4ITWA

Anaerobic crystal structure of iron soaked (75 min) ferritin from pseudo-nitzschia multiseries
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
156
structure length
155
Chain Sequence
EELLDLFNRQVTQEFTASQVYLSASIWFDQNDWEGMAAYMLAESAEEREHGLGFVDFANKRNIPIELQAVPAPVSAEWSSPEDVWQSILELEQANTRSLLNLAEAASTCHDFAVMAFLNPFHLQQVNEEDKIGSILAKVTDENRTPGLLRSLDVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Ferritin
publication title Mechanism of ferrous iron binding and oxidation by ferritin from a pennate diatom.
pubmed doi rcsb
source organism Pseudo-nitzschia multiseries
total genus 72
structure length 155
sequence length 156
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4itwA00
3SH6A 2VXIA 5JKMG 4CYAA 5JKLG 4RC7B 3F39A 3E1OA 4XKTA 4REUA 4CMYA 2V2JA 3A9QA 3UOIA 2JD80 4DZ0A 2Z90A 4CMYV 3F35A 1VLGA 4XKSA 4ZKWA 1NFVA 5FFAA 1SQ3A 5AXSA 3WNWA 2WTLA 2V2IA 4ML5A 3RGDA 4U3GA 3VNXA 1KRQA 4RC5B 4ITTA 4DASA 1JTSA 1RYTA 3BKNA 1GWGA 1F30A 4RC7A 3PW1A 1VJXA 1L8HA 1SOFA 5GU2X 3UOFA 5J8SA 2V2OA 3E2CA 3KX9A 3WVVA 4LPMA 2BJYA 2YJKA 5JKMA 5JKLA 5FEJA 3KWOA 4TOAA 3OGHA 3PVYA 4RC8A 3FSEA 5IX6A 2ZG7X 4CVRA 4ISPA 2OC5A 3QZ3A 2CEIA 3R2SA 4TODA 2XJOA 3AJPA 3QB9A 4RC5A 4DE6A 5LG8A 3BVKA 2V2MA 4AM4A 3IQ1A 5I4JA 5HJFA 1XZ3A 2GS4A 1NNQA 1OTKA 2C2UA 2YW7A 4ITWA 5C6FA 3E1QA 3UNOA 1JREA 1AEWA 2PYBA 3F33A 4LQNA 1QYBA 3RBCA 3KA8A 1UMNA 2IY4A 1DVBA 5D8PA 3F37A 5CMQA 4RC6A 3IS7A 4LQVA 4TOCA 4EVDA 3RE7A 4A25A 3NOZX 3KA9A 2CLUA 3U90A 4CVTA 5J9VA 5D8SA 3E6SA 2HR5A 2GYQA 2GYDA 3PWQC 2RBDA 1N1QA 3F36A 4M34A 5GU0X 2UX1A 3QHBA 2CF7A 2JD70 3O7RA 2CN7A 4LYUA 3FI6A 4IWJA 2C2JA 1VEIA 4ZJKA 5HJHA 3PW1B 1JI4A 2BW1A 4Y08A 2YW6A 3F32A 2G4HA 2QQYA 2V2LA 3Q4NA 4KVSA 4TOGA 5J8WA 4PG1A 3A68A 1BG7A 3Q4QA 1NF6A 1TKPA 3ES3A 2OH3A 2YJJA 3EZUA 1JKVA 3PVYB 1B71A 3HIUA 4TOBA 3R2HA 3H7GA 4DI0A 4LQJA 4AM2A 4ISMA 3PVRB 4Z5SA 1Z4AA 4ZMCA 2V2PA 3BVFA 4TOHA 2ZA7A 3WVUA 2CN6A 2ZA6A 5CMRA 1YUXA 3AJOA 2BKCA 4IWKA 4CYBA 1MFRA 1Z6OM 3R2OA 1O9IA 3OJ5A 4II4B 4LYXA 4PG0A 4TW3A 2ITBA 5K53A 4IXKA 1R03A 4ZLWA 4ZL5A 4RC6B 2Y3QA 2QF9A 5FFBA 1IERA 1JI5A 5D8RA 3EGMA 3PW8C 3PVRA 4LQHA 3NP0X 1BCFA 2FG4A 2ZG8X 2WLUA 2CHPA 1DPSA 3BVLA 1RCCA 1S30A 3PW8A 1JKUA 4II4A 3RAVA 1F33A 1RCEA 2C6RA 3EZ0A 4PGKA 1Z6OA 5K52A 3GVYA 3QVDA 3PZAA 5GN8B 1HRSA 3O7SA 4ZTTA 3T9JA 2JD60 3F34A 4QUWA 3ISEA 1BFRA 5HQOA 3R2RA 3ERZA 1TK6A 2FHAA 3E1LA 3R2KA 1RCGA 3RD0A 2VXXA 1ZS3A 3GHQA 3BVIA 4CVPA 2CHIA 4PGIA 3GE4A 5GOUA 2FL0A 2C41A 4DYXA 5GN8A 3NP2X 4EVCA 1LKOA 2Z5RA 2VZBA 4TO9A 1IESA 5LS9A 5LG2A 2V2NA 3QD8A 5JACA 3KA3A 1LB3A 5FFEA 2XKQA 2X170 4ERUA 2WLAA 2V2RA 2FZFA 3FVBA 1RCIA 4TOFA 3Q4RA 4EVBA 3TA8A 4M35A 1YUZA 1JYBA 1QGHA 2BK6A 3AF8X 3SIDA 3E1MA 4MKUA 2FKZA 3R2MA 3AF7X 3AK9A 2W0OA 2Z6MA 2F7NA 3R2LA 5ERKA 4E6KA 4MY7A 3IS8A 4LPJA 4CVSA 1LKPA 3HL1A 2V2SA 1VELA 2XGWA 5CZUA 1ZUJA 4M32A 2FFXJ 3QHCA 2V15A 1JIGA 2FJCA 5J93A 3PVTB 1S3QA 