PW1 A;  2Z5Q A;  5J93 A;  3PWQ A;  1VEI A;  2YJJ A;  2Z5P A;  4PGI A;  3SID A;  2ZUR X;  3GE4 A;  3WVW A;  4LQV A;  3R2L A;  4LQH A;  1XZ3 A;  3KA4 A;  5GN8 B;  2Y3Q A;  1LKO A;  2CLU A;  2WTL A;  4LYX A;  4Y08 A;  4CVP A;  4LQN A;  1TKP A;  2FG8 A;  3PVY A;  3E2C A;  1VEL A;  4KVQ A;  3E1Q A;  5HJF A;  4ZKH A;  3F33 A;  2V2M A;  3KA3 A;  3WNW A;  3QHC A;  4PG0 A;  2ZA8 A;  5FFE A;  5FFB A;  1R03 A;  4TOE A;  3EGM A;  5D8R A;  5FEJ A;  1JRE A;  5J8S A;  4MY7 A;  3OGH A;  3EZU A;  1QGH A;  1FHA A;  2CIH A;  3PZA A;  2VXI A;  4ZJK A;  4ZL5 A;  2XGW A;  1JYB A;  1XZ1 A;  2ITB A;  2CN6 A;  3PW8 A;  3QB9 A;  4LPM A;  1NNQ A;  4II4 B;  1RCG A;  5D8Y A;  2IU2 A;  2ZA6 A;  4EVE A;  2X17 0;  4ZKW A;  3H7G A;  3BKN A;  3HIU A;  5FFA A;  2GYQ A;  2CHP A;  3AF8 X;  1LB3 A;  3KA6 A;  3PW1 B;  4MJY A;  1ZS3 A;  5GU2 X;  2FHA A;  2V2I A;  3R2R A;  4KVR A;  4CVT A;  4U3G A;  1MOJ A;  3R2S A;  3VNX A;  4DYU A;  2WLU A;  3A68 A;  2BW1 A;  5FFD A;  4M34 A;  2CN7 A;  3F37 A;  1ZUJ A;  5LBH A;  1DVB A;  5D8O A;  3OJ5 A;  1L8I A;  5CMR A;  4DYX A;  3PVY B;  5CMQ A;  3PW8 C;  3RD0 A;  3NOZ X;  4II4 A;  4ISM A;  2CF7 A;  3RE7 A;  3ERZ A;  5HJH A;  2ZG8 X;  2V2S A;  4P18 A;  4DAS A;  1Z4A A;  4TOG A;  3RBC A;  4ZL6 A;  1S30 A;  4ETR A;  1EUM A;  1JKU A;  4IWJ A;  5FFC A;  3KXU A;  5LG2 A;  4CMY V;  1SQ3 A;  3BVI A;  3QD8 A;  3Q4Q A;  1YV1 A;  4IWK A;  5J9V A;  4CYA A;  4TOF A;  4EVD A;  1RCD A;  2V2R A;  1RCC A;  1NF4 A;  4ZLW A;  3R2H A;  1Z6O A;  3E6R A;  2RBD A;  3E1J A;  1YUZ A;  3UOI A;  4Z5S A;  4R42 A;  2FL0 A;  3E1P A;  3E1N A;  2C2F A;  2V2P A;  4TOD A;  1KRQ A;  4CYB A;  2VZB A;  2C2J A;  1Z6O M;  1S3Q A;  4PG1 A;  4MN9 A;  1TKO A;  3BVK A;  4TW3 A;  2VXX A;  1NFV A;  5I4J A;  4M32 A;  3PVR A;  1QYB A;  3HL1 A;  3A9Q A;  1H96 A; 
#chains in the Genus database with same CATH topology
 1UVH A;  3GGY A;  3TA8 A;  3F39 A;  2ZG9 X;  5JKM A;  1JI5 A;  3F36 A;  3F34 A;  2FKZ A;  4XKS A;  1IER A;  2CEI A;  3QZ3 A;  2YJK A;  3LKD A;  5LS9 A;  4Z3B A;  4ZTT A;  3E1L A;  4LQJ A;  4AM2 A;  3UOF A;  5E1U A;  2YW6 A;  4M33 A;  4AM5 A;  3QVD A;  3UNO A;  2GYD A;  2YW7 A;  3DBY A;  2MGY A;  2V2N A;  4CY9 A;  2D5K A;  4LYU