2XJOA

Crystal structure of streptococcus suis dpr with nickel
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
150
structure length
150
Chain Sequence
ADSKAVLNQAVADLSVAHSILHQVHWYMRGRGFMIWHPKMDEYMEEIDGYLDEMSERLITLGGAPFSTLKEFSENSQLKEVLGDYNVTIEEQLARVVEVFRYLAALFQKGFDVSDEEGDSVTNDIFNVAKASIEKHIWMLQAELGQAPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DNA PROTECTION DURING STARVATION PROTEIN
publication title Structural and Thermodynamic Characterization of Metal Ion Binding in Streptococcus Suis Dpr.
pubmed doi rcsb
source organism Streptococcus suis
total genus 65
structure length 150
sequence length 150
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.16.-.-:
pdb deposition date 2010-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2xjoA00
3R2MA 3Q4QA 3BT5A 4M32A 1JTSA 1YV1A 1NF6A 1VEQA 1J30A 3TA8A 4Z3BA 2IY4A 4LQHA 3GHQA 1N1QA 3BVFA 3R2RA 5D8SA 2HTNA 5LS9A 3QHBA 5FFCA 3UOIA 4KVQA 4ZTTA 4II4A 4PGIA 4ZJKA 1VLGA 2CN7A 1MOJA 1YUXA 3KA4A 1YUZA 3GVYA 3Q4OA 1JI5A 4RC6A 3ISFA 4EVCA 4RC5B 5GU3X 3E1QA 3NOZX 1RCIA 2CHIA 1LKPA 3E6RA 4ZLWA 2CLUA 5HJFA 2YJJA 3F35A 3AF7X 1S30A 1R03A 3OJ5A 4ZKXA 4DE6A 3FSEA 3KA8A 4RC7A 3AF8X 5GU0X 5D8QA 2GYQA 3E1NA 4ZMCA 3PW8A 4TOGA 2IB0A 5IX6A 5JKMG 4DYUA 1JKVA 2XGWA 5FFEA 4IWJA 4Z5SA 5FFDA 1H96A 4CYBA 2ZG8X 3SHXA 1JI4A 2G4HA 3ERZA 3F38A 2FG4A 2GYDA 5ERKA 3ISEA 4MJYA 1Z6OM 1O9RA 4EVDA 4DYZA 4ISMA 2FJCA 1DPSA 3BVEA 2C2JA 5GOUA 4TW3A 1L8IA 3AJPA 1LB3A 4CMYA 4CVTA 5JKLA 4EVEA 1UVHA 3RE7A 2CEIA 3O7SA 1JREA 3AF9X 3PVRB 4PGKA 2WTLA 1ZS3A 3F37A 4U3GA 3RBCA 1JIGA 2Z5PA 4ZKHA 2V15A 2XJNA 5FFAA 1TK6A 5CMRA 1RYTA 1LKMA 2FFXJ 3PW1B 5LG8A 2HR5A 3PW8C 3QZ3A 1QYBA 4MUDA 1S2ZA 2OC5A 1VEIA 1VELA 1Z4AA 3QHCA 4ML5A 2C41A 4IXKA 3F33A 1XZ1A 4RC8A 3PVYB 3E1LA 2OH3A 3PVTB 2JD80 3U90A 2ZURX 3WVVA 3QD8A 4RC5A 1DVBA 4XKUA 4Y08A 3H7GA 3RD0A 5FEJA 4TOHA 2JD70 3E1PA 3T9JA 2ZG7X 4PG0A 2BKCA 5D8XA 1BFRA 3NP0X 3E2CA 4ZL6A 4KVSA 3F32A 3QVDA 1TKPA 2CN6A 2V2LA 1TJOA 3NP2X 4TOAA 3E1OA 1LKOA 4ZKWA 3KXUA 4MY7A 1NNQA 1RCEA 1O9IA 4ITWA 1TKOA 1RCDA 2XJMA 2V2PA 2V2OA 4M33A 5ERJA 3KA3A 5J8SA 5HQOA 5K53A 5JKLG 1RCCA 3SH6A 3R2SA 3PWFA 4EVBA 4DI0A 4KVRA 5GN8A 4IWKA 1GWGA 3RGDA 4AM2A 3WVUA 3KA9A 2FG8A 3KA6A 5LBHA 3ES3A 4XKTA 2WLUA 3QB9A 5J9VA 1ZUJA 2FHAA 1AEWA 2QQYA 2Z5RA 1XZ3A 5E1UA 4TO9A 1IESA 2W0OA 2X170 4TOBA 2V2RA 3AK9A 5D8PA 3E1MA 4M34A 2Y3QA 3FVBA 3RAVA 3PZAA 2FL0A 3O7RA 3MPSA 1IERA 1JKUA 3PVRA 4CYAA 1RCGA 5JACA 1BG7A 3UOFA 3HIUA 2BJYA 3GE4A 1SOFA 2XKQA 3KX9A 2C2UA 4TODA 3WNWA 2V2IA 5E2DA 4MKUA 2ZA6A 3UNOA 3PW1A 2PYBA 2VXXA 3F39A 3R2OA 4DYYA 3OGHA 4LPMA 2C2FA 2D5KA 4CVRA 3R2KA 3IQ1A 2C6RA 4LYUA 1UMNA 3Q4RA 3WVWA 3E6SA 2Z5QA 3AK8A 3FI6A 3PVYA 1B71A 4AM4A 5CMQA 3PVTA 3R2HA 3SE1A 3EZ0A 2UX1A 4CVPA 1MFRA 3KWOA 1KRQA 3BKNA 4E6KA 3IS7A 4ZL5A 2CHPA 1DATA 3F34A 1SQ3A 5GU2X 4DYXA 4II4B 4XKSA 1NFVA 4TOFA 4LPNA 1F30A 4LQNA 3BVLA 2IU2A 1OTKA 1L8HA 