4XGSA 2Z5PA 4ZL6A 2CLBA 4DYUA 1L8IA 4MUDA 1DATA 2CIHA 4DYZA 3E1JA 5ERJA 4YKHA 4ETRA 4ZKHA 4MN9A 3BVEA 1RCDA 4P18A 4LPNA 5FFDA 1NF4A 1O9RA 3KA6A 3SE1A 3WVWA 1UVHA 4XKUA 5D8OA 5E2DA 3AJQA 2C2FA 3PVTA 4ZKXA 1EUMA 5D8XA 1MOJA 5GU1X 2Z5QA 2IU2A 1JGCA 3BT5A 3KXUA 1YV1A 4M33A 2HTNA 4OYNA 5E1UA 4Z3BA 3SHXA 3ISFA 4KVQA 3PWFA 3AF9X 3KA4A 4MJYA 3E6RA 2ZA8A 5FFCA 1XZ1A 2XJNA 5D8YA 2D5KA 3E1PA 5LBHA 2IB0A 3MPSA 4EVEA 1H96A 4R42A 1TKOA 3AK8A 3E1NA 4KVRA 2ZURX 1TJOA 4AM5A 2FG8A 1FHAA 5GU3X 1LKMA 1J30A 1VEQA 4DYYA 1S2ZA 3F38A 2XJMA 3PWQA 4CY9A 4TOEA 2ZG9X 5D8QA 3Q4OA
chains in the Genus database with same CATH superfamily
2G38B 3SH6A 2VXIA 5JKMG 4CYAA 5JKLG 4RC7B 3F39A 3E1OA 4XKTA 4REUA 4CMYA 2V2JA 3A9QA 3UOIA 2JD80 4DZ0A 2Z90A 4CMYV 3VVAA 3F35A 5JDOA 1VLGA 4XKSA 4ZKWA 1NFVA 5FFAA 1SQ3A 5AXSA 3WNWA 2WTLA 2V2IA 4ML5A 3RGDA 4U3GA 3VNXA 1KRQA 4RC5B 4ITTA 4DASA 1JTSA 1RYTA 3BKNA 1GWGA 1F30A 3C21A 4RC7A 3PW1A 1VJXA 1L8HA 1SOFA 2CWLA 5GU2X 3UOFA 5J8SA 2V2OA 3E2CA 3KX9A 4E40A 3WVVA 4LPMA 2BJYA 2WWXB 2YJKA 5JKMA 5JKLA 5FEJA 3KWOA 4TOAA 3OGHA 3PVYA 4RC8A 3FSEA 5IX6A 2ZG7X 4CVRA 4ISPA 2OC5A 3QZ3A 3C1YA 2CEIA 3R2SA 4TODA 3N6OA 2XJOA 3AJPA 3QB9A 4RC5A 4DE6A 5LG8A 3BVKA 2V2MA 4AM4A 2V8TA 3IQ1A 5I4JA 5HJFA 1XZ3A 2GS4A 1NNQA 1OTKA 2C2UA 2YW7A 4ITWA 5C6FA 3E1QA 3UNOA 1JREA 1AEWA 2PYBA 3F33A 4LQNA 1QYBA 3RBCA 3KA8A 1UMNA 3L0MA 4YXMA 2IY4A 1DVBA 5D8PA 2N02A 3F37A 5CMQA 4RC6A 3IS7A 4LQVA 4TOCA 4EVDA 3FRRA 3RE7A 4A25A 3NOZX 3KA9A 2CLUA 3U90A 4CVTA 5J9VA 5D8SA 3E6SA 2HR5A 2GYQA 2GYDA 3PWQC 3M6JA 2RBDA 1N1QA 3F36A 4M34A 5GU0X 3DBYA 2UX1A 3QHBA 2CF7A 2JD70 3O7RA 2CN7A 4LYUA 3FI6A 4IWJA 2C2JA 1VEIA 4ZJKA 4W4LB 5HJHA 3PW1B 1JI4A 2BW1A 4Y08A 2YW6A 3F32A 2G4HA 2QQYA 2V2LA 3Q4NA 4KVSA 4TOGA 5J8WA 4PG1A 3A68A 1BG7A 3Q4QA 1NF6A 1TKPA 3ES3A 2OH3A 2YJJA 3EZUA 1JKVA 4YVZA 3PVYB 1B71A 3VV9A 3HIUA 4TOBA 3R2HA 3H7GA 4DI0A 4LQJA 4AM2A 4ISMA 3PVRB 4Z5SA 1Z4AA 4ZMCA 2V2PA 3BVFA 4TOHA 2ZA7A 3WVUA 2CN6A 2ZA6A 5CMRA 1YUXA 3AJOA 2BKCA 4IWKA 4CYBA 1MFRA 1Z6OM 3R2OA 3C1ZA 4W4KB 1O9IA 3OJ5A 4II4B 4LYXA 4PG0A 4TW3A 2ITBA 5K53A 4IXKA 1R03A 4ZLWA 4ZL5A 4RC6B 2Y3QA 2QF9A 3W54A 5FFBA 1IERA 1JI5A 5D8RA 4X0JA 3EGMA 3PW8C 3PVRA 4LQHA 5HU6D 3NP0X 1BCFA 2FG4A 2ZG8X 2WLUA 3KDQA 2CHPA 1DPSA 3BVLA 1RCCA 3C23A 1S30A 3PW8A 1JKUA 4II4A 3RAVA 1F33A 1RCEA 2C6RA 3EZ0A 4PGKA 1Z6OA 5K52A 3GVYA 3QVDA 3PZAA 5GN8B 1HRSA 3O7SA 2Y44A 4ZTTA 3T9JA 2JD60 3F34A 4WJG4 4QUWA 3ISEA 3JZ9A 1BFRA 5HQOA 3R2RA 3ERZA 1TK6A 2FHAA 3E1LA 2OKCA 3R2KA 1RCGA 3RD0A 2AR0A 2VXXA 1ZS3A 3GHQA 3BVIA 4CVPA 2CHIA 4PGIA 3GE4A 5GOUA 2FL0A 2C41A 4DYXA 5GN8A 3NP2X 4EVCA 1LKOA 2Z5RA 2VZBA 4TO9A 1IESA 5LS9A 5LG2A 2V2NA 3QD8A 5JACA 3KA3A 1LB3A 5FFEA 2XKQA 2X170 4ERUA 2WLAA 2V2RA 2FZFA 3FVBA 1RCIA 4TOFA 3Q4RA 4EVBA 3TA8A 4M35A 1YUZA 1JYBA 1QGHA 2BK6A 3JZAB 3AF8X 3SIDA 3E1MA 4MKUA 2FKZA 3R2MA 3AF7X 3AK9A 2W0OA 2Z6MA 2F7NA 3R2LA 5ERKA 4E6KA 4MY7A 