A;  3PWF A;  4ERU A;  3NP2 X;  5JKM G;  3F38 A;  4XGS A;  2JD8 0;  1OTK A;  3C23 A;  4OYN A;  4CVS A;  4ISP A;  3SH6 A;  1LKP A;  4DYZ A;  2ZA7 A;  4YKH A;  4ITT A;  1J30 A;  5JAC A;  3UFB A;  4DZ0 A;  4ITW A;  2QQY A;  5GOU A;  4ZKX A;  3PVT A;  5JDO B;  4RC7 A;  3E6S A;  4ZMC A;  3AJO A;  2GS4 A;  3GVY A;  2HR5 A;  1O9R A;  3FVB A;  3KDQ A;  3Q4N A;  3E1M A;  4RC6 A;  2FFX J;  2Z90 A;  5HQO A;  2F7N A;  4ML5 A;  2HTN A;  2C6R A;  3FSE A;  2FZF A;  3NP0 X;  3BVF A;  4RC8 A;  2V15 A;  3PVR B;  2W0O A;  3RGD A;  2V8T A;  3W54 A;  1JTS A;  2XJO A;  4XKT A;  2CHI A;  3AJP A;  4E40 A;  5LG8 A;  4CVR A;  3R2O A;  2BJY A;  3R2M A;  3KX9 A;  2V2L A;  1SOF A;  5CZU A;  2N02 A;  5K52 A;  4A25 A;  2AR0 A;  1JKV A;  4TOC A;  2IB0 A;  4DI0 A;  5ERK A;  5D8S A;  2Z6M A;  2WLA A;  3O7S A;  3KA9 A;  4IXK A;  3BT5 A;  3GHQ A;  3MPS A;  1MFR A;  2JD7 0;  3AJQ A;  2OC5 A;  4DYY A;  3O7R A;  3WVU A;  5ERJ A;  1F33 A;  4CMY A;  4LPJ A;  4YXJ A;  2JD6 0;  5IX6 A;  1O9I A;  4E6K A;  3QHB A;  1HRS A;  2OKC A;  3L0M A;  5AXS A;  4REU A;  5C6F A;  5D8X A;  4TOA A;  2G4H A;  2WWX B;  1L8H A;  2IY4 A;  3PVT B;  5J8W A;  1RCI A;  3E1O A;  3PWQ C;  4KVS A;  1JI4 A;  5D8P A;  4RC7 B;  1UMN A;  1B71 A;  3BVE A;  2FG4 A;  3KA8 A;  2PYB A;  3R2K A;  2ZG7 X;  3JZ9 A;  3AF7 X;  5JKL A;  3ISF A;  3RAV A;  5GN8 A;  4TO9 A;  4EVB A;  3GGZ A;  2XJM A;  4RC6 B;  3U90 A;  4AM4 A;  2Z5R A;  4TOH A;  4MUD A;  1RYT A;  1JGC A;  4RC5 B;  1GWG A;  2V2O A;  3IQ1 A;  2BK6 A;  4TOB A;  3KHK A;  1IES A;  1TK6 A;  2QF9 A;  1LKM A;  3T9J A;  4DE6 A;  3F32 A;  4QUW A;  4X0J A;  5K53 A;  5JKL G;  3BVL A;  2BKC A;  4PGK A;  1VJX A;  3F35 A;  1N1Q A;  1TJO A;  3IS8 A;  1AEW A;  1BCF A;  3AK8 A;  2C41 A;  1F30 A;  2XKQ A;  5D8Q A;  3KWO A;  3V3K B;  2CLB A;  2XJN A;  3VVA A;  4EVC A;  5GU0 X;  3EZ0 A;  2V2J A;  1RCE A;  3ISE A;  3SHX A;  3FI6 A;  1VLG A;  1DAT A;  5GU1 X;  4LPN A;  1DPS A;  3Q4O A;  1NF6 A;  4RC5 A;  3SE1 A;  4XKU A;  3ES3 A;  3IS7 A;  1BG7 A;  3AF9 X;  3JZA B;  1YUX A;  4MKU A;  5E2D A;  5GU3 X;  3Q4R A;  3WVV A;  4M35 A;  2UX1 A;  1JIG A;  2FJC A;  1S2Z A;  1BFR A;  2OH3 A;  2C2U A;  1VEQ A;  3AK9 A;  3PW1 A;  2Z5Q A;  5J93 A;  3PWQ A;  1VEI A;  2YJJ A;  2Z5P A;  4PGI A;  3SID A;  2ZUR X;  3GE4 A;  3WVW A;  4LQV A;  3R2L A;  4LQH A;  1XZ3 A;  3KA4 A;  5GN8 B;  2Y3Q A;  1LKO A;  2CLU A;  2WTL A;  4LYX A;  4Y08 A;  4CVP A;  4LQN A;  1TKP A;  2FG8 A;  3PVY A;  2CWL A;  3E2C A;  2G38 B;  1VEL A;  4KVQ A;  3E1Q A;  5HJF A;  4ZKH A;  3F33 A;  2V2M A;  3KA3 A;  3WNW A;  3QHC A;  4PG0 A;  2ZA8 A;  5FFE A;  3VV9 A;  5FFB A;  1R03 A;  4W4K B;  5HU6 D;  4TOE A;  3EGM A;  5D8R A;  5FEJ A;  1JRE A;  5J8S A;  4MY7 A;  3OGH A;  3EZU A;  1QGH A;  1FHA A;  2CIH A;  3PZA A;  2VXI A;  4ZJK A;  4ZL5 A;  3D19 A;  2XGW A;  1JYB A;  1XZ1 A;  2ITB A;  2CN6 A;  3PW8 A;  3C1Z A;  4W4L B;  4YVZ A;  3QB9 A;  4LPM A;  1NNQ A;  4II4 B;  1RCG A;  5D8Y A;  2IU2 A;  2ZA6 A;  4EVE A;  2X17 0;  4ZKW A;  3H7G A;  3BKN A;  3HIU A;  5FFA A;  2GYQ A;  2CHP A;  3AF8 X;  4MXP A;  2Y44 A;  1LB3 A;  3KA6 A;  3PW1 B;  4MJY A;  1ZS3 A;  5GU2 X;  2FHA A;  2V2I A;  3R2R A;  4KVR A;  4CVT A;  4U3G A;  1MOJ A;  3R2S A;  3VNX A;  4DYU A;  2WLU A;  3A68 A;  2BW1 A;  5FFD A;  4M34 A;  2CN7 A;  3F37 A;  4WJG 4;  1ZUJ A;  5LBH A;  1DVB A;  5D8O A;  3OJ5 A;  4YXM A;  1L8I A;  5CMR A;  4DYX A;  3PVY B;  5CMQ A;  3PW8 C;  3RD0 A;  3NOZ X;  4II4 A;  4ISM A;  2CF7 A;  3RE7 A;  3ERZ A;  5HJH A;  2ZG8 X;  2V2S A;  4P18 A;  4DAS A;  2V8U A;  1Z4A A;  4TOG A;  4KXR B;  4ZL6 A;  3RBC A;  1S30 A;  3FRS A;  4ETR A;  1EUM A;  1JKU A;  4IWJ A;  5FFC A;  3KXU A;  5LG2 A;  4CMY V;  1SQ3 A;  3BVI A;  3QD8 A;  3Q4Q A;  1YV1 A;  4IWK A;  5J9V A;  3FRR A;  4CYA A;  4TOF A;  4EVD A;  1RCD A;  3N6O A;  2V2R A;  1RCC A;  1NF4 A;  4ZLW A;  3R2H A;  1Z6O A;  3E6R A;  5JDO A;  2RBD A;  3E1J A;  1YUZ A;  3UOI A;  4Z5S A;  4R42 A;  2FL0 A;  3E1P A;  3E1N A;  2C2F A;  2V2P A;  3C1Y A;  4TOD A;  1KRQ A;  4CYB A;  2VZB A;  2C2J A;  1Z6O M;  3C21 A;  1S3Q A;  4PG1 A;  4MN9 A;  1TKO A;  3BVK A;  3M6J A;  4TW3 A;  2VXX A;  1NFV A;  5I4J A;  4M32 A;  3PVR A;  1QYB A;  3HL1 A;  3A9Q A;  1H96 A; 
#chains in the Genus database with same CATH homology
