4ITWA

Anaerobic crystal structure of iron soaked (75 min) ferritin from pseudo-nitzschia multiseries
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
156
structure length
155
Chain Sequence
EELLDLFNRQVTQEFTASQVYLSASIWFDQNDWEGMAAYMLAESAEEREHGLGFVDFANKRNIPIELQAVPAPVSAEWSSPEDVWQSILELEQANTRSLLNLAEAASTCHDFAVMAFLNPFHLQQVNEEDKIGSILAKVTDENRTPGLLRSLDVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferritin
publication title Mechanism of ferrous iron binding and oxidation by ferritin from a pennate diatom.
pubmed doi rcsb
source organism Pseudo-nitzschia multiseries
molecule tags Transport protein
total genus 72
structure length 155
sequence length 156
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4itwA00
5AXSA 5K53A 5K52A 4M33A 5FFEA 3E1OA 5JKLG 4XGSA 3PVRA 4LQNA 3R2RA 2V2LA 3O7SA 3MPSA 4XKSA 3WVWA 4DZ0A 5GU0X 4KVRA 5JKMA 2Z90A 2GYDA 2FG4A 4AM5A 1EUMA 4RC7B 3PVYB 3A68A 1MOJA 4ITWA 4TOAA 4TO9A 2C41A 3PVRB 4TODA 5GU3X 3F35A 1TKOA 1Z4AA 5ERKA 3R2KA 1F33A 1AEWA 3IS8A 3R2MA 1NNQA 3QHBA 1VLGA 2QQYA 4IWKA 2VXXA 2Z5PA 3OGHA 2Z5RA 3AK9A 1BG7A 1L8IA 2FJCA 4ZLWA 2FG8A 3KA4A 2VZBA 3IS7A 4PGKA 2CIHA 5CMRA 3IQ1A 1VJXA 3QVDA 1GWGA 1NF4A 4TW3A 3VNXA 3GHQA 2Z6MA 1H96A 1B71A 3ISFA 3UNOA 5FFBA 1VEIA 4PGIA 5IX6A 4TOEA 2ITBA 2CHIA 3RAVA 1S2ZA 2F7NA 1TK6A 3EZ0A 3FI6A 1O9RA 2CF7A 4DE6A 2XGWA 1HRSA 2CHPA 3SE1A 4ITTA 4LPJA 3NP2X 2FL0A 2V2JA 3E6SA 3SHXA 4DI0A 3R2HA 5HJFA 4CMYV 1LKOA 3UOFA 1R03A 3F36A 2ZG9X 4CMYA 3F32A 3TA8A 1KRQA 1QYBA 4AM2A 1UVHA 3BKNA 4KVQA 3KA8A 2CLBA 1DATA 1J30A 5LS9A 5D8RA 4XKUA 5CZUA 4AM4A 3ISEA 2XJOA 1NF6A 3E2CA 1TJOA 4LPMA 1RYTA 3PW8C 4YKHA 5JKMG 1YV1A 2V2IA 2BJYA 2C2FA 3E1LA 1RCIA 2ZA6A 3E1QA 1JI4A 3BVIA 3E1JA 3AF8X 4ZKXA 5J8SA 4ETRA 1JREA 5D8PA 2X170 3PW1A 2QF9A 2JD70 2V2RA 2BW1A 3PVTA 2GS4A 3HIUA 4MN9A 5LBHA 4CYBA 1XZ3A 3NP0X 3O7RA 4MKUA 3E1MA 1VELA 3PWQC 1RCDA 4E6KA 3NOZX 4RC6A 2WLUA 3WVUA 3E1NA 3AK8A 1NFVA 1JKVA 4REUA 2ZG7X 1YUXA 2G4HA 1F30A 4MUDA 2YJJA 3BVLA 4II4B 4ISPA 3PW1B 4LQVA 3PVTB 4TOBA 5D8OA 2FKZA 2HR5A 3E6RA 2BKCA 2V2MA 4ZMCA 3Q4OA 4U3GA 4TOGA 5FFDA 5LG8A 3KA9A 4RC6B 4IXKA 3QHCA 3T9JA 4ML5A 1JGCA 1TKPA 3RGDA 4OYNA 3AF7X 4LYXA 4R42A 4EVCA 2C6RA 5I4JA 1Z6OM 4LQJA 4EVDA 5HQOA 5FEJA 5GN8B 5FFCA 3AJOA 4MY7A 3BT5A 4A25A 2ZA8A 3AJPA 4CY9A 2XKQA 5CMQA 4ZKWA 3PZAA 4M34A 3BVEA 5FFAA 3QD8A 3RBCA 5D8QA 4DYUA 4CVSA 1RCEA 3AJQA 5D8YA 1LKMA 3KWOA 2ZURX 5D8XA 2V2SA 2Z5QA 3E1PA 3UOIA 2V2NA 3F39A 4XKTA 3SH6A 1Z6OA 3Q4NA 2GYQA 3OJ5A 3QZ3A 4RC8A 5ERJA 2HTNA 2FHAA 3PWFA 1ZS3A 3FSEA 4ERUA 2OH3A 1SQ3A 2JD80 4ZJKA 2BK6A 2UX1A 3SIDA 2D5KA 2XJNA 1L8HA 5E2DA 4DYXA 1JKUA 3F33A 1O9IA 2V15A 4Z3BA 3WNWA 1LKPA 4II4A 3QB9A 4ZTTA 4RC5B 5JKLA 1JTSA 4CVTA 1IERA 3PW8A 1VEQA 3EGMA 4CVPA 2PYBA 