3IS8A 4LPJA 4YXJA 4CVSA 1LKPA 3HL1A 2V2SA 1VELA 2XGWA 3V3KB 5CZUA 1ZUJA 4M32A 3GGZA 2FFXJ 3QHCA 2V15A 2MGYA 3FRSA 1JIGA 2FJCA 5J93A 3PVTB 1S3QA 4XGSA 2Z5PA 4ZL6A 2CLBA 4DYUA 1L8IA 3GGYA 3LKDA 4MUDA 1DATA 2CIHA 4DYZA 3E1JA 5ERJA 2V8UA 4YKHA 4ETRA 4ZKHA 4MN9A 3BVEA 1RCDA 4P18A 4LPNA 5FFDA 1NF4A 1O9RA 3KA6A 3SE1A 3WVWA 1UVHA 4XKUA 5D8OA 5E2DA 3AJQA 2C2FA 3PVTA 4ZKXA 1EUMA 5D8XA 1MOJA 5GU1X 2Z5QA 2IU2A 1JGCA 3BT5A 3KXUA 1YV1A 4M33A 2HTNA 4OYNA 5E1UA 4Z3BA 3SHXA 3ISFA 4KVQA 3PWFA 4KXRB 3AF9X 3KA4A 4MJYA 3E6RA 2ZA8A 5FFCA 1XZ1A 2XJNA 3UFBA 5D8YA 2D5KA 3E1PA 5LBHA 2IB0A 3MPSA 4EVEA 1H96A 4R42A 1TKOA 3AK8A 3E1NA 4MXPA 4KVRA 2ZURX 1TJOA 3KHKA 4AM5A 2FG8A 1FHAA 5JDOB 5GU3X 1LKMA 1J30A 1VEQA 4DYYA 1S2ZA 3F38A 2XJMA 3PWQA 4CY9A 3D19A 4TOEA 2ZG9X 5D8QA 3Q4OA
chains in the Genus database with same CATH topology
2G38B 3SH6A 2VXIA 5JKMG 4CYAA 5JKLG 4RC7B 3F39A 3E1OA 4XKTA 4REUA 4CMYA 2V2JA 3A9QA 3UOIA 2JD80 4DZ0A 2Z90A 4CMYV 3VVAA 3F35A 5JDOA 1VLGA 4XKSA 4ZKWA 1NFVA 5FFAA 1SQ3A 5AXSA 3WNWA 2WTLA 2V2IA 4ML5A 3RGDA 4U3GA 3VNXA 1KRQA 4RC5B 4ITTA 4DASA 1JTSA 1RYTA 3BKNA 1GWGA 1F30A 3C21A 4RC7A 3PW1A 1VJXA 1L8HA 1SOFA 2CWLA 5GU2X 3UOFA 5J8SA 2V2OA 3E2CA 3KX9A 4E40A 3WVVA 4LPMA 2BJYA 2WWXB 2YJKA 5JKMA 5JKLA 5FEJA 3KWOA 4TOAA 3OGHA 3PVYA 4RC8A 3FSEA 5IX6A 2ZG7X 4CVRA 4ISPA 2OC5A 3QZ3A 3C1YA 2CEIA 3R2SA 4TODA 3N6OA 2XJOA 3AJPA 3QB9A 4RC5A 4DE6A 5LG8A 3BVKA 2V2MA 4AM4A 2V8TA 3IQ1A 5I4JA 5HJFA 1XZ3A 2GS4A 1NNQA 1OTKA 2C2UA 2YW7A 4ITWA 5C6FA 3E1QA 3UNOA 1JREA 1AEWA 2PYBA 3F33A 4LQNA 1QYBA 3RBCA 3KA8A 1UMNA 3L0MA 4YXMA 2IY4A 1DVBA 5D8PA 2N02A 3F37A 5CMQA 4RC6A 3IS7A 4LQVA 4TOCA 4EVDA 3FRRA 3RE7A 4A25A 3NOZX 3KA9A 2CLUA 3U90A 4CVTA 5J9VA 5D8SA 3E6SA 2HR5A 2GYQA 2GYDA 3PWQC 3M6JA 2RBDA 1N1QA 3F36A 4M34A 5GU0X 3DBYA 2UX1A 3QHBA 2CF7A 2JD70 3O7RA 2CN7A 4LYUA 3FI6A 4IWJA 2C2JA 1VEIA 4ZJKA 4W4LB 5HJHA 3PW1B 1JI4A 2BW1A 4Y08A 2YW6A 3F32A 2G4HA 2QQYA 2V2LA 3Q4NA 4KVSA 4TOGA 5J8WA 4PG1A 3A68A 1BG7A 3Q4QA 1NF6A 1TKPA 3ES3A 2OH3A 2YJJA 3EZUA 1JKVA 4YVZA 3PVYB 1B71A 3VV9A 3HIUA 4TOBA 3R2HA 3H7GA 4DI0A 4LQJA 4AM2A 4ISMA 3PVRB 4Z5SA 1Z4AA 4ZMCA 2V2PA 3BVFA 4TOHA 2ZA7A 3WVUA 2CN6A 2ZA6A 5CMRA 1YUXA 3AJOA 2BKCA 4IWKA 4CYBA 1MFRA 1Z6OM 3R2OA 3C1ZA 4W4KB 1O9IA 3OJ5A 4II4B 4LYXA 4PG0A 4TW3A 2ITBA 5K53A 4IXKA 1R03A 4ZLWA 4ZL5A 4RC6B 2Y3QA 2QF9A 3W54A 5FFBA 1IERA 1JI5A 5D8RA 4X0JA 3EGMA 3PW8C 3PVRA 4LQHA 5HU6D 3NP0X 1BCFA 2FG4A 2ZG8X 2WLUA 3KDQA 2CHPA 1DPSA 3BVLA 1RCCA 3C23A 1S30A 3PW8A 1JKUA 4II4A 3RAVA 1F33A 1RCEA 2C6RA 3EZ0A 4PGKA 1Z6OA 5K52A 3GVYA 3QVDA 3PZAA 5GN8B 1HRSA 3O7SA 2Y44A 4ZTTA 3T9JA 2JD60 3F34A 4WJG4 4QUWA 3ISEA 3JZ9A 1BFRA 5HQOA 3R2RA 3ERZA 1TK6A 2FHAA 3E1LA 2OKCA 3R2KA 1RCGA 3RD0A 2AR0A 2VXXA 1ZS3A 3GHQA 3BVIA 4CVPA 2CHIA 4PGIA 3GE4A 5GOUA 2FL0A 2C41A 4DYXA 5GN8A 3NP2X 4EVCA 1LKOA 2Z5RA 2VZBA 4TO9A 1IESA 5LS9A 5LG2A 2V2NA 3QD8A 5JACA 3KA3A 1LB3A 5FFEA 