2XJOA 5C6FA 2ITBA 4LYXA 4LQJA 4RC6B 2JD60 1VJXA 4OYNA 4REUA 4A25A 2RBDA 4DASA 3A68A 4TOCA 4YKHA 2ZA8A 5D8YA 4CVSA 1QGHA 4ISPA 3BVKA 2BW1A 1HRSA 1JGCA 1EUMA 2V2JA 4RC7B 1NF4A 2YW7A 4AM5A 4M35A 3PWQA 1BCFA 2CLBA 3Q4NA 1S3QA 1Z6OA 2YJKA 4LQVA 4CY9A 4DZ0A 4ITTA 2CF7A 3EZUA 5K52A 4PG1A 5D8OA 1F33A 3IS8A 5LG2A 4ERUA 4R42A 5GN8B 5GU1X 2CIHA 2Z6MA 4CMYV 2V2SA 2BK6A 2VXIA 3AJQA 5D8RA 5JKMA 4MN9A 5J8WA 5I4JA 1JYBA 4QUWA 3SIDA 2F7NA 3R2LA 1FHAA 3E1JA 5HJHA 5AXSA 3A9QA 4XGSA 3AJOA 2Z90A 3F36A 4LPJA 2ZG9X 2FZFA 2FKZA 2V2MA 2V2NA 2ZA7A 4TOEA 2VZBA 2YW6A 4ETRA 5J93A 3HL1A 2WLAA 4P18A 5FFBA 3BVIA 3EGMA 3PWQC 5CZUA 3VNXA 2QF9A 2GS4A
chains in the Genus database with same CATH superfamily
3R2MA 3Q4QA 3D19A 3BT5A 3V3KB 4M32A 1JTSA 1YV1A 1NF6A 1VEQA 1J30A 3TA8A 4Z3BA 3L0MA 2IY4A 4LQHA 3GHQA 1N1QA 3BVFA 3R2RA 5D8SA 2HTNA 5LS9A 3QHBA 5FFCA 3C1ZA 3UOIA 4KVQA 4ZTTA 4II4A 4YVZA 4PGIA 4ZJKA 1VLGA 4W4KB 2CN7A 1MOJA 1YUXA 3KA4A 1YUZA 3GVYA 3Q4OA 1JI5A 4RC6A 3ISFA 4EVCA 4RC5B 5GU3X 3E1QA 3NOZX 1RCIA 2CHIA 1LKPA 3E6RA 4ZLWA 2CLUA 5HJFA 3GGYA 2YJJA 3F35A 2MGYA 3AF7X 1S30A 3W54A 1R03A 3OJ5A 4ZKXA 4DE6A 3FSEA 3KA8A 4RC7A 3AF8X 5GU0X 3C1YA 3KDQA 5D8QA 3JZ9A 2GYQA 3E1NA 4ZMCA 3PW8A 4TOGA 2IB0A 5IX6A 5JKMG 4DYUA 1JKVA 2XGWA 5FFEA 4IWJA 4Z5SA 5FFDA 1H96A 2Y44A 4CYBA 2ZG8X 3SHXA 1JI4A 2G4HA 3ERZA 3F38A 2FG4A 2GYDA 5ERKA 3ISEA 4MJYA 1Z6OM 1O9RA 4EVDA 4DYZA 5JDOA 4ISMA 2FJCA 1DPSA 3BVEA 2C2JA 5GOUA 4TW3A 1L8IA 3AJPA 1LB3A 4CMYA 4CVTA 5JKLA 4EVEA 1UVHA 4MXPA 3RE7A 2CEIA 3M6JA 4YXJA 2CWLA 3O7SA 1JREA 3AF9X 3PVRB 4PGKA 2WTLA 1ZS3A 3F37A 4U3GA 3RBCA 1JIGA 2Z5PA 4ZKHA 2V15A 2XJNA 5FFAA 1TK6A 5CMRA 1RYTA 1LKMA 2FFXJ 3PW1B 5LG8A 2HR5A 3C23A 3PW8C 3QZ3A 1QYBA 4MUDA 1S2ZA 3KHKA 2OC5A 1VEIA 4X0JA 1VELA 1Z4AA 3QHCA 4ML5A 2C41A 4IXKA 3F33A 1XZ1A 4RC8A 3PVYB 3E1LA 2OH3A 3PVTB 2JD80 3U90A 2ZURX 3WVVA 3QD8A 4RC5A 1DVBA 4XKUA 4Y08A 3H7GA 3RD0A 5FEJA 4TOHA 2JD70 4E40A 3E1PA 3T9JA 2ZG7X 4PG0A 2BKCA 5D8XA 1BFRA 3NP0X 3E2CA 4KXRB 4ZL6A 4KVSA 3F32A 3QVDA 1TKPA 2CN6A 2V2LA 1TJOA 3NP2X 4TOAA 3E1OA 1LKOA 4ZKWA 3KXUA 1NNQA 1RCEA 4MY7A 1O9IA 4ITWA 1TKOA 1RCDA 2XJMA 2V2PA 2V2OA 4M33A 5ERJA 3KA3A 5J8SA 5HQOA 5K53A 5JKLG 1RCCA 3SH6A 3R2SA 3PWFA 4WJG4 4EVBA 4DI0A 4KVRA 5GN8A 4IWKA 1GWGA 3RGDA 4AM2A 3WVUA 3KA9A 2FG8A 3KA6A 5LBHA 3ES3A 4XKTA 2WLUA 3QB9A 5J9VA 1ZUJA 2FHAA 1AEWA 2QQYA 2Z5RA 1XZ3A 5E1UA 4TO9A 1IESA 2W0OA 2X170 4TOBA 2V2RA 3AK9A 3JZAB 5D8PA 3E1MA 4M34A 2Y3QA 3FVBA 3RAVA 3PZAA 2FL0A 3O7RA 3MPSA 1IERA 1JKUA 2G38B 3PVRA 4CYAA 1RCGA 5JACA 1BG7A 3UOFA 3HIUA 2BJYA 3GE4A 1SOFA 2XKQA 3KX9A 2C2UA 4TODA 3WNWA 2V2IA 5E2DA 4MKUA 2ZA6A 3UNOA 3PW1A 2PYBA 2AR0A 2VXXA 3F39A 3R2OA 4DYYA 3OGHA 4LPMA 2C2FA 2D5KA 4CVRA 3R2KA 3IQ1A 2C6RA 4LYUA 1UMNA 3Q4RA 3WVWA 3E6SA 2Z5QA 3AK8A 3FI6A 3FRSA 1B71A 3PVYA 4AM4A 5CMQA 3PVTA 3R2HA 3SE1A 3EZ0A 2UX1A 4CVPA 1MFRA 3KWOA 1KRQA 3C21A 3BKNA 4E6KA 3IS7A 4ZL5A 2CHPA 1DATA 3F34A 