1UMNA 2FFXJ 1JIGA 2W0OA 4TOCA 4DYZA 3KX9A 3RD0A 4TOHA 3A9QA 5C6FA 3F34A 1DPSA 2V2OA 2Y3QA 3GVYA 2RBDA 4PG1A 5GOUA 4M35A 1BCFA 4EVBA 1RCCA 5GN8A 4QUWA 1RCGA 1S30A 5LG2A 4IWJA 3PWQA 5J93A 3KA3A 3F37A 4EVEA 1LB3A 2CEIA 3H7GA 3ES3A 3AF9X 4DASA 5D8SA 1YUZA 2CN6A 4ZL6A 1BFRA 3BVFA 4Y08A 3U90A 3Q4QA 4Z5SA 2VXIA 5JACA 2V2PA 5GU1X 2WTLA 4MJYA 1IESA 2YW6A 4KVSA 2IU2A 1N1QA 1OTKA 3R2OA 3KXUA 5J8WA 2XJMA 4M32A 4LQHA 4PG0A 1S3QA 3R2LA 4ZKHA 2OC5A 2YW7A 3KA6A 1ZUJA 3BVKA 3EZUA 1SOFA 4DYYA 2WLAA 4P18A 3F38A 5HJHA 3RE7A 2FZFA 3R2SA 2ZG8X 5J9VA 4LPNA 3WVVA 1FHAA 1JYBA 3FVBA 1XZ1A 1MFRA 3GE4A 2ZA7A 1JI5A 4RC5A 4CYAA 1QGHA 3HL1A 4CVRA 2C2JA 2C2UA 2YJKA 1DVBA 3ERZA 5GU2X 2CN7A 5E1UA 2CLUA 2IB0A 4ISMA 4ZL5A 4LYUA 4RC7A 2IY4A 3PVYA 3Q4RA 4TOFA 2JD60
chains in the Genus database with same CATH superfamily
5AXSA 2WWXB 5K53A 5K52A 4M33A 5FFEA 3E1OA 5JKLG 4XGSA 3PVRA 4LQNA 3R2RA 2V2LA 3O7SA 4WJG4 3MPSA 4XKSA 3WVWA 4DZ0A 5GU0X 4KVRA 5JKMA 2Z90A 2GYDA 2FG4A 4AM5A 1EUMA 4RC7B 3PVYB 3A68A 1MOJA 4ITWA 4TOAA 4TO9A 2C41A 3PVRB 4TODA 5GU3X 3F35A 1TKOA 1Z4AA 2N02A 3GGZA 5ERKA 3R2KA 1F33A 1AEWA 3IS8A 3R2MA 1NNQA 3QHBA 1VLGA 2QQYA 4IWKA 2VXXA 2Z5PA 3OGHA 2Z5RA 3AK9A 1BG7A 1L8IA 2FJCA 4ZLWA 2FG8A 3KA4A 2VZBA 3IS7A 4PGKA 2CIHA 4E40A 3N6OA 5CMRA 3IQ1A 3W54A 1VJXA 3FRRA 3QVDA 2OKCA 1GWGA 1NF4A 4TW3A 3VNXA 3GHQA 2Z6MA 1H96A 1B71A 3ISFA 3UNOA 5FFBA 5HU6D 1VEIA 4PGIA 5IX6A 4TOEA 2ITBA 2CHIA 3RAVA 1S2ZA 2F7NA 1TK6A 4KXRB 3EZ0A 3FI6A 1O9RA 2CF7A 4DE6A 2XGWA 1HRSA 2CHPA 3SE1A 4ITTA 4LPJA 3NP2X 2FL0A 2V2JA 3E6SA 3SHXA 4DI0A 3R2HA 5HJFA 4CMYV 1LKOA 3UOFA 1R03A 3F36A 2ZG9X 4X0JA 4YXJA 4CMYA 3F32A 3TA8A 1KRQA 1QYBA 4AM2A 1UVHA 3BKNA 4KVQA 3KA8A 2V8UA 2CLBA 1DATA 1J30A 5LS9A 5D8RA 4XKUA 5CZUA 4AM4A 3JZ9A 3ISEA 2XJOA 1NF6A 3E2CA 4YXMA 1TJOA 4LPMA 1RYTA 3PW8C 4YKHA 5JKMG 1YV1A 2V2IA 2BJYA 2C2FA 3E1LA 1RCIA 2ZA6A 3E1QA 1JI4A 3BVIA 3E1JA 3AF8X 4MXPA 4ZKXA 5J8SA 4ETRA 1JREA 5D8PA 2X170 3PW1A 2QF9A 2JD70 2V2RA 2BW1A 3PVTA 2GS4A 3HIUA 3VVAA 4MN9A 5LBHA 4CYBA 1XZ3A 3NP0X 3O7RA 3FRSA 3E1MA 4MKUA 1VELA 3PWQC 1RCDA 4E6KA 3NOZX 4RC6A 2WLUA 4W4KB 3WVUA 3E1NA 3AK8A 1NFVA 1JKVA 4REUA 2ZG7X 1YUXA 2G4HA 1F30A 4MUDA 2YJJA 3BVLA 4II4B 4ISPA 3PW1B 4LQVA 3KDQA 3PVTB 4TOBA 5D8OA 2FKZA 2HR5A 3E6RA 2BKCA 2V2MA 4ZMCA 3Q4OA 4U3GA 3M6JA 4TOGA 5FFDA 5LG8A 3KA9A 4RC6B 4IXKA 3QHCA 2V8TA 3T9JA 4ML5A 1JGCA 1TKPA 3RGDA 3C21A 3AF7X 4LYXA 4OYNA 4R42A 4EVCA 2C6RA 5I4JA 1Z6OM 4LQJA 4EVDA 5HQOA 2CWLA 5FEJA 5GN8B 5FFCA 3AJOA 4MY7A 3BT5A 4A25A 2ZA8A 3AJPA 4CY9A 2XKQA 5CMQA 4ZKWA 2AR0A 3PZAA 4M34A 3BVEA 5FFAA 3QD8A 3RBCA 5D8QA 4DYUA 4CVSA 1RCEA 3AJQA 5D8YA 1LKMA 3KWOA 2ZURX 5D8XA 2MGYA 2V2SA 2Z5QA 3E1PA 3UOIA 2V2NA 3F39A 4XKTA 3SH6A 1Z6OA 3Q4NA 2GYQA 3OJ5A 3QZ3A 3C1YA 4RC8A 5ERJA 2HTNA 2FHAA 3PWFA 1ZS3A 3FSEA 4ERUA 2OH3A 1SQ3A 2JD80 4ZJKA 2BK6A 2UX1A 3SIDA 2D5KA 2XJNA 1L8HA 5E2DA 4DYXA 1JKUA 3F33A 3DBYA 1O9IA 3C1ZA 2V15A 4Z3BA 3WNWA 1LKPA 4II4A 3QB9A 4ZTTA 4RC5B 5JKLA 5JDOA 1JTSA 4CVTA 1IERA 3PW8A 1VEQA 3EGMA 4CVPA 2PYBA 1UMNA 2FFXJ 1JIGA 2W0OA 4TOCA 4DYZA 3GGYA 3KX9A 3LKDA 3RD0A 4TOHA 3A9QA 5C6FA 3F34A 1DPSA 2V2OA 2Y3QA 3KHKA 3GVYA 2RBDA 3D19A 4PG1A 5GOUA 3C23A 4M35A 1BCFA 4EVBA 1RCCA 2Y44A 5GN8A 4QUWA 1RCGA 1S30A 5JDOB 5LG2A 3JZAB 4IWJA 3PWQA 5J93A 3KA3A 3F37A 4EVEA 1LB3A 2CEIA 3H7GA 3ES3A 3AF9X 3VV9A 4DASA 5D8SA 1YUZA 2CN6A 4ZL6A 1BFRA 3BVFA 3L0MA 4Y08A 3U90A 3Q4QA 4Z5SA 2VXIA 5JACA 2V2PA 5GU1X 2WTLA 4MJYA 1IESA 2YW6A 4KVSA 2IU2A 1N1QA 1OTKA 3R2OA 3KXUA 5J8WA 2XJMA 4M32A 4LQHA 4PG0A 1S3QA 3R2LA 4ZKHA 2OC5A 2YW7A 3KA6A 1ZUJA 3UFBA 3BVKA 3EZUA 1SOFA 4DYYA 4YVZA 2WLAA 4P18A 2G38B 3F38A 5HJHA 3RE7A 2FZFA 3R2SA 2ZG8X 5J9VA 4LPNA 3WVVA 1FHAA 1JYBA 3FVBA 1XZ1A 1MFRA 3V3KB 3GE4A 2ZA7A 1JI5A 4RC5A 4CYAA 1QGHA 3HL1A 4CVRA 2C2JA 2C2UA 2YJKA 1DVBA 3ERZA 5GU2X 2CN7A 5E1UA 2CLUA 2IB0A 4ISMA 4ZL5A 4LYUA 4RC7A 2IY4A 3PVYA 3Q4RA 4TOFA 4W4LB 2JD60
chains in the Genus database with same CATH topology
5AXSA 2WWXB 5K53A 5K52A 4M33A 5FFEA 3E1OA 5JKLG 4XGSA 3PVRA 4LQNA 3R2RA 2V2LA 3O7SA 4WJG4 3MPSA 4XKSA 3WVWA 4DZ0A 5GU0X 4KVRA 5JKMA 2Z90A 2GYDA 2FG4A 4AM5A 1EUMA 4RC7B 3PVYB 3A68A 1MOJA 4ITWA 4TOAA 4TO9A 2C41A 3PVRB 4TODA 5GU3X 3F35A 1TKOA 1Z4AA 2N02A 3GGZA 5ERKA 3R2KA 1F33A 1AEWA 3IS8A 3R2MA 1NNQA 3QHBA 1VLGA 2QQYA 4IWKA 2VXXA 2Z5PA 3OGHA 2Z5RA 3AK9A 1BG7A 1L8IA 2FJCA 4ZLWA 2FG8A 3KA4A 2VZBA 3IS7A 4PGKA 2CIHA 4E40A 3N6OA 5CMRA 3IQ1A 3W54A 1VJXA 3FRRA 3QVDA 2OKCA 1GWGA 1NF4A 4TW3A 3VNXA 3GHQA 2Z6MA 1H96A 1B71A 3ISFA 3UNOA 5FFBA 5HU6D 1VEIA 4PGIA 5IX6A 4TOEA 2ITBA 2CHIA 3RAVA 1S2ZA 2F7NA 1TK6A 4KXRB 3EZ0A 3FI6A 1O9RA 2CF7A 4DE6A 2XGWA 1HRSA 2CHPA 3SE1A 4ITTA 4LPJA 3NP2X 2FL0A 2V2JA 3E6SA 3SHXA 4DI0A 3R2HA 5HJFA 4CMYV 1LKOA 3UOFA 1R03A 3F36A 2ZG9X 4X0JA 4YXJA 4CMYA 3F32A 3TA8A 1KRQA 1QYBA 4AM2A 1UVHA 3BKNA 4KVQA 3KA8A 2V8UA 2CLBA 1DATA 1J30A 5LS9A 5D8RA 4XKUA 5CZUA 4AM4A 3JZ9A 3ISEA 2XJOA 1NF6A 3E2CA 4YXMA 1TJOA 4LPMA 1RYTA 3PW8C 4YKHA 5JKMG 1YV1A 2V2IA 2BJYA 2C2FA 3E1LA 1RCIA 2ZA6A 3E1QA 1JI4A 3BVIA 3E1JA 3AF8X 4MXPA 4ZKXA 5J8SA 4ETRA 1JREA 5D8PA 2X170 3PW1A 2QF9A 2JD70 2V2RA 2BW1A 3PVTA 2GS4A 3HIUA 3VVAA 4MN9A 5LBHA 4CYBA 1XZ3A 3NP0X 3O7RA 3FRSA 3E1MA 4MKUA 1VELA 3PWQC 1RCDA 4E6KA 3NOZX 4RC6A 2WLUA 4W4KB 3WVUA 3E1NA 3AK8A 1NFVA 1JKVA 4REUA 2ZG7X 1YUXA 2G4HA 1F30A 4MUDA 2YJJA 3BVLA 4II4B 4ISPA 3PW1B 4LQVA 3KDQA 3PVTB 4TOBA 5D8OA 2FKZA 2HR5A 3E6RA 2BKCA 2V2MA 4ZMCA 3Q4OA 4U3GA 3M6JA 4TOGA 5FFDA 5LG8A 3KA9A 4RC6B 4IXKA 3QHCA 2V8TA 3T9JA 4ML5A 1JGCA 1TKPA 