2XKQA 2X170 4ERUA 2WLAA 2V2RA 2FZFA 3FVBA 1RCIA 4TOFA 3Q4RA 4EVBA 3TA8A 4M35A 1YUZA 1JYBA 1QGHA 2BK6A 3JZAB 3AF8X 3SIDA 3E1MA 4MKUA 2FKZA 3R2MA 3AF7X 3AK9A 2W0OA 2Z6MA 2F7NA 3R2LA 5ERKA 4E6KA 4MY7A 3IS8A 4LPJA 4YXJA 4CVSA 1LKPA 3HL1A 2V2SA 1VELA 2XGWA 3V3KB 5CZUA 1ZUJA 4M32A 3GGZA 2FFXJ 3QHCA 2V15A 2MGYA 3FRSA 1JIGA 2FJCA 5J93A 3PVTB 1S3QA 4XGSA 2Z5PA 4ZL6A 2CLBA 4DYUA 1L8IA 3GGYA 3LKDA 4MUDA 1DATA 2CIHA 4DYZA 3E1JA 5ERJA 2V8UA 4YKHA 4ETRA 4ZKHA 4MN9A 3BVEA 1RCDA 4P18A 4LPNA 5FFDA 1NF4A 1O9RA 3KA6A 3SE1A 3WVWA 1UVHA 4XKUA 5D8OA 5E2DA 3AJQA 2C2FA 3PVTA 4ZKXA 1EUMA 5D8XA 1MOJA 5GU1X 2Z5QA 2IU2A 1JGCA 3BT5A 3KXUA 1YV1A 4M33A 2HTNA 4OYNA 5E1UA 4Z3BA 3SHXA 3ISFA 4KVQA 3PWFA 4KXRB 3AF9X 3KA4A 4MJYA 3E6RA 2ZA8A 5FFCA 1XZ1A 2XJNA 3UFBA 5D8YA 2D5KA 3E1PA 5LBHA 2IB0A 3MPSA 4EVEA 1H96A 4R42A 1TKOA 3AK8A 3E1NA 4MXPA 4KVRA 2ZURX 1TJOA 3KHKA 4AM5A 2FG8A 1FHAA 5JDOB 5GU3X 1LKMA 1J30A 1VEQA 4DYYA 1S2ZA 3F38A 2XJMA 3PWQA 4CY9A 3D19A 4TOEA 2ZG9X 5D8QA 3Q4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SH6 A;  2VXI A;  5JKM G;  4CYA A;  5JKL G;  4RC7 B;  3F39 A;  3E1O A;  4XKT A;  4REU A;  4CMY A;  2V2J A;  3A9Q A;  3UOI A;  2JD8 0;  4DZ0 A;  2Z90 A;  4CMY V;  3F35 A;  1VLG A;  4XKS A;  4ZKW A;  1NFV A;  5FFA A;  1SQ3 A;  5AXS A;  3WNW A;  2WTL A;  2V2I A;  4ML5 A;  3RGD A;  4U3G A;  3VNX A;  1KRQ A;  4RC5 B;  4ITT A;  4DAS A;  1JTS A;  1RYT A;  3BKN A;  1GWG A;  1F30 A;  4RC7 A;  3PW1 A;  1VJX A;  1L8H A;  1SOF A;  5GU2 X;  3UOF A;  5J8S A;  2V2O A;  3E2C A;  3KX9 A;  3WVV A;  4LPM A;  2BJY A;  2YJK A;  5JKM A;  5JKL A;  5FEJ A;  3KWO A;  4TOA A;  3OGH A;  3PVY A;  4RC8 A;  3FSE A;  5IX6 A;  2ZG7 X;  4CVR A;  4ISP A;  2OC5 A;  3QZ3 A;  2CEI A;  3R2S A;  4TOD A;  2XJO A;  3AJP A;  3QB9 A;  4RC5 A;  4DE6 A;  5LG8 A;  3BVK A;  2V2M A;  4AM4 A;  3IQ1 A;  5I4J A;  5HJF A;  1XZ3 A;  2GS4 A;  1NNQ A;  1OTK A;  2C2U A;  2YW7 A;  4ITW A;  5C6F A;  3E1Q A;  3UNO A;  1JRE A;  1AEW A;  2PYB A;  3F33 A;  4LQN A;  1QYB A;  3RBC A;  3KA8 A;  1UMN A;  2IY4 A;  1DVB A;  5D8P A;  3F37 A;  5CMQ A;  4RC6 A;  3IS7 A;  4LQV A;  4TOC A;  4EVD A;  3RE7 A;  4A25 A;  3NOZ X;  3KA9 A;  2CLU A;  3U90 A;  4CVT A;  5J9V A;  5D8S A;  3E6S A;  2HR5 A;  2GYQ A;  2GYD A;  3PWQ C;  2RBD A;  1N1Q A;  3F36 A;  4M34 A;  5GU0 X;  2UX1 A;  3QHB A;  2CF7 A;  2JD7 0;  3O7R A;  2CN7 A;  4LYU A;  3FI6 A;  4IWJ A;  2C2J A;  1VEI A;  4ZJK A;  5HJH A;  3PW1 B;  1JI4 A;  2BW1 A;  4Y08 A;  2YW6 A;  3F32 A;  2G4H A;  2QQY A;  2V2L A;  3Q4N A;  4KVS A;  4TOG A;  5J8W A;  4PG1 A;  3A68 A;  1BG7 A;  3Q4Q A;  1NF6 A;  1TKP A;  3ES3 A;  2OH3 A;  2YJJ A;  3EZU A;  1JKV A;  3PVY B;  1B71 A;  3HIU A;  4TOB A;  3R2H A;  3H7G A;  4DI0 A;  4LQJ A;  4AM2 A;  4ISM A;  3PVR B;  4Z5S A;  1Z4A A;  4ZMC A;  2V2P A;  3BVF A;  4TOH A;  2ZA7 A;  3WVU A;  2CN6 A;  2ZA6 A;  5CMR A;  1YUX A;  3AJO A;  2BKC A;  