1SQ3A 5GU2X 4DYXA 4II4B 4XKSA 1NFVA 2V8TA 4TOFA 4LPNA 2V8UA 1F30A 4LQNA 3BVLA 2IU2A 1OTKA 1L8HA 2XJOA 5C6FA 2ITBA 4LYXA 4LQJA 4RC6B 2JD60 1VJXA 4W4LB 4OYNA 4REUA 4A25A 2RBDA 4DASA 3A68A 4TOCA 4YKHA 3VV9A 2ZA8A 2OKCA 5D8YA 4CVSA 1QGHA 4ISPA 3BVKA 3FRRA 2N02A 2BW1A 1HRSA 1JGCA 1EUMA 2V2JA 4RC7B 1NF4A 3GGZA 2YW7A 3DBYA 4AM5A 5HU6D 4M35A 3PWQA 1BCFA 2CLBA 3VVAA 4YXMA 3Q4NA 1S3QA 1Z6OA 2YJKA 2WWXB 4LQVA 4CY9A 4DZ0A 4ITTA 2CF7A 3EZUA 5K52A 4PG1A 5D8OA 1F33A 3IS8A 5LG2A 4ERUA 4R42A 5GN8B 5GU1X 3N6OA 2CIHA 2Z6MA 5JDOB 4CMYV 2V2SA 2BK6A 2VXIA 3AJQA 5D8RA 5JKMA 4MN9A 5J8WA 5I4JA 1JYBA 4QUWA 3SIDA 3R2LA 2F7NA 1FHAA 3E1JA 5HJHA 5AXSA 3A9QA 4XGSA 3AJOA 2Z90A 3F36A 4LPJA 2ZG9X 2FZFA 2FKZA 2V2MA 2V2NA 3UFBA 2ZA7A 4TOEA 2VZBA 2YW6A 4ETRA 5J93A 3HL1A 2WLAA 4P18A 5FFBA 3BVIA 3LKDA 3EGMA 3PWQC 5CZUA 3VNXA 2QF9A 2GS4A
chains in the Genus database with same CATH topology
3R2MA 3Q4QA 3D19A 3BT5A 3V3KB 4M32A 1JTSA 1YV1A 1NF6A 1VEQA 1J30A 3TA8A 4Z3BA 3L0MA 2IY4A 4LQHA 3GHQA 1N1QA 3BVFA 3R2RA 5D8SA 2HTNA 5LS9A 3QHBA 5FFCA 3C1ZA 3UOIA 4KVQA 4ZTTA 4II4A 4YVZA 4PGIA 4ZJKA 1VLGA 4W4KB 2CN7A 1MOJA 1YUXA 3KA4A 1YUZA 3GVYA 3Q4OA 1JI5A 4RC6A 3ISFA 4EVCA 4RC5B 5GU3X 3E1QA 3NOZX 1RCIA 2CHIA 1LKPA 3E6RA 4ZLWA 2CLUA 5HJFA 3GGYA 2YJJA 3F35A 2MGYA 3AF7X 1S30A 3W54A 1R03A 3OJ5A 4ZKXA 4DE6A 3FSEA 3KA8A 4RC7A 3AF8X 5GU0X 3C1YA 3KDQA 5D8QA 3JZ9A 2GYQA 3E1NA 4ZMCA 3PW8A 4TOGA 2IB0A 5IX6A 5JKMG 4DYUA 1JKVA 2XGWA 5FFEA 4IWJA 4Z5SA 5FFDA 1H96A 2Y44A 4CYBA 2ZG8X 3SHXA 1JI4A 2G4HA 3ERZA 3F38A 2FG4A 2GYDA 5ERKA 3ISEA 4MJYA 1Z6OM 1O9RA 4EVDA 4DYZA 5JDOA 4ISMA 2FJCA 1DPSA 3BVEA 2C2JA 5GOUA 4TW3A 1L8IA 3AJPA 1LB3A 4CMYA 4CVTA 5JKLA 4EVEA 1UVHA 4MXPA 3RE7A 2CEIA 3M6JA 4YXJA 2CWLA 3O7SA 1JREA 3AF9X 3PVRB 4PGKA 2WTLA 1ZS3A 3F37A 4U3GA 3RBCA 1JIGA 2Z5PA 4ZKHA 2V15A 2XJNA 5FFAA 1TK6A 5CMRA 1RYTA 1LKMA 2FFXJ 3PW1B 5LG8A 2HR5A 3C23A 3PW8C 3QZ3A 1QYBA 4MUDA 1S2ZA 3KHKA 2OC5A 1VEIA 4X0JA 1VELA 1Z4AA 3QHCA 4ML5A 2C41A 4IXKA 3F33A 1XZ1A 4RC8A 3PVYB 3E1LA 2OH3A 3PVTB 2JD80 3U90A 2ZURX 3WVVA 3QD8A 4RC5A 1DVBA 4XKUA 4Y08A 3H7GA 3RD0A 5FEJA 4TOHA 2JD70 4E40A 3E1PA 3T9JA 2ZG7X 4PG0A 2BKCA 5D8XA 1BFRA 3NP0X 3E2CA 4KXRB 4ZL6A 4KVSA 3F32A 3QVDA 1TKPA 2CN6A 2V2LA 1TJOA 3NP2X 4TOAA 3E1OA 1LKOA 4ZKWA 3KXUA 1NNQA 1RCEA 4MY7A 1O9IA 4ITWA 1TKOA 1RCDA 2XJMA 2V2PA 2V2OA 4M33A 5ERJA 3KA3A 5J8SA 5HQOA 5K53A 5JKLG 1RCCA 3SH6A 3R2SA 3PWFA 4WJG4 4EVBA 4DI0A 4KVRA 5GN8A 4IWKA 1GWGA 3RGDA 4AM2A 3WVUA 3KA9A 2FG8A 3KA6A 5LBHA 3ES3A 4XKTA 2WLUA 3QB9A 5J9VA 1ZUJA 2FHAA 1AEWA 2QQYA 2Z5RA 1XZ3A 5E1UA 4TO9A 1IESA 2W0OA 2X170 4TOBA 2V2RA 3AK9A 3JZAB 5D8PA 3E1MA 4M34A 2Y3QA 3FVBA 3RAVA 3PZAA 2FL0A 3O7RA 3MPSA 1IERA 1JKUA 2G38B 3PVRA 4CYAA 1RCGA 5JACA 1BG7A 3UOFA 3HIUA 2BJYA 3GE4A 1SOFA 2XKQA 3KX9A 2C2UA 4TODA 3WNWA 2V2IA 5E2DA 4MKUA 2ZA6A 3UNOA 3PW1A 2PYBA 2AR0A 2VXXA 3F39A 3R2OA 4DYYA 3OGHA 4LPMA 2C2FA 2D5KA 4CVRA 3R2KA 3IQ1A 