3RGDA 3C21A 3AF7X 4LYXA 4OYNA 4R42A 4EVCA 2C6RA 5I4JA 1Z6OM 4LQJA 4EVDA 5HQOA 2CWLA 5FEJA 5GN8B 5FFCA 3AJOA 4MY7A 3BT5A 4A25A 2ZA8A 3AJPA 4CY9A 2XKQA 5CMQA 4ZKWA 2AR0A 3PZAA 4M34A 3BVEA 5FFAA 3QD8A 3RBCA 5D8QA 4DYUA 4CVSA 1RCEA 3AJQA 5D8YA 1LKMA 3KWOA 2ZURX 5D8XA 2MGYA 2V2SA 2Z5QA 3E1PA 3UOIA 2V2NA 3F39A 4XKTA 3SH6A 1Z6OA 3Q4NA 2GYQA 3OJ5A 3QZ3A 3C1YA 4RC8A 5ERJA 2HTNA 2FHAA 3PWFA 1ZS3A 3FSEA 4ERUA 2OH3A 1SQ3A 2JD80 4ZJKA 2BK6A 2UX1A 3SIDA 2D5KA 2XJNA 1L8HA 5E2DA 4DYXA 1JKUA 3F33A 3DBYA 1O9IA 3C1ZA 2V15A 4Z3BA 3WNWA 1LKPA 4II4A 3QB9A 4ZTTA 4RC5B 5JKLA 5JDOA 1JTSA 4CVTA 1IERA 3PW8A 1VEQA 3EGMA 4CVPA 2PYBA 1UMNA 2FFXJ 1JIGA 2W0OA 4TOCA 4DYZA 3GGYA 3KX9A 3LKDA 3RD0A 4TOHA 3A9QA 5C6FA 3F34A 1DPSA 2V2OA 2Y3QA 3KHKA 3GVYA 2RBDA 3D19A 4PG1A 5GOUA 3C23A 4M35A 1BCFA 4EVBA 1RCCA 2Y44A 5GN8A 4QUWA 1RCGA 1S30A 5JDOB 5LG2A 3JZAB 4IWJA 3PWQA 5J93A 3KA3A 3F37A 4EVEA 1LB3A 2CEIA 3H7GA 3ES3A 3AF9X 3VV9A 4DASA 5D8SA 1YUZA 2CN6A 4ZL6A 1BFRA 3BVFA 3L0MA 4Y08A 3U90A 3Q4QA 4Z5SA 2VXIA 5JACA 2V2PA 5GU1X 2WTLA 4MJYA 1IESA 2YW6A 4KVSA 2IU2A 1N1QA 1OTKA 3R2OA 3KXUA 5J8WA 2XJMA 4M32A 4LQHA 4PG0A 1S3QA 3R2LA 4ZKHA 2OC5A 2YW7A 3KA6A 1ZUJA 3UFBA 3BVKA 3EZUA 1SOFA 4DYYA 4YVZA 2WLAA 4P18A 2G38B 3F38A 5HJHA 3RE7A 2FZFA 3R2SA 2ZG8X 5J9VA 4LPNA 3WVVA 1FHAA 1JYBA 3FVBA 1XZ1A 1MFRA 3V3KB 3GE4A 2ZA7A 1JI5A 4RC5A 4CYAA 1QGHA 3HL1A 4CVRA 2C2JA 2C2UA 2YJKA 1DVBA 3ERZA 5GU2X 2CN7A 5E1UA 2CLUA 2IB0A 4ISMA 4ZL5A 4LYUA 4RC7A 2IY4A 3PVYA 3Q4RA 4TOFA 4W4LB 2JD60
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AXS A;  5K53 A;  5K52 A;  4M33 A;  5FFE A;  3E1O A;  5JKL G;  4XGS A;  3PVR A;  4LQN A;  3R2R A;  2V2L A;  3O7S A;  3MPS A;  4XKS A;  3WVW A;  4DZ0 A;  5GU0 X;  4KVR A;  5JKM A;  2Z90 A;  2GYD A;  2FG4 A;  4AM5 A;  1EUM A;  4RC7 B;  3PVY B;  3A68 A;  1MOJ A;  4ITW A;  4TOA A;  4TO9 A;  2C41 A;  3PVR B;  4TOD A;  5GU3 X;  3F35 A;  1TKO A;  1Z4A A;  5ERK A;  3R2K A;  1F33 A;  1AEW A;  3IS8 A;  3R2M A;  1NNQ A;  3QHB A;  1VLG A;  2QQY A;  4IWK A;  2VXX A;  2Z5P A;  3OGH A;  2Z5R A;  3AK9 A;  1BG7 A;  1L8I A;  2FJC A;  4ZLW A;  2FG8 A;  3KA4 A;  2VZB A;  3IS7 A;  4PGK A;  2CIH A;  5CMR A;  3IQ1 A;  1VJX A;  3QVD A;  1GWG A;  1NF4 A;  4TW3 A;  3VNX A;  3GHQ A;  2Z6M A;  1H96 A;  1B71 A;  3ISF A;  3UNO A;  5FFB A;  1VEI A;  4PGI A;  5IX6 A;  4TOE A;  2ITB A;  2CHI A;  3RAV A;  1S2Z A;  2F7N A;  1TK6 A;  3EZ0 A;  3FI6 A;  1O9R A;  2CF7 A;  4DE6 A;  2XGW A;  1HRS A;  2CHP A;  3SE1 A;  4ITT A;  4LPJ A;  3NP2 X;  2FL0 A;  2V2J A;  3E6S A;  3SHX A;  4DI0 A;  3R2H A;  5HJF A;  4CMY V;  1LKO A;  3UOF A;  1R03 A;  3F36 A;  2ZG9 X;  4CMY A;  3F32 A;  3TA8 A;  1KRQ A;  1QYB A;  4AM2 A;  1UVH A;  3BKN A;  4KVQ A;  3KA8 A;  2CLB A;  