4IWK A;  4CYB A;  1MFR A;  1Z6O M;  3R2O A;  1O9I A;  3OJ5 A;  4II4 B;  4LYX A;  4PG0 A;  4TW3 A;  2ITB A;  5K53 A;  4IXK A;  1R03 A;  4ZLW A;  4ZL5 A;  4RC6 B;  2Y3Q A;  2QF9 A;  5FFB A;  1IER A;  1JI5 A;  5D8R A;  3EGM A;  3PW8 C;  3PVR A;  4LQH A;  3NP0 X;  1BCF A;  2FG4 A;  2ZG8 X;  2WLU A;  2CHP A;  1DPS A;  3BVL A;  1RCC A;  1S30 A;  3PW8 A;  1JKU A;  4II4 A;  3RAV A;  1F33 A;  1RCE A;  2C6R A;  3EZ0 A;  4PGK A;  1Z6O A;  5K52 A;  3GVY A;  3QVD A;  3PZA A;  5GN8 B;  1HRS A;  3O7S A;  4ZTT A;  3T9J A;  2JD6 0;  3F34 A;  4QUW A;  3ISE A;  1BFR A;  5HQO A;  3R2R A;  3ERZ A;  1TK6 A;  2FHA A;  3E1L A;  3R2K A;  1RCG A;  3RD0 A;  2VXX A;  1ZS3 A;  3GHQ A;  3BVI A;  4CVP A;  2CHI A;  4PGI A;  3GE4 A;  5GOU A;  2FL0 A;  2C41 A;  4DYX A;  5GN8 A;  3NP2 X;  4EVC A;  1LKO A;  2Z5R A;  2VZB A;  4TO9 A;  1IES A;  5LS9 A;  5LG2 A;  2V2N A;  3QD8 A;  5JAC A;  3KA3 A;  1LB3 A;  5FFE A;  2XKQ A;  2X17 0;  4ERU A;  2WLA A;  2V2R A;  2FZF A;  3FVB A;  1RCI A;  4TOF A;  3Q4R A;  4EVB A;  3TA8 A;  4M35 A;  1YUZ A;  1JYB A;  1QGH A;  2BK6 A;  3AF8 X;  3SID A;  3E1M A;  4MKU A;  2FKZ A;  3R2M A;  3AF7 X;  3AK9 A;  2W0O A;  2Z6M A;  2F7N A;  3R2L A;  5ERK A;  4E6K A;  4MY7 A;  3IS8 A;  4LPJ A;  4CVS A;  1LKP A;  3HL1 A;  2V2S A;  1VEL A;  2XGW A;  5CZU A;  1ZUJ A;  4M32 A;  2FFX J;  3QHC A;  2V15 A;  1JIG A;  2FJC A;  5J93 A;  3PVT B;  1S3Q A;  4XGS A;  2Z5P A;  4ZL6 A;  2CLB A;  4DYU A;  1L8I A;  4MUD A;  1DAT A;  2CIH A;  4DYZ A;  3E1J A;  5ERJ A;  4YKH A;  4ETR A;  4ZKH A;  4MN9 A;  3BVE A;  1RCD A;  4P18 A;  4LPN A;  5FFD A;  1NF4 A;  1O9R A;  3KA6 A;  3SE1 A;  3WVW A;  1UVH A;  4XKU A;  5D8O A;  5E2D A;  3AJQ A;  2C2F A;  3PVT A;  4ZKX A;  1EUM A;  5D8X A;  1MOJ A;  5GU1 X;  2Z5Q A;  2IU2 A;  1JGC A;  3BT5 A;  3KXU A;  1YV1 A;  4M33 A;  2HTN A;  4OYN A;  5E1U A;  4Z3B A;  3SHX A;  3ISF A;  4KVQ A;  3PWF A;  3AF9 X;  3KA4 A;  4MJY A;  3E6R A;  2ZA8 A;  5FFC A;  1XZ1 A;  2XJN A;  5D8Y A;  2D5K A;  3E1P A;  5LBH A;  2IB0 A;  3MPS A;  4EVE A;  1H96 A;  4R42 A;  1TKO A;  3AK8 A;  3E1N A;  4KVR A;  2ZUR X;  1TJO A;  4AM5 A;  2FG8 A;  1FHA A;  5GU3 X;  1LKM A;  1J30 A;  1VEQ A;  4DYY A;  1S2Z A;  3F38 A;  2XJM A;  3PWQ A;  4CY9 A;  4TOE A;  2ZG9 X;  5D8Q A;  3Q4O A; 
#chains in the Genus database with same CATH topology
 2G38 B;  3SH6 A;  2VXI A;  5JKM G;  4CYA A;  5JKL G;  4RC7 B;  3F39 A;  3E1O A;  4XKT A;  4REU A;  4CMY A;  2V2J A;  3A9Q A;  3UOI A;  2JD8 0;  4DZ0 A;  2Z90 A;  4CMY V;  3VVA A;  3F35 A;  5JDO A;  1VLG A;  4XKS A;  4ZKW A;  1NFV A;  5FFA A;  1SQ3 A;  5AXS A;  3WNW A;  2WTL A;  2V2I A;  4ML5 A;  3RGD A;  4U3G A;  3VNX A;  1KRQ A;  4RC5 B;  4ITT A;  4DAS A;  1JTS A;  1RYT A;  3BKN A;  1GWG A;  1F30 A;  3C21 A;  4RC7 A;  3PW1 A;  1VJX A;  1L8H A;  1SOF A;  2CWL A;  5GU2 X;  3UOF A;  5J8S A;  2V2O A;  3E2C A;  3KX9 A;  4E40 A;  