2C6RA 4LYUA 1UMNA 3Q4RA 3WVWA 3E6SA 2Z5QA 3AK8A 3FI6A 3FRSA 1B71A 3PVYA 4AM4A 5CMQA 3PVTA 3R2HA 3SE1A 3EZ0A 2UX1A 4CVPA 1MFRA 3KWOA 1KRQA 3C21A 3BKNA 4E6KA 3IS7A 4ZL5A 2CHPA 1DATA 3F34A 1SQ3A 5GU2X 4DYXA 4II4B 4XKSA 1NFVA 2V8TA 4TOFA 4LPNA 2V8UA 1F30A 4LQNA 3BVLA 2IU2A 1OTKA 1L8HA 2XJOA 5C6FA 2ITBA 4LYXA 4LQJA 4RC6B 2JD60 1VJXA 4W4LB 4OYNA 4REUA 4A25A 2RBDA 4DASA 3A68A 4TOCA 4YKHA 3VV9A 2ZA8A 2OKCA 5D8YA 4CVSA 1QGHA 4ISPA 3BVKA 3FRRA 2N02A 2BW1A 1HRSA 1JGCA 1EUMA 2V2JA 4RC7B 1NF4A 3GGZA 2YW7A 3DBYA 4AM5A 5HU6D 4M35A 3PWQA 1BCFA 2CLBA 3VVAA 4YXMA 3Q4NA 1S3QA 1Z6OA 2YJKA 2WWXB 4LQVA 4CY9A 4DZ0A 4ITTA 2CF7A 3EZUA 5K52A 4PG1A 5D8OA 1F33A 3IS8A 5LG2A 4ERUA 4R42A 5GN8B 5GU1X 3N6OA 2CIHA 2Z6MA 5JDOB 4CMYV 2V2SA 2BK6A 2VXIA 3AJQA 5D8RA 5JKMA 4MN9A 5J8WA 5I4JA 1JYBA 4QUWA 3SIDA 3R2LA 2F7NA 1FHAA 3E1JA 5HJHA 5AXSA 3A9QA 4XGSA 3AJOA 2Z90A 3F36A 4LPJA 2ZG9X 2FZFA 2FKZA 2V2MA 2V2NA 3UFBA 2ZA7A 4TOEA 2VZBA 2YW6A 4ETRA 5J93A 3HL1A 2WLAA 4P18A 5FFBA 3BVIA 3LKDA 3EGMA 3PWQC 5CZUA 3VNXA 2QF9A 2GS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R2M A;  3Q4Q A;  3BT5 A;  4M32 A;  1JTS A;  1YV1 A;  1NF6 A;  1VEQ A;  1J30 A;  3TA8 A;  4Z3B A;  2IY4 A;  4LQH A;  3GHQ A;  1N1Q A;  3BVF A;  3R2R A;  5D8S A;  2HTN A;  5LS9 A;  3QHB A;  5FFC A;  3UOI A;  4KVQ A;  4ZTT A;  4II4 A;  4PGI A;  4ZJK A;  1VLG A;  2CN7 A;  1MOJ A;  1YUX A;  3KA4 A;  1YUZ A;  3GVY A;  3Q4O A;  1JI5 A;  4RC6 A;  3ISF A;  4EVC A;  4RC5 B;  5GU3 X;  3E1Q A;  3NOZ X;  1RCI A;  2CHI A;  1LKP A;  3E6R A;  4ZLW A;  2CLU A;  5HJF A;  2YJJ A;  3F35 A;  3AF7 X;  1S30 A;  1R03 A;  3OJ5 A;  4ZKX A;  4DE6 A;  3FSE A;  3KA8 A;  4RC7 A;  3AF8 X;  5GU0 X;  5D8Q A;  2GYQ A;  3E1N A;  4ZMC A;  3PW8 A;  4TOG A;  2IB0 A;  5IX6 A;  5JKM G;  4DYU A;  1JKV A;  2XGW A;  5FFE A;  4IWJ A;  4Z5S A;  5FFD A;  1H96 A;  4CYB A;  2ZG8 X;  3SHX A;  1JI4 A;  2G4H A;  3ERZ A;  3F38 A;  2FG4 A;  2GYD A;  5ERK A;  3ISE A;  4MJY A;  1Z6O M;  1O9R A;  4EVD A;  4DYZ A;  4ISM A;  2FJC A;  1DPS A;  3BVE A;  2C2J A;  5GOU A;  4TW3 A;  1L8I A;  3AJP A;  1LB3 A;  4CMY A;  4CVT A;  5JKL A;  4EVE A;  1UVH A;  3RE7 A;  2CEI A;  3O7S A;  1JRE A;  3AF9 X;  3PVR B;  4PGK A;  2WTL A;  1ZS3 A;  3F37 A;  4U3G A;  3RBC A;  1JIG A;  2Z5P A;  4ZKH A;  2V15 A;  2XJN A;  5FFA A;  1TK6 A;  5CMR A;  1RYT A;  1LKM A;  2FFX J;  3PW1 B;  5LG8 A;  2HR5 A;  3PW8 C;  3QZ3 A;  1QYB A;  4MUD A;  1S2Z A;  2OC5 A;  1VEI A;  1VEL A;  1Z4A A;  3QHC A;  4ML5 A;  2C41 A;  4IXK A;  3F33 A;  1XZ1 A;  4RC8 A;  3PVY B;  3E1L A;  2OH3 A;  3PVT B;  2JD8 0;  3U90 A;  2ZUR X;  3WVV A;  3QD8 A;  4RC5 A;  1DVB A;  4XKU A;  4Y08 A;  3H7G A;  3RD0 A;  5FEJ A;  4TOH A;  2JD7 0;  3E1P A;  3T9J A;  2ZG7 X;  4PG0 A;  2BKC A;  5D8X A;  1BFR A;  3NP0 X;  3E2C A;  4ZL6 A;  4KVS A;  3F32 A;  3QVD A;  1TKP A;  2CN6 A;  2V2L A;  1TJO A;  3NP2 X;  4TOA A;  3E1O A;  1LKO A;  