1DAT A;  1J30 A;  5LS9 A;  5D8R A;  4XKU A;  5CZU A;  4AM4 A;  3ISE A;  2XJO A;  1NF6 A;  3E2C A;  1TJO A;  4LPM A;  1RYT A;  3PW8 C;  4YKH A;  5JKM G;  1YV1 A;  2V2I A;  2BJY A;  2C2F A;  3E1L A;  1RCI A;  2ZA6 A;  3E1Q A;  1JI4 A;  3BVI A;  3E1J A;  3AF8 X;  4ZKX A;  5J8S A;  4ETR A;  1JRE A;  5D8P A;  2X17 0;  3PW1 A;  2QF9 A;  2JD7 0;  2V2R A;  2BW1 A;  3PVT A;  2GS4 A;  3HIU A;  4MN9 A;  5LBH A;  4CYB A;  1XZ3 A;  3NP0 X;  3O7R A;  4MKU A;  3E1M A;  1VEL A;  3PWQ C;  1RCD A;  4E6K A;  3NOZ X;  4RC6 A;  2WLU A;  3WVU A;  3E1N A;  3AK8 A;  1NFV A;  1JKV A;  4REU A;  2ZG7 X;  1YUX A;  2G4H A;  1F30 A;  4MUD A;  2YJJ A;  3BVL A;  4II4 B;  4ISP A;  3PW1 B;  4LQV A;  3PVT B;  4TOB A;  5D8O A;  2FKZ A;  2HR5 A;  3E6R A;  2BKC A;  2V2M A;  4ZMC A;  3Q4O A;  4U3G A;  4TOG A;  5FFD A;  5LG8 A;  3KA9 A;  4RC6 B;  4IXK A;  3QHC A;  3T9J A;  4ML5 A;  1JGC A;  1TKP A;  3RGD A;  4OYN A;  3AF7 X;  4LYX A;  4R42 A;  4EVC A;  2C6R A;  5I4J A;  1Z6O M;  4LQJ A;  4EVD A;  5HQO A;  5FEJ A;  5GN8 B;  5FFC A;  3AJO A;  4MY7 A;  3BT5 A;  4A25 A;  2ZA8 A;  3AJP A;  4CY9 A;  2XKQ A;  5CMQ A;  4ZKW A;  3PZA A;  4M34 A;  3BVE A;  5FFA A;  3QD8 A;  3RBC A;  5D8Q A;  4DYU A;  4CVS A;  1RCE A;  3AJQ A;  5D8Y A;  1LKM A;  3KWO A;  2ZUR X;  5D8X A;  2V2S A;  2Z5Q A;  3E1P A;  3UOI A;  2V2N A;  3F39 A;  4XKT A;  3SH6 A;  1Z6O A;  3Q4N A;  2GYQ A;  3OJ5 A;  3QZ3 A;  4RC8 A;  5ERJ A;  2HTN A;  2FHA A;  3PWF A;  1ZS3 A;  3FSE A;  4ERU A;  2OH3 A;  1SQ3 A;  2JD8 0;  4ZJK A;  2BK6 A;  2UX1 A;  3SID A;  2D5K A;  2XJN A;  1L8H A;  5E2D A;  4DYX A;  1JKU A;  3F33 A;  1O9I A;  2V15 A;  4Z3B A;  3WNW A;  1LKP A;  4II4 A;  3QB9 A;  4ZTT A;  4RC5 B;  5JKL A;  1JTS A;  4CVT A;  1IER A;  3PW8 A;  1VEQ A;  3EGM A;  4CVP A;  2PYB A;  1UMN A;  2FFX J;  1JIG A;  2W0O A;  4TOC A;  4DYZ A;  3KX9 A;  3RD0 A;  4TOH A;  3A9Q A;  5C6F A;  3F34 A;  1DPS A;  2V2O A;  2Y3Q A;  3GVY A;  2RBD A;  4PG1 A;  5GOU A;  4M35 A;  1BCF A;  4EVB A;  1RCC A;  5GN8 A;  4QUW A;  1RCG A;  1S30 A;  5LG2 A;  4IWJ A;  3PWQ A;  5J93 A;  3KA3 A;  3F37 A;  4EVE A;  1LB3 A;  2CEI A;  3H7G A;  3ES3 A;  3AF9 X;  4DAS A;  5D8S A;  1YUZ A;  2CN6 A;  4ZL6 A;  1BFR A;  3BVF A;  4Y08 A;  3U90 A;  3Q4Q A;  4Z5S A;  2VXI A;  5JAC A;  2V2P A;  5GU1 X;  2WTL A;  4MJY A;  1IES A;  2YW6 A;  4KVS A;  2IU2 A;  1N1Q A;  1OTK A;  3R2O A;  3KXU A;  5J8W A;  2XJM A;  4M32 A;  4LQH A;  4PG0 A;  1S3Q A;  3R2L A;  4ZKH A;  2OC5 A;  2YW7 A;  3KA6 A;  1ZUJ A;  3BVK A;  3EZU A;  1SOF A;  4DYY A;  2WLA A;  4P18 A;  3F38 A;  5HJH A;  3RE7 A;  2FZF A;  3R2S A;  2ZG8 X;  5J9V A;  4LPN A;  3WVV A;  1FHA A;  1JYB A;  3FVB A;  1XZ1 A;  1MFR A;  3GE4 A;  2ZA7 A;  1JI5 A;  4RC5 A;  4CYA A;  1QGH A;  3HL1 A;  4CVR A;  2C2J A;  2C2U A;  2YJK A;  1DVB A;  3ERZ A;  5GU2 X;  2CN7 A;  5E1U A;  2CLU A;  2IB0 A;  4ISM A;  4ZL5 A;  4LYU A;  4RC7 A;  2IY4 A;  3PVY A;  3Q4R A;  4TOF A;  2JD6 0; 