3WVV A;  4LPM A;  2BJY A;  2WWX B;  2YJK A;  5JKM A;  5JKL A;  5FEJ A;  3KWO A;  4TOA A;  3OGH A;  3PVY A;  4RC8 A;  3FSE A;  5IX6 A;  2ZG7 X;  4CVR A;  4ISP A;  2OC5 A;  3QZ3 A;  3C1Y A;  2CEI A;  3R2S A;  4TOD A;  3N6O A;  2XJO A;  3AJP A;  3QB9 A;  4RC5 A;  4DE6 A;  5LG8 A;  3BVK A;  2V2M A;  4AM4 A;  2V8T A;  3IQ1 A;  5I4J A;  5HJF A;  1XZ3 A;  2GS4 A;  1NNQ A;  1OTK A;  2C2U A;  2YW7 A;  4ITW A;  5C6F A;  3E1Q A;  3UNO A;  1JRE A;  1AEW A;  2PYB A;  3F33 A;  4LQN A;  1QYB A;  3RBC A;  3KA8 A;  1UMN A;  3L0M A;  4YXM A;  2IY4 A;  1DVB A;  5D8P A;  2N02 A;  3F37 A;  5CMQ A;  4RC6 A;  3IS7 A;  4LQV A;  4TOC A;  4EVD A;  3FRR A;  3RE7 A;  4A25 A;  3NOZ X;  3KA9 A;  2CLU A;  3U90 A;  4CVT A;  5J9V A;  5D8S A;  3E6S A;  2HR5 A;  2GYQ A;  2GYD A;  3PWQ C;  3M6J A;  2RBD A;  1N1Q A;  3F36 A;  4M34 A;  5GU0 X;  3DBY A;  2UX1 A;  3QHB A;  2CF7 A;  2JD7 0;  3O7R A;  2CN7 A;  4LYU A;  3FI6 A;  4IWJ A;  2C2J A;  1VEI A;  4ZJK A;  4W4L B;  5HJH A;  3PW1 B;  1JI4 A;  2BW1 A;  4Y08 A;  2YW6 A;  3F32 A;  2G4H A;  2QQY A;  2V2L A;  3Q4N A;  4KVS A;  4TOG A;  5J8W A;  4PG1 A;  3A68 A;  1BG7 A;  3Q4Q A;  1NF6 A;  1TKP A;  3ES3 A;  2OH3 A;  2YJJ A;  3EZU A;  1JKV A;  4YVZ A;  3PVY B;  1B71 A;  3VV9 A;  3HIU A;  4TOB A;  3R2H A;  3H7G A;  4DI0 A;  4LQJ A;  4AM2 A;  4ISM A;  3PVR B;  4Z5S A;  1Z4A A;  4ZMC A;  2V2P A;  3BVF A;  4TOH A;  2ZA7 A;  3WVU A;  2CN6 A;  2ZA6 A;  5CMR A;  1YUX A;  3AJO A;  2BKC A;  4IWK A;  4CYB A;  1MFR A;  1Z6O M;  3R2O A;  3C1Z A;  4W4K B;  1O9I A;  3OJ5 A;  4II4 B;  4LYX A;  4PG0 A;  4TW3 A;  2ITB A;  5K53 A;  4IXK A;  1R03 A;  4ZLW A;  4ZL5 A;  4RC6 B;  2Y3Q A;  2QF9 A;  3W54 A;  5FFB A;  1IER A;  1JI5 A;  5D8R A;  4X0J A;  3EGM A;  3PW8 C;  3PVR A;  4LQH A;  5HU6 D;  3NP0 X;  1BCF A;  2FG4 A;  2ZG8 X;  2WLU A;  3KDQ A;  2CHP A;  1DPS A;  3BVL A;  1RCC A;  3C23 A;  1S30 A;  3PW8 A;  1JKU A;  4II4 A;  3RAV A;  1F33 A;  1RCE A;  2C6R A;  3EZ0 A;  4PGK A;  1Z6O A;  5K52 A;  3GVY A;  3QVD A;  3PZA A;  5GN8 B;  1HRS A;  3O7S A;  2Y44 A;  4ZTT A;  3T9J A;  2JD6 0;  3F34 A;  4WJG 4;  4QUW A;  3ISE A;  3JZ9 A;  1BFR A;  5HQO A;  3R2R A;  3ERZ A;  1TK6 A;  2FHA A;  3E1L A;  2OKC A;  3R2K A;  1RCG A;  3RD0 A;  2AR0 A;  2VXX A;  1ZS3 A;  3GHQ A;  3BVI A;  4CVP A;  2CHI A;  4PGI A;  3GE4 A;  5GOU A;  2FL0 A;  2C41 A;  4DYX A;  5GN8 A;  3NP2 X;  4EVC A;  1LKO A;  2Z5R A;  2VZB A;  4TO9 A;  1IES A;  5LS9 A;  5LG2 A;  2V2N A;  3QD8 A;  5JAC A;  3KA3 A;  1LB3 A;  5FFE A;  2XKQ A;  2X17 0;  4ERU A;  2WLA A;  2V2R A;  2FZF A;  3FVB A;  1RCI A;  4TOF A;  3Q4R A;  4EVB A;  3TA8 A;  4M35 A;  1YUZ A;  1JYB A;  1QGH A;  2BK6 A;  3JZA B;  3AF8 X;  3SID A;  3E1M A;  4MKU A;  2FKZ A;  3R2M A;  3AF7 X;  3AK9 A;  2W0O A;  2Z6M A;  2F7N A;  3R2L A;  5ERK A;  4E6K A;  4MY7 A;  3IS8 A;  4LPJ A;  4YXJ A;  4CVS A;  1LKP A;  3HL1 A;  2V2S A;  1VEL