4ZKW A;  3KXU A;  4MY7 A;  1NNQ A;  1RCE A;  1O9I A;  4ITW A;  1TKO A;  1RCD A;  2XJM A;  2V2P A;  2V2O A;  4M33 A;  5ERJ A;  3KA3 A;  5J8S A;  5HQO A;  5K53 A;  5JKL G;  1RCC A;  3SH6 A;  3R2S A;  3PWF A;  4EVB A;  4DI0 A;  4KVR A;  5GN8 A;  4IWK A;  1GWG A;  3RGD A;  4AM2 A;  3WVU A;  3KA9 A;  2FG8 A;  3KA6 A;  5LBH A;  3ES3 A;  4XKT A;  2WLU A;  3QB9 A;  5J9V A;  1ZUJ A;  2FHA A;  1AEW A;  2QQY A;  2Z5R A;  1XZ3 A;  5E1U A;  4TO9 A;  1IES A;  2W0O A;  2X17 0;  4TOB A;  2V2R A;  3AK9 A;  5D8P A;  3E1M A;  4M34 A;  2Y3Q A;  3FVB A;  3RAV A;  3PZA A;  2FL0 A;  3O7R A;  3MPS A;  1IER A;  1JKU A;  3PVR A;  4CYA A;  1RCG A;  5JAC A;  1BG7 A;  3UOF A;  3HIU A;  2BJY A;  3GE4 A;  1SOF A;  2XKQ A;  3KX9 A;  2C2U A;  4TOD A;  3WNW A;  2V2I A;  5E2D A;  4MKU A;  2ZA6 A;  3UNO A;  3PW1 A;  2PYB A;  2VXX A;  3F39 A;  3R2O A;  4DYY A;  3OGH A;  4LPM A;  2C2F A;  2D5K A;  4CVR A;  3R2K A;  3IQ1 A;  2C6R A;  4LYU A;  1UMN A;  3Q4R A;  3WVW A;  3E6S A;  2Z5Q A;  3AK8 A;  3FI6 A;  3PVY A;  1B71 A;  4AM4 A;  5CMQ A;  3PVT A;  3R2H A;  3SE1 A;  3EZ0 A;  2UX1 A;  4CVP A;  1MFR A;  3KWO A;  1KRQ A;  3BKN A;  4E6K A;  3IS7 A;  4ZL5 A;  2CHP A;  1DAT A;  3F34 A;  1SQ3 A;  5GU2 X;  4DYX A;  4II4 B;  4XKS A;  1NFV A;  4TOF A;  4LPN A;  1F30 A;  4LQN A;  3BVL A;  2IU2 A;  1OTK A;  1L8H A;  2XJO A;  5C6F A;  2ITB A;  4LYX A;  4LQJ A;  4RC6 B;  2JD6 0;  1VJX A;  4OYN A;  4REU A;  4A25 A;  2RBD A;  4DAS A;  3A68 A;  4TOC A;  4YKH A;  2ZA8 A;  5D8Y A;  4CVS A;  1QGH A;  4ISP A;  3BVK A;  2BW1 A;  1HRS A;  1JGC A;  1EUM A;  2V2J A;  4RC7 B;  1NF4 A;  2YW7 A;  4AM5 A;  4M35 A;  3PWQ A;  1BCF A;  2CLB A;  3Q4N A;  1S3Q A;  1Z6O A;  2YJK A;  4LQV A;  4CY9 A;  4DZ0 A;  4ITT A;  2CF7 A;  3EZU A;  5K52 A;  4PG1 A;  5D8O A;  1F33 A;  3IS8 A;  5LG2 A;  4ERU A;  4R42 A;  5GN8 B;  5GU1 X;  2CIH A;  2Z6M A;  4CMY V;  2V2S A;  2BK6 A;  2VXI A;  3AJQ A;  5D8R A;  5JKM A;  4MN9 A;  5J8W A;  5I4J A;  1JYB A;  4QUW A;  3SID A;  2F7N A;  3R2L A;  1FHA A;  3E1J A;  5HJH A;  5AXS A;  3A9Q A;  4XGS A;  3AJO A;  2Z90 A;  3F36 A;  4LPJ A;  2ZG9 X;  2FZF A;  2FKZ A;  2V2M A;  2V2N A;  2ZA7 A;  4TOE A;  2VZB A;  2YW6 A;  4ETR A;  5J93 A;  3HL1 A;  2WLA A;  4P18 A;  5FFB A;  3BVI A;  3EGM A;  3PWQ C;  5CZU A;  3VNX A;  2QF9 A;  2GS4 A; 
#chains in the Genus database with same CATH topology
 3R2M A;  3Q4Q A;  3D19 A;  3BT5 A;  3V3K B;  4M32 A;  1JTS A;  1YV1 A;  1NF6 A;  1VEQ A;  1J30 A;  3TA8 A;  4Z3B A;  3L0M A;  2IY4 A;  4LQH A;  3GHQ A;  1N1Q A;  3BVF A;  3R2R A;  5D8S A;  2HTN A;  5LS9 A;  3QHB A;  5FFC A;  3C1Z A;  3UOI A;  4KVQ A;  4ZTT A;  4II4 A;  4YVZ A;  4PGI A;  4ZJK A;  1VLG A;  4W4K B;  2CN7 A;  1MOJ A;  1YUX A;  3KA4 A;  1YUZ A;  3GVY A;  3Q4O A;  1JI5 A;  4RC6 A;  3ISF A;  4EVC A;  4RC5 B;  5GU3 X;  3E1Q A;  3NOZ X;  1RCI A;  2CHI A;  1LKP A;  3E6R A;  4ZLW A;  2CLU A;  