#chains in the Genus database with same CATH topology
 5AXS A;  2WWX B;  5K53 A;  5K52 A;  4M33 A;  5FFE A;  3E1O A;  5JKL G;  4XGS A;  3PVR A;  4LQN A;  3R2R A;  2V2L A;  3O7S A;  4WJG 4;  3MPS A;  4XKS A;  3WVW A;  4DZ0 A;  5GU0 X;  4KVR A;  5JKM A;  2Z90 A;  2GYD A;  2FG4 A;  4AM5 A;  1EUM A;  4RC7 B;  3PVY B;  3A68 A;  1MOJ A;  4ITW A;  4TOA A;  4TO9 A;  2C41 A;  3PVR B;  4TOD A;  5GU3 X;  3F35 A;  1TKO A;  1Z4A A;  2N02 A;  3GGZ A;  5ERK A;  3R2K A;  1F33 A;  1AEW A;  3IS8 A;  3R2M A;  1NNQ A;  3QHB A;  1VLG A;  2QQY A;  4IWK A;  2VXX A;  2Z5P A;  3OGH A;  2Z5R A;  3AK9 A;  1BG7 A;  1L8I A;  2FJC A;  4ZLW A;  2FG8 A;  3KA4 A;  2VZB A;  3IS7 A;  4PGK A;  2CIH A;  4E40 A;  3N6O A;  5CMR A;  3IQ1 A;  3W54 A;  1VJX A;  3FRR A;  3QVD A;  2OKC A;  1GWG A;  1NF4 A;  4TW3 A;  3VNX A;  3GHQ A;  2Z6M A;  1H96 A;  1B71 A;  3ISF A;  3UNO A;  5FFB A;  5HU6 D;  1VEI A;  4PGI A;  5IX6 A;  4TOE A;  2ITB A;  2CHI A;  3RAV A;  1S2Z A;  2F7N A;  1TK6 A;  4KXR B;  3EZ0 A;  3FI6 A;  1O9R A;  2CF7 A;  4DE6 A;  2XGW A;  1HRS A;  2CHP A;  3SE1 A;  4ITT A;  4LPJ A;  3NP2 X;  2FL0 A;  2V2J A;  3E6S A;  3SHX A;  4DI0 A;  3R2H A;  5HJF A;  4CMY V;  1LKO A;  3UOF A;  1R03 A;  3F36 A;  2ZG9 X;  4X0J A;  4YXJ A;  4CMY A;  3F32 A;  3TA8 A;  1KRQ A;  1QYB A;  4AM2 A;  1UVH A;  3BKN A;  4KVQ A;  3KA8 A;  2V8U A;  2CLB A;  1DAT A;  1J30 A;  5LS9 A;  5D8R A;  4XKU A;  5CZU A;  4AM4 A;  3JZ9 A;  3ISE A;  2XJO A;  1NF6 A;  3E2C A;  4YXM A;  1TJO A;  4LPM A;  1RYT A;  3PW8 C;  4YKH A;  5JKM G;  1YV1 A;  2V2I A;  2BJY A;  2C2F A;  3E1L A;  1RCI A;  2ZA6 A;  3E1Q A;  1JI4 A;  3BVI A;  3E1J A;  3AF8 X;  4MXP A;  4ZKX A;  5J8S A;  4ETR A;  1JRE A;  5D8P A;  2X17 0;  3PW1 A;  2QF9 A;  2JD7 0;  2V2R A;  2BW1 A;  3PVT A;  2GS4 A;  3HIU A;  3VVA A;  4MN9 A;  5LBH A;  4CYB A;  1XZ3 A;  3NP0 X;  3O7R A;  3FRS A;  3E1M A;  4MKU A;  1VEL A;  3PWQ C;  1RCD A;  4E6K A;  3NOZ X;  4RC6 A;  2WLU A;  4W4K B;  3WVU A;  3E1N A;  3AK8 A;  1NFV A;  1JKV A;  4REU A;  2ZG7 X;  1YUX A;  2G4H A;  1F30 A;  4MUD A;  2YJJ A;  3BVL A;  4II4 B;  4ISP A;  3PW1 B;  4LQV A;  3KDQ A;  3PVT B;  4TOB A;  5D8O A;  2FKZ A;  2HR5 A;  3E6R A;  2BKC A;  2V2M A;  4ZMC A;  3Q4O A;  4U3G A;  3M6J A;  4TOG A;  5FFD A;  5LG8 A;  3KA9 A;  4RC6 B;  4IXK A;  3QHC A;  2V8T A;  3T9J A;  4ML5 A;  1JGC A;  1TKP A;  3RGD A;  3C21 A;  3AF7 X;  4LYX A;  4OYN A;  4R42 A;  4EVC A;  2C6R A;  5I4J A;  1Z6O M;  4LQJ A;  4EVD A;  5HQO A;  2CWL A;  5FEJ A;  5GN8 B;  5FFC