 1UVH A;  3GGY A;  3TA8 A;  3F39 A;  2ZG9 X;  5JKM A;  1JI5 A;  3F36 A;  3F34 A;  2FKZ A;  4XKS A;  1IER A;  2CEI A;  3QZ3 A;  2YJK A;  3LKD A;  5LS9 A;  4Z3B A;  4ZTT A;  3E1L A;  4LQJ A;  4AM2 A;  3UOF A;  5E1U A;  2YW6 A;  4M33 A;  4AM5 A;  3QVD A;  3UNO A;  2GYD A;  2YW7 A;  3DBY A;  2MGY A;  2V2N A;  4CY9 A;  2D5K A;  4LYU A;  3PWF A;  4ERU A;  3NP2 X;  5JKM G;  3F38 A;  4XGS A;  2JD8 0;  1OTK A;  3C23 A;  4OYN A;  4CVS A;  4ISP A;  3SH6 A;  1LKP A;  4DYZ A;  2ZA7 A;  4YKH A;  4ITT A;  1J30 A;  5JAC A;  3UFB A;  4DZ0 A;  4ITW A;  2QQY A;  5GOU A;  4ZKX A;  3PVT A;  5JDO B;  4RC7 A;  3E6S A;  4ZMC A;  3AJO A;  2GS4 A;  3GVY A;  2HR5 A;  1O9R A;  3FVB A;  3KDQ A;  3Q4N A;  3E1M A;  4RC6 A;  2FFX J;  2Z90 A;  5HQO A;  2F7N A;  4ML5 A;  2HTN A;  2C6R A;  3FSE A;  2FZF A;  3NP0 X;  3BVF A;  4RC8 A;  2V15 A;  3PVR B;  2W0O A;  3RGD A;  2V8T A;  3W54 A;  1JTS A;  2XJO A;  4XKT A;  2CHI A;  3AJP A;  4E40 A;  5LG8 A;  4CVR A;  3R2O A;  2BJY A;  3R2M A;  3KX9 A;  2V2L A;  1SOF A;  5CZU A;  2N02 A;  5K52 A;  4A25 A;  2AR0 A;  1JKV A;  4TOC A;  2IB0 A;  4DI0 A;  5ERK A;  5D8S A;  2Z6M A;  2WLA A;  3O7S A;  3KA9 A;  4IXK A;  3BT5 A;  3GHQ A;  3MPS A;  1MFR A;  2JD7 0;  3AJQ A;  2OC5 A;  4DYY A;  3O7R A;  3WVU A;  5ERJ A;  1F33 A;  4CMY A;  4LPJ A;  4YXJ A;  2JD6 0;  5IX6 A;  1O9I A;  4E6K A;  3QHB A;  1HRS A;  2OKC A;  3L0M A;  5AXS A;  4REU A;  5C6F A;  5D8X A;  4TOA A;  2G4H A;  2WWX B;  1L8H A;  2IY4 A;  3PVT B;  5J8W A;  1RCI A;  3E1O A;  3PWQ C;  4KVS A;  1JI4 A;  5D8P A;  4RC7 B;  1UMN A;  1B71 A;  3BVE A;  2FG4 A;  3KA8 A;  2PYB A;  3R2K A;  2ZG7 X;  3JZ9 A;  3AF7 X;  5JKL A;  3ISF A;  3RAV A;  5GN8 A;  4TO9 A;  4EVB A;  3GGZ A;  2XJM A;  4RC6 B;  3U90 A;  4AM4 A;  2Z5R A;  4TOH A;  4MUD A;  1RYT A;  1JGC A;  4RC5 B;  1GWG A;  2V2O A;  3IQ1 A;  2BK6 A;  4TOB A;  3KHK A;  1IES A;  1TK6 A;  2QF9 A;  1LKM A;  3T9J A;  4DE6 A;  3F32 A;  4QUW A;  4X0J A;  5K53 A;  5JKL G;  3BVL A;  2BKC A;  4PGK A;  1VJX A;  3F35 A;  1N1Q A;  1TJO A;  3IS8 A;  1AEW A;  1BCF A;  3AK8 A;  2C41 A;  1F30 A;  2XKQ A;  5D8Q A;  3KWO A;  3V3K B;  2CLB A;  2XJN A;  3VVA A;  4EVC A;  5GU0 X;  3EZ0 A;  2V2J A;  1RCE A;  3ISE A;  3SHX A;  3FI6 A;  1VLG A;  1DAT A;  5GU1 X;  4LPN A;  1DPS A;  3Q4O A;  1NF6 A;  4RC5 A;  3SE1 A;  4XKU A;  3ES3 A;  3IS7 A;  1BG7 A;  3AF9 X;  3JZA B;  1YUX A;  