5HJF A;  3GGY A;  2YJJ A;  3F35 A;  2MGY A;  3AF7 X;  1S30 A;  3W54 A;  1R03 A;  3OJ5 A;  4ZKX A;  4DE6 A;  3FSE A;  3KA8 A;  4RC7 A;  3AF8 X;  5GU0 X;  3C1Y A;  3KDQ A;  5D8Q A;  3JZ9 A;  2GYQ A;  3E1N A;  4ZMC A;  3PW8 A;  4TOG A;  2IB0 A;  5IX6 A;  5JKM G;  4DYU A;  1JKV A;  2XGW A;  5FFE A;  4IWJ A;  4Z5S A;  5FFD A;  1H96 A;  2Y44 A;  4CYB A;  2ZG8 X;  3SHX A;  1JI4 A;  2G4H A;  3ERZ A;  3F38 A;  2FG4 A;  2GYD A;  5ERK A;  3ISE A;  4MJY A;  1Z6O M;  1O9R A;  4EVD A;  4DYZ A;  5JDO A;  4ISM A;  2FJC A;  1DPS A;  3BVE A;  2C2J A;  5GOU A;  4TW3 A;  1L8I A;  3AJP A;  1LB3 A;  4CMY A;  4CVT A;  5JKL A;  4EVE A;  1UVH A;  4MXP A;  3RE7 A;  2CEI A;  3M6J A;  4YXJ A;  2CWL A;  3O7S A;  1JRE A;  3AF9 X;  3PVR B;  4PGK A;  2WTL A;  1ZS3 A;  3F37 A;  4U3G A;  3RBC A;  1JIG A;  2Z5P A;  4ZKH A;  2V15 A;  2XJN A;  5FFA A;  1TK6 A;  5CMR A;  1RYT A;  1LKM A;  2FFX J;  3PW1 B;  5LG8 A;  2HR5 A;  3C23 A;  3PW8 C;  3QZ3 A;  1QYB A;  4MUD A;  1S2Z A;  3KHK A;  2OC5 A;  1VEI A;  4X0J A;  1VEL A;  1Z4A A;  3QHC A;  4ML5 A;  2C41 A;  4IXK A;  3F33 A;  1XZ1 A;  4RC8 A;  3PVY B;  3E1L A;  2OH3 A;  3PVT B;  2JD8 0;  3U90 A;  2ZUR X;  3WVV A;  3QD8 A;  4RC5 A;  1DVB A;  4XKU A;  4Y08 A;  3H7G A;  3RD0 A;  5FEJ A;  4TOH A;  2JD7 0;  4E40 A;  3E1P A;  3T9J A;  2ZG7 X;  4PG0 A;  2BKC A;  5D8X A;  1BFR A;  3NP0 X;  3E2C A;  4KXR B;  4ZL6 A;  4KVS A;  3F32 A;  3QVD A;  1TKP A;  2CN6 A;  2V2L A;  1TJO A;  3NP2 X;  4TOA A;  3E1O A;  1LKO A;  4ZKW A;  3KXU A;  1NNQ A;  1RCE A;  4MY7 A;  1O9I A;  4ITW A;  1TKO A;  1RCD A;  2XJM A;  2V2P A;  2V2O A;  4M33 A;  5ERJ A;  3KA3 A;  5J8S A;  5HQO A;  5K53 A;  5JKL G;  1RCC A;  3SH6 A;  3R2S A;  3PWF A;  4WJG 4;  4EVB A;  4DI0 A;  4KVR A;  5GN8 A;  4IWK A;  1GWG A;  3RGD A;  4AM2 A;  3WVU A;  3KA9 A;  2FG8 A;  3KA6 A;  5LBH A;  3ES3 A;  4XKT A;  2WLU A;  3QB9 A;  5J9V A;  1ZUJ A;  2FHA A;  1AEW A;  2QQY A;  2Z5R A;  1XZ3 A;  5E1U A;  4TO9 A;  1IES A;  2W0O A;  2X17 0;  4TOB A;  2V2R A;  3AK9 A;  3JZA B;  5D8P A;  3E1M A;  4M34 A;  2Y3Q A;  3FVB A;  3RAV A;  3PZA A;  2FL0 A;  3O7R A;  3MPS A;  1IER A;  1JKU A;  2G38 B;  3PVR A;  4CYA A;  1RCG A;  5JAC A;  1BG7 A;  3UOF A;  3HIU A;  2BJY A;  3GE4 A;  1SOF A;  2XKQ A;  3KX9 A;  2C2U A;  4TOD A;  3WNW A;  2V2I A;  5E2D A;  4MKU A;  2ZA6 A;  3UNO A;  3PW1 A;  2PYB A;  2AR0 A;  2VXX A;  3F39 A;  3R2O A;  4DYY A;  3OGH A;  4LPM A;  2C2F A;  2D5K A;  4CVR A;  3R2K A;  3IQ1 A;  2C6R A;  4LYU A;  1UMN A;  3Q4R A;  3WVW A;  3E6S A;  2Z5Q A;  3AK8 A;  3FI6 A;  3FRS A;  1B71 A;  3PVY A;  4AM4 A;  5CMQ A;  3PVT A;  3R2H A;  3SE1 A;  3EZ0 A;  2UX1 A;  4CVP A;  1MFR A;  3KWO A;  1KRQ A;  3C21 A;  3BKN A;  4E6K A;  3IS7 A;  4ZL5 A;  2CHP A;  1DAT A;  3F34 A;  1SQ3 A;  5GU2 X;  4DYX A;  4II4 B;  4XKS A;  1NFV A;  2V8T A;  4TOF A;  4LPN A;  2V8U A;  1F30 A;  4LQN A;  3BVL A;  2IU2 A;  