A;  2XGW A;  3V3K B;  5CZU A;  1ZUJ A;  4M32 A;  3GGZ A;  2FFX J;  3QHC A;  2V15 A;  2MGY A;  3FRS A;  1JIG A;  2FJC A;  5J93 A;  3PVT B;  1S3Q A;  4XGS A;  2Z5P A;  4ZL6 A;  2CLB A;  4DYU A;  1L8I A;  3GGY A;  3LKD A;  4MUD A;  1DAT A;  2CIH A;  4DYZ A;  3E1J A;  5ERJ A;  2V8U A;  4YKH A;  4ETR A;  4ZKH A;  4MN9 A;  3BVE A;  1RCD A;  4P18 A;  4LPN A;  5FFD A;  1NF4 A;  1O9R A;  3KA6 A;  3SE1 A;  3WVW A;  1UVH A;  4XKU A;  5D8O A;  5E2D A;  3AJQ A;  2C2F A;  3PVT A;  4ZKX A;  1EUM A;  5D8X A;  1MOJ A;  5GU1 X;  2Z5Q A;  2IU2 A;  1JGC A;  3BT5 A;  3KXU A;  1YV1 A;  4M33 A;  2HTN A;  4OYN A;  5E1U A;  4Z3B A;  3SHX A;  3ISF A;  4KVQ A;  3PWF A;  4KXR B;  3AF9 X;  3KA4 A;  4MJY A;  3E6R A;  2ZA8 A;  5FFC A;  1XZ1 A;  2XJN A;  3UFB A;  5D8Y A;  2D5K A;  3E1P A;  5LBH A;  2IB0 A;  3MPS A;  4EVE A;  1H96 A;  4R42 A;  1TKO A;  3AK8 A;  3E1N A;  4MXP A;  4KVR A;  2ZUR X;  1TJO A;  3KHK A;  4AM5 A;  2FG8 A;  1FHA A;  5JDO B;  5GU3 X;  1LKM A;  1J30 A;  1VEQ A;  4DYY A;  1S2Z A;  3F38 A;  2XJM A;  3PWQ A;  4CY9 A;  3D19 A;  4TOE A;  2ZG9 X;  5D8Q A;  3Q4O A; 
#chains in the Genus database with same CATH homology
 2G38 B;  3SH6 A;  2VXI A;  5JKM G;  4CYA A;  5JKL G;  4RC7 B;  3F39 A;  3E1O A;  4XKT A;  4REU A;  4CMY A;  2V2J A;  3A9Q A;  3UOI A;  2JD8 0;  4DZ0 A;  2Z90 A;  4CMY V;  3VVA A;  3F35 A;  5JDO A;  1VLG A;  4XKS A;  4ZKW A;  1NFV A;  5FFA A;  1SQ3 A;  5AXS A;  3WNW A;  2WTL A;  2V2I A;  4ML5 A;  3RGD A;  4U3G A;  3VNX A;  1KRQ A;  4RC5 B;  4ITT A;  4DAS A;  1JTS A;  1RYT A;  3BKN A;  1GWG A;  1F30 A;  3C21 A;  4RC7 A;  3PW1 A;  1VJX A;  1L8H A;  1SOF A;  2CWL A;  5GU2 X;  3UOF A;  5J8S A;  2V2O A;  3E2C A;  3KX9 A;  4E40 A;  3WVV A;  4LPM A;  2BJY A;  2WWX B;  2YJK A;  5JKM A;  5JKL A;  5FEJ A;  3KWO A;  4TOA A;  3OGH A;  3PVY A;  4RC8 A;  3FSE A;  5IX6 A;  2ZG7 X;  4CVR A;  4ISP A;  2OC5 A;  3QZ3 A;  3C1Y A;  2CEI A;  3R2S A;  4TOD A;  3N6O A;  2XJO A;  3AJP A;  3QB9 A;  4RC5 A;  4DE6 A;  5LG8 A;  3BVK A;  2V2M A;  4AM4 A;  2V8T A;  3IQ1 A;  5I4J A;  5HJF A;  1XZ3 A;  2GS4 A;  1NNQ A;  1OTK A;  2C2U A;  2YW7 A;  4ITW A;  5C6F A;  3E1Q A;  3UNO A;  1JRE A;  1AEW A;  2PYB A;  3F33 A;  4LQN A;  1QYB A;  3RBC A;  3KA8 A;  1UMN A;  3L0M A;  4YXM A;  2IY4 A;  1DVB A;  5D8P A;  2N02 A;  3F37 A;  5CMQ A;  4RC6 A;  3IS7 A;  4LQV A;  4TOC A;  4EVD A;  3FRR A;  3RE7 A;  4A25 A;  3NOZ X;  3KA9 A;  2CLU A;  3U90 A;  4CVT A;  5J9V A;  5D8S A;  3E6S A;  2HR5 A;  2GYQ A;  2GYD A;  3PWQ C;  3M6J A;  2RBD A;  1N1Q A;  3F36 A;  4M34 A;  5GU0 X;  3DBY A;  2UX1 A;  3QHB A;  2CF7 A;  2JD7 0;  3O7R A;  2CN7 A;  4LYU A;  3FI6 A;  4IWJ A;  2C2J A;  1VEI A;  4ZJK A;  4W4L B;  5HJH A;  3PW1 B;  1JI4 A;  2BW1 A;  4Y08 A;  2YW6 A;  3F32 A;  2G4H A;  2QQY A;  2V2L A;  3Q4N A;  4KVS A;  4TOG A;  5J8W A;  4PG1 A;  3A68 A;  1BG7 A;  3Q4Q A;  1NF6 A;  1TKP