A;  3AJO A;  4MY7 A;  3BT5 A;  4A25 A;  2ZA8 A;  3AJP A;  4CY9 A;  2XKQ A;  5CMQ A;  4ZKW A;  2AR0 A;  3PZA A;  4M34 A;  3BVE A;  5FFA A;  3QD8 A;  3RBC A;  5D8Q A;  4DYU A;  4CVS A;  1RCE A;  3AJQ A;  5D8Y A;  1LKM A;  3KWO A;  2ZUR X;  5D8X A;  2MGY A;  2V2S A;  2Z5Q A;  3E1P A;  3UOI A;  2V2N A;  3F39 A;  4XKT A;  3SH6 A;  1Z6O A;  3Q4N A;  2GYQ A;  3OJ5 A;  3QZ3 A;  3C1Y A;  4RC8 A;  5ERJ A;  2HTN A;  2FHA A;  3PWF A;  1ZS3 A;  3FSE A;  4ERU A;  2OH3 A;  1SQ3 A;  2JD8 0;  4ZJK A;  2BK6 A;  2UX1 A;  3SID A;  2D5K A;  2XJN A;  1L8H A;  5E2D A;  4DYX A;  1JKU A;  3F33 A;  3DBY A;  1O9I A;  3C1Z A;  2V15 A;  4Z3B A;  3WNW A;  1LKP A;  4II4 A;  3QB9 A;  4ZTT A;  4RC5 B;  5JKL A;  5JDO A;  1JTS A;  4CVT A;  1IER A;  3PW8 A;  1VEQ A;  3EGM A;  4CVP A;  2PYB A;  1UMN A;  2FFX J;  1JIG A;  2W0O A;  4TOC A;  4DYZ A;  3GGY A;  3KX9 A;  3LKD A;  3RD0 A;  4TOH A;  3A9Q A;  5C6F A;  3F34 A;  1DPS A;  2V2O A;  2Y3Q A;  3KHK A;  3GVY A;  2RBD A;  3D19 A;  4PG1 A;  5GOU A;  3C23 A;  4M35 A;  1BCF A;  4EVB A;  1RCC A;  2Y44 A;  5GN8 A;  4QUW A;  1RCG A;  1S30 A;  5JDO B;  5LG2 A;  3JZA B;  4IWJ A;  3PWQ A;  5J93 A;  3KA3 A;  3F37 A;  4EVE A;  1LB3 A;  2CEI A;  3H7G A;  3ES3 A;  3AF9 X;  3VV9 A;  4DAS A;  5D8S A;  1YUZ A;  2CN6 A;  4ZL6 A;  1BFR A;  3BVF A;  3L0M A;  4Y08 A;  3U90 A;  3Q4Q A;  4Z5S A;  2VXI A;  5JAC A;  2V2P A;  5GU1 X;  2WTL A;  4MJY A;  1IES A;  2YW6 A;  4KVS A;  2IU2 A;  1N1Q A;  1OTK A;  3R2O A;  3KXU A;  5J8W A;  2XJM A;  4M32 A;  4LQH A;  4PG0 A;  1S3Q A;  3R2L A;  4ZKH A;  2OC5 A;  2YW7 A;  3KA6 A;  1ZUJ A;  3UFB A;  3BVK A;  3EZU A;  1SOF A;  4DYY A;  4YVZ A;  2WLA A;  4P18 A;  2G38 B;  3F38 A;  5HJH A;  3RE7 A;  2FZF A;  3R2S A;  2ZG8 X;  5J9V A;  4LPN A;  3WVV A;  1FHA A;  1JYB A;  3FVB A;  1XZ1 A;  1MFR A;  3V3K B;  3GE4 A;  2ZA7 A;  1JI5 A;  4RC5 A;  4CYA A;  1QGH A;  3HL1 A;  4CVR A;  2C2J A;  2C2U A;  2YJK A;  1DVB A;  3ERZ A;  5GU2 X;  2CN7 A;  5E1U A;  2CLU A;  2IB0 A;  4ISM A;  4ZL5 A;  4LYU A;  4RC7 A;  2IY4 A;  3PVY A;  3Q4R A;  4TOF A;  4W4L B;  2JD6 0; 
#chains in the Genus database with same CATH homology
 5AXS A;  2WWX B;  5K53 A;  5K52 A;  4M33 A;  5FFE A;  3E1O A;  5JKL G;  4XGS A;  3PVR A;  4LQN A;  3R2R A;  2V2L A;  3O7S A;  4WJG 4;  3MPS A;  4XKS A;  3WVW A;  4DZ0 A;  5GU0 X;  4KVR A;  5JKM A;  2Z90 A;  2GYD A;  2FG4 A;  4AM5 A;  1EUM A;  4RC7 B;  3PVY B;  3A68 A;  1MOJ A;  4ITW A;  4TOA A;  4TO9 A;  2C41 A;  3PVR B;  4TOD A;  5GU3 X;  3F35 A;  1TKO A;  1Z4A A;  2N02 A;  3GGZ A;  5ERK A;  3R2K A;  1F33 A;  1AEW A;  3IS8 A;  3R2M A;  1NNQ A;  3QHB A;  1VLG A;  2QQY A;  4IWK A;  2VXX A;  2Z5P A;  3OGH A;  2Z5R A;  3AK9 A;  1BG7 A;  1L8I A;  2FJC