1OTK A;  1L8H A;  2XJO A;  5C6F A;  2ITB A;  4LYX A;  4LQJ A;  4RC6 B;  2JD6 0;  1VJX A;  4W4L B;  4OYN A;  4REU A;  4A25 A;  2RBD A;  4DAS A;  3A68 A;  4TOC A;  4YKH A;  3VV9 A;  2ZA8 A;  2OKC A;  5D8Y A;  4CVS A;  1QGH A;  4ISP A;  3BVK A;  3FRR A;  2N02 A;  2BW1 A;  1HRS A;  1JGC A;  1EUM A;  2V2J A;  4RC7 B;  1NF4 A;  3GGZ A;  2YW7 A;  3DBY A;  4AM5 A;  5HU6 D;  4M35 A;  3PWQ A;  1BCF A;  2CLB A;  3VVA A;  4YXM A;  3Q4N A;  1S3Q A;  1Z6O A;  2YJK A;  2WWX B;  4LQV A;  4CY9 A;  4DZ0 A;  4ITT A;  2CF7 A;  3EZU A;  5K52 A;  4PG1 A;  5D8O A;  1F33 A;  3IS8 A;  5LG2 A;  4ERU A;  4R42 A;  5GN8 B;  5GU1 X;  3N6O A;  2CIH A;  2Z6M A;  5JDO B;  4CMY V;  2V2S A;  2BK6 A;  2VXI A;  3AJQ A;  5D8R A;  5JKM A;  4MN9 A;  5J8W A;  5I4J A;  1JYB A;  4QUW A;  3SID A;  3R2L A;  2F7N A;  1FHA A;  3E1J A;  5HJH A;  5AXS A;  3A9Q A;  4XGS A;  3AJO A;  2Z90 A;  3F36 A;  4LPJ A;  2ZG9 X;  2FZF A;  2FKZ A;  2V2M A;  2V2N A;  3UFB A;  2ZA7 A;  4TOE A;  2VZB A;  2YW6 A;  4ETR A;  5J93 A;  3HL1 A;  2WLA A;  4P18 A;  5FFB A;  3BVI A;  3LKD A;  3EGM A;  3PWQ C;  5CZU A;  3VNX A;  2QF9 A;  2GS4 A; 
#chains in the Genus database with same CATH homology
 3R2M A;  3Q4Q A;  3D19 A;  3BT5 A;  3V3K B;  4M32 A;  1JTS A;  1YV1 A;  1NF6 A;  1VEQ A;  1J30 A;  3TA8 A;  4Z3B A;  3L0M A;  2IY4 A;  4LQH A;  3GHQ A;  1N1Q A;  3BVF A;  3R2R A;  5D8S A;  2HTN A;  5LS9 A;  3QHB A;  5FFC A;  3C1Z A;  3UOI A;  4KVQ A;  4ZTT A;  4II4 A;  4YVZ A;  4PGI A;  4ZJK A;  1VLG A;  4W4K B;  2CN7 A;  1MOJ A;  1YUX A;  3KA4 A;  1YUZ A;  3GVY A;  3Q4O A;  1JI5 A;  4RC6 A;  3ISF A;  4EVC A;  4RC5 B;  5GU3 X;  3E1Q A;  3NOZ X;  1RCI A;  2CHI A;  1LKP A;  3E6R A;  4ZLW A;  2CLU A;  5HJF A;  3GGY A;  2YJJ A;  3F35 A;  2MGY A;  3AF7 X;  1S30 A;  3W54 A;  1R03 A;  3OJ5 A;  4ZKX A;  4DE6 A;  3FSE A;  3KA8 A;  4RC7 A;  3AF8 X;  5GU0 X;  3C1Y A;  3KDQ A;  5D8Q A;  3JZ9 A;  2GYQ A;  3E1N A;  4ZMC A;  3PW8 A;  4TOG A;  2IB0 A;  5IX6 A;  5JKM G;  4DYU A;  1JKV A;  2XGW A;  5FFE A;  4IWJ A;  4Z5S A;  5FFD A;  1H96 A;  2Y44 A;  4CYB A;  2ZG8 X;  3SHX A;  1JI4 A;  2G4H A;  3ERZ A;  3F38 A;  2FG4 A;  2GYD A;  5ERK A;  3ISE A;  4MJY A;  1Z6O M;  1O9R A;  4EVD A;  4DYZ A;  5JDO A;  4ISM A;  2FJC A;  1DPS A;  3BVE A;  2C2J A;  5GOU A;  4TW3 A;  1L8I A;  3AJP A;  1LB3 A;  4CMY A;  4CVT A;  5JKL A;  4EVE A;  1UVH A;  4MXP A;  3RE7 A;  2CEI A;  3M6J A;  4YXJ A;  2CWL A;  3O7S A;  1JRE A;  3AF9 X;  3PVR B;  4PGK A;  2WTL A;  1ZS3 A;  3F37 A;  4U3G A;  3RBC A;  1JIG A;  2Z5P A;  4ZKH A;  2V15 A;  2XJN A;  5FFA A;  1TK6 A;  5CMR A;  1RYT A;  1LKM A;  2FFX J;  3PW1 B;  5LG8 A;  2HR5 A;  3C23 A;  3PW8 C;  3QZ3 A;  1QYB A;  4MUD A;  1S2Z A;  3KHK A;  2OC5 A;  1VEI A;  4X0J A;  1VEL A;  1Z4A A;  3QHC A;  4ML5 A;  2C41 A;  4IXK A;  3F33 A;  1XZ1 A;  4RC8 A;  3PVY B;  3E1L A;  2OH3 A;  3PVT B;  2JD8 0;  3U90 A;  2ZUR X;  3WVV