A;  3ES3 A;  2OH3 A;  2YJJ A;  3EZU A;  1JKV A;  4YVZ A;  3PVY B;  1B71 A;  3VV9 A;  3HIU A;  4TOB A;  3R2H A;  3H7G A;  4DI0 A;  4LQJ A;  4AM2 A;  4ISM A;  3PVR B;  4Z5S A;  1Z4A A;  4ZMC A;  2V2P A;  3BVF A;  4TOH A;  2ZA7 A;  3WVU A;  2CN6 A;  2ZA6 A;  5CMR A;  1YUX A;  3AJO A;  2BKC A;  4IWK A;  4CYB A;  1MFR A;  1Z6O M;  3R2O A;  3C1Z A;  4W4K B;  1O9I A;  3OJ5 A;  4II4 B;  4LYX A;  4PG0 A;  4TW3 A;  2ITB A;  5K53 A;  4IXK A;  1R03 A;  4ZLW A;  4ZL5 A;  4RC6 B;  2Y3Q A;  2QF9 A;  3W54 A;  5FFB A;  1IER A;  1JI5 A;  5D8R A;  4X0J A;  3EGM A;  3PW8 C;  3PVR A;  4LQH A;  5HU6 D;  3NP0 X;  1BCF A;  2FG4 A;  2ZG8 X;  2WLU A;  3KDQ A;  2CHP A;  1DPS A;  3BVL A;  1RCC A;  3C23 A;  1S30 A;  3PW8 A;  1JKU A;  4II4 A;  3RAV A;  1F33 A;  1RCE A;  2C6R A;  3EZ0 A;  4PGK A;  1Z6O A;  5K52 A;  3GVY A;  3QVD A;  3PZA A;  5GN8 B;  1HRS A;  3O7S A;  2Y44 A;  4ZTT A;  3T9J A;  2JD6 0;  3F34 A;  4WJG 4;  4QUW A;  3ISE A;  3JZ9 A;  1BFR A;  5HQO A;  3R2R A;  3ERZ A;  1TK6 A;  2FHA A;  3E1L A;  2OKC A;  3R2K A;  1RCG A;  3RD0 A;  2AR0 A;  2VXX A;  1ZS3 A;  3GHQ A;  3BVI A;  4CVP A;  2CHI A;  4PGI A;  3GE4 A;  5GOU A;  2FL0 A;  2C41 A;  4DYX A;  5GN8 A;  3NP2 X;  4EVC A;  1LKO A;  2Z5R A;  2VZB A;  4TO9 A;  1IES A;  5LS9 A;  5LG2 A;  2V2N A;  3QD8 A;  5JAC A;  3KA3 A;  1LB3 A;  5FFE A;  2XKQ A;  2X17 0;  4ERU A;  2WLA A;  2V2R A;  2FZF A;  3FVB A;  1RCI A;  4TOF A;  3Q4R A;  4EVB A;  3TA8 A;  4M35 A;  1YUZ A;  1JYB A;  1QGH A;  2BK6 A;  3JZA B;  3AF8 X;  3SID A;  3E1M A;  4MKU A;  2FKZ A;  3R2M A;  3AF7 X;  3AK9 A;  2W0O A;  2Z6M A;  2F7N A;  3R2L A;  5ERK A;  4E6K A;  4MY7 A;  3IS8 A;  4LPJ A;  4YXJ A;  4CVS A;  1LKP A;  3HL1 A;  2V2S A;  1VEL A;  2XGW A;  3V3K B;  5CZU A;  1ZUJ A;  4M32 A;  3GGZ A;  2FFX J;  3QHC A;  2V15 A;  2MGY A;  3FRS A;  1JIG A;  2FJC A;  5J93 A;  3PVT B;  1S3Q A;  4XGS A;  2Z5P A;  4ZL6 A;  2CLB A;  4DYU A;  1L8I A;  3GGY A;  3LKD A;  4MUD A;  1DAT A;  2CIH A;  4DYZ A;  3E1J A;  5ERJ A;  2V8U A;  4YKH A;  4ETR A;  4ZKH A;  4MN9 A;  3BVE A;  1RCD A;  4P18 A;  4LPN A;  5FFD A;  1NF4 A;  1O9R A;  3KA6 A;  3SE1 A;  3WVW A;  1UVH A;  4XKU A;  5D8O A;  5E2D A;  3AJQ A;  2C2F A;  3PVT A;  4ZKX A;  1EUM A;  5D8X A;  1MOJ A;  5GU1 X;  2Z5Q A;  2IU2 A;  1JGC A;  3BT5 A;  3KXU A;  1YV1 A;  4M33 A;  2HTN A;  4OYN A;  5E1U A;  4Z3B A;  3SHX A;  3ISF A;  4KVQ A;  3PWF A;  4KXR B;  3AF9 X;  3KA4 A;  4MJY A;  3E6R A;  2ZA8 A;  5FFC A;  1XZ1 A;  2XJN A;  3UFB A;  5D8Y A;  2D5K A;  3E1P A;  5LBH A;  2IB0 A;  3MPS A;  4EVE A;  1H96 A;  4R42 A;  1TKO A;  3AK8 A;  3E1N A;  4MXP A;  4KVR A;  2ZUR X;  1TJO A;  3KHK A;  4AM5 A;  2FG8 A;  1FHA A;  5JDO B;  5GU3 X;  1LKM A;  1J30 A;  1VEQ A;  4DYY A;  1S2Z A;  3F38 A;  2XJM A;  3PWQ A;  4CY9 A;  3D19 A;  4TOE A;  2ZG9 X;  5D8Q A;  3Q4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...