4MKU A;  5E2D A;  5GU3 X;  3Q4R A;  3WVV A;  4M35 A;  2UX1 A;  1JIG A;  2FJC A;  1S2Z A;  1BFR A;  2OH3 A;  2C2U A;  1VEQ A;  3AK9 A;  3PW1 A;  2Z5Q A;  5J93 A;  3PWQ A;  1VEI A;  2YJJ A;  2Z5P A;  4PGI A;  3SID A;  2ZUR X;  3GE4 A;  3WVW A;  4LQV A;  3R2L A;  4LQH A;  1XZ3 A;  3KA4 A;  5GN8 B;  2Y3Q A;  1LKO A;  2CLU A;  2WTL A;  4LYX A;  4Y08 A;  4CVP A;  4LQN A;  1TKP A;  2FG8 A;  3PVY A;  2CWL A;  3E2C A;  2G38 B;  1VEL A;  4KVQ A;  3E1Q A;  5HJF A;  4ZKH A;  3F33 A;  2V2M A;  3KA3 A;  3WNW A;  3QHC A;  4PG0 A;  2ZA8 A;  5FFE A;  3VV9 A;  5FFB A;  1R03 A;  4W4K B;  5HU6 D;  4TOE A;  3EGM A;  5D8R A;  5FEJ A;  1JRE A;  5J8S A;  4MY7 A;  3OGH A;  3EZU A;  1QGH A;  1FHA A;  2CIH A;  3PZA A;  2VXI A;  4ZJK A;  4ZL5 A;  3D19 A;  2XGW A;  1JYB A;  1XZ1 A;  2ITB A;  2CN6 A;  3PW8 A;  3C1Z A;  4W4L B;  4YVZ A;  3QB9 A;  4LPM A;  1NNQ A;  4II4 B;  1RCG A;  5D8Y A;  2IU2 A;  2ZA6 A;  4EVE A;  2X17 0;  4ZKW A;  3H7G A;  3BKN A;  3HIU A;  5FFA A;  2GYQ A;  2CHP A;  3AF8 X;  4MXP A;  2Y44 A;  1LB3 A;  3KA6 A;  3PW1 B;  4MJY A;  1ZS3 A;  5GU2 X;  2FHA A;  2V2I A;  3R2R A;  4KVR A;  4CVT A;  4U3G A;  1MOJ A;  3R2S A;  3VNX A;  4DYU A;  2WLU A;  3A68 A;  2BW1 A;  5FFD A;  4M34 A;  2CN7 A;  3F37 A;  4WJG 4;  1ZUJ A;  5LBH A;  1DVB A;  5D8O A;  3OJ5 A;  4YXM A;  1L8I A;  5CMR A;  4DYX A;  3PVY B;  5CMQ A;  3PW8 C;  3RD0 A;  3NOZ X;  4II4 A;  4ISM A;  2CF7 A;  3RE7 A;  3ERZ A;  5HJH A;  2ZG8 X;  2V2S A;  4P18 A;  4DAS A;  2V8U A;  1Z4A A;  4TOG A;  4KXR B;  4ZL6 A;  3RBC A;  1S30 A;  3FRS A;  4ETR A;  1EUM A;  1JKU A;  4IWJ A;  5FFC A;  3KXU A;  5LG2 A;  4CMY V;  1SQ3 A;  3BVI A;  3QD8 A;  3Q4Q A;  1YV1 A;  4IWK A;  5J9V A;  3FRR A;  4CYA A;  4TOF A;  4EVD A;  1RCD A;  3N6O A;  2V2R A;  1RCC A;  1NF4 A;  4ZLW A;  3R2H A;  1Z6O A;  3E6R A;  5JDO A;  2RBD A;  3E1J A;  1YUZ A;  3UOI A;  4Z5S A;  4R42 A;  2FL0 A;  3E1P A;  3E1N A;  2C2F A;  2V2P A;  3C1Y A;  4TOD A;  1KRQ A;  4CYB A;  2VZB A;  2C2J A;  1Z6O M;  3C21 A;  1S3Q A;  4PG1 A;  4MN9 A;  1TKO A;  3BVK A;  3M6J A;  4TW3 A;  2VXX A;  1NFV A;  5I4J A;  4M32 A;  3PVR A;  1QYB A;  3HL1 A;  3A9Q A;  1H96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...