A;  3QD8 A;  4RC5 A;  1DVB A;  4XKU A;  4Y08 A;  3H7G A;  3RD0 A;  5FEJ A;  4TOH A;  2JD7 0;  4E40 A;  3E1P A;  3T9J A;  2ZG7 X;  4PG0 A;  2BKC A;  5D8X A;  1BFR A;  3NP0 X;  3E2C A;  4KXR B;  4ZL6 A;  4KVS A;  3F32 A;  3QVD A;  1TKP A;  2CN6 A;  2V2L A;  1TJO A;  3NP2 X;  4TOA A;  3E1O A;  1LKO A;  4ZKW A;  3KXU A;  1NNQ A;  1RCE A;  4MY7 A;  1O9I A;  4ITW A;  1TKO A;  1RCD A;  2XJM A;  2V2P A;  2V2O A;  4M33 A;  5ERJ A;  3KA3 A;  5J8S A;  5HQO A;  5K53 A;  5JKL G;  1RCC A;  3SH6 A;  3R2S A;  3PWF A;  4WJG 4;  4EVB A;  4DI0 A;  4KVR A;  5GN8 A;  4IWK A;  1GWG A;  3RGD A;  4AM2 A;  3WVU A;  3KA9 A;  2FG8 A;  3KA6 A;  5LBH A;  3ES3 A;  4XKT A;  2WLU A;  3QB9 A;  5J9V A;  1ZUJ A;  2FHA A;  1AEW A;  2QQY A;  2Z5R A;  1XZ3 A;  5E1U A;  4TO9 A;  1IES A;  2W0O A;  2X17 0;  4TOB A;  2V2R A;  3AK9 A;  3JZA B;  5D8P A;  3E1M A;  4M34 A;  2Y3Q A;  3FVB A;  3RAV A;  3PZA A;  2FL0 A;  3O7R A;  3MPS A;  1IER A;  1JKU A;  2G38 B;  3PVR A;  4CYA A;  1RCG A;  5JAC A;  1BG7 A;  3UOF A;  3HIU A;  2BJY A;  3GE4 A;  1SOF A;  2XKQ A;  3KX9 A;  2C2U A;  4TOD A;  3WNW A;  2V2I A;  5E2D A;  4MKU A;  2ZA6 A;  3UNO A;  3PW1 A;  2PYB A;  2AR0 A;  2VXX A;  3F39 A;  3R2O A;  4DYY A;  3OGH A;  4LPM A;  2C2F A;  2D5K A;  4CVR A;  3R2K A;  3IQ1 A;  2C6R A;  4LYU A;  1UMN A;  3Q4R A;  3WVW A;  3E6S A;  2Z5Q A;  3AK8 A;  3FI6 A;  3FRS A;  1B71 A;  3PVY A;  4AM4 A;  5CMQ A;  3PVT A;  3R2H A;  3SE1 A;  3EZ0 A;  2UX1 A;  4CVP A;  1MFR A;  3KWO A;  1KRQ A;  3C21 A;  3BKN A;  4E6K A;  3IS7 A;  4ZL5 A;  2CHP A;  1DAT A;  3F34 A;  1SQ3 A;  5GU2 X;  4DYX A;  4II4 B;  4XKS A;  1NFV A;  2V8T A;  4TOF A;  4LPN A;  2V8U A;  1F30 A;  4LQN A;  3BVL A;  2IU2 A;  1OTK A;  1L8H A;  2XJO A;  5C6F A;  2ITB A;  4LYX A;  4LQJ A;  4RC6 B;  2JD6 0;  1VJX A;  4W4L B;  4OYN A;  4REU A;  4A25 A;  2RBD A;  4DAS A;  3A68 A;  4TOC A;  4YKH A;  3VV9 A;  2ZA8 A;  2OKC A;  5D8Y A;  4CVS A;  1QGH A;  4ISP A;  3BVK A;  3FRR A;  2N02 A;  2BW1 A;  1HRS A;  1JGC A;  1EUM A;  2V2J A;  4RC7 B;  1NF4 A;  3GGZ A;  2YW7 A;  3DBY A;  4AM5 A;  5HU6 D;  4M35 A;  3PWQ A;  1BCF A;  2CLB A;  3VVA A;  4YXM A;  3Q4N A;  1S3Q A;  1Z6O A;  2YJK A;  2WWX B;  4LQV A;  4CY9 A;  4DZ0 A;  4ITT A;  2CF7 A;  3EZU A;  5K52 A;  4PG1 A;  5D8O A;  1F33 A;  3IS8 A;  5LG2 A;  4ERU A;  4R42 A;  5GN8 B;  5GU1 X;  3N6O A;  2CIH A;  2Z6M A;  5JDO B;  4CMY V;  2V2S A;  2BK6 A;  2VXI A;  3AJQ A;  5D8R A;  5JKM A;  4MN9 A;  5J8W A;  5I4J A;  1JYB A;  4QUW A;  3SID A;  3R2L A;  2F7N A;  1FHA A;  3E1J A;  5HJH A;  5AXS A;  3A9Q A;  4XGS A;  3AJO A;  2Z90 A;  3F36 A;  4LPJ A;  2ZG9 X;  2FZF A;  2FKZ A;  2V2M A;  2V2N A;  3UFB A;  2ZA7 A;  4TOE A;  2VZB A;  2YW6 A;  4ETR A;  5J93 A;  3HL1 A;  2WLA A;  4P18 A;  5FFB A;  3BVI A;  3LKD A;  3EGM A;  3PWQ C;  5CZU A;  3VNX A;  2QF9 A;  2GS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...