A;  4ZLW A;  2FG8 A;  3KA4 A;  2VZB A;  3IS7 A;  4PGK A;  2CIH A;  4E40 A;  3N6O A;  5CMR A;  3IQ1 A;  3W54 A;  1VJX A;  3FRR A;  3QVD A;  2OKC A;  1GWG A;  1NF4 A;  4TW3 A;  3VNX A;  3GHQ A;  2Z6M A;  1H96 A;  1B71 A;  3ISF A;  3UNO A;  5FFB A;  5HU6 D;  1VEI A;  4PGI A;  5IX6 A;  4TOE A;  2ITB A;  2CHI A;  3RAV A;  1S2Z A;  2F7N A;  1TK6 A;  4KXR B;  3EZ0 A;  3FI6 A;  1O9R A;  2CF7 A;  4DE6 A;  2XGW A;  1HRS A;  2CHP A;  3SE1 A;  4ITT A;  4LPJ A;  3NP2 X;  2FL0 A;  2V2J A;  3E6S A;  3SHX A;  4DI0 A;  3R2H A;  5HJF A;  4CMY V;  1LKO A;  3UOF A;  1R03 A;  3F36 A;  2ZG9 X;  4X0J A;  4YXJ A;  4CMY A;  3F32 A;  3TA8 A;  1KRQ A;  1QYB A;  4AM2 A;  1UVH A;  3BKN A;  4KVQ A;  3KA8 A;  2V8U A;  2CLB A;  1DAT A;  1J30 A;  5LS9 A;  5D8R A;  4XKU A;  5CZU A;  4AM4 A;  3JZ9 A;  3ISE A;  2XJO A;  1NF6 A;  3E2C A;  4YXM A;  1TJO A;  4LPM A;  1RYT A;  3PW8 C;  4YKH A;  5JKM G;  1YV1 A;  2V2I A;  2BJY A;  2C2F A;  3E1L A;  1RCI A;  2ZA6 A;  3E1Q A;  1JI4 A;  3BVI A;  3E1J A;  3AF8 X;  4MXP A;  4ZKX A;  5J8S A;  4ETR A;  1JRE A;  5D8P A;  2X17 0;  3PW1 A;  2QF9 A;  2JD7 0;  2V2R A;  2BW1 A;  3PVT A;  2GS4 A;  3HIU A;  3VVA A;  4MN9 A;  5LBH A;  4CYB A;  1XZ3 A;  3NP0 X;  3O7R A;  3FRS A;  3E1M A;  4MKU A;  1VEL A;  3PWQ C;  1RCD A;  4E6K A;  3NOZ X;  4RC6 A;  2WLU A;  4W4K B;  3WVU A;  3E1N A;  3AK8 A;  1NFV A;  1JKV A;  4REU A;  2ZG7 X;  1YUX A;  2G4H A;  1F30 A;  4MUD A;  2YJJ A;  3BVL A;  4II4 B;  4ISP A;  3PW1 B;  4LQV A;  3KDQ A;  3PVT B;  4TOB A;  5D8O A;  2FKZ A;  2HR5 A;  3E6R A;  2BKC A;  2V2M A;  4ZMC A;  3Q4O A;  4U3G A;  3M6J A;  4TOG A;  5FFD A;  5LG8 A;  3KA9 A;  4RC6 B;  4IXK A;  3QHC A;  2V8T A;  3T9J A;  4ML5 A;  1JGC A;  1TKP A;  3RGD A;  3C21 A;  3AF7 X;  4LYX A;  4OYN A;  4R42 A;  4EVC A;  2C6R A;  5I4J A;  1Z6O M;  4LQJ A;  4EVD A;  5HQO A;  2CWL A;  5FEJ A;  5GN8 B;  5FFC A;  3AJO A;  4MY7 A;  3BT5 A;  4A25 A;  2ZA8 A;  3AJP A;  4CY9 A;  2XKQ A;  5CMQ A;  4ZKW A;  2AR0 A;  3PZA A;  4M34 A;  3BVE A;  5FFA A;  3QD8 A;  3RBC A;  5D8Q A;  4DYU A;  4CVS A;  1RCE A;  3AJQ A;  5D8Y A;  1LKM A;  3KWO A;  2ZUR X;  5D8X A;  2MGY A;  2V2S A;  2Z5Q A;  3E1P A;  3UOI A;  2V2N A;  3F39 A;  4XKT A;  3SH6 A;  1Z6O A;  3Q4N A;  2GYQ A;  3OJ5 A;  3QZ3 A;  3C1Y A;  4RC8 A;  5ERJ A;  2HTN A;  2FHA A;  3PWF A;  1ZS3 A;  3FSE A;  4ERU A;  2OH3 A;  1SQ3 A;  2JD8 0;  4ZJK A;  2BK6 A;  2UX1 A;  3SID A;  2D5K A;  2XJN A;  1L8H A;  5E2D A;  4DYX A;  1JKU A;  3F33 A;  3DBY A;  1O9I A;  3C1Z A;  2V15 A;  4Z3B A;  3WNW A;  1LKP A;  4II4 A;  3QB9 A;  4ZTT A;  4RC5 B;  5JKL A;  5JDO A;  1JTS A;  4CVT A;  1IER A;  3PW8 A;  1VEQ A;  3EGM A;  4CVP A;  2PYB A;  1UMN A;  2FFX J;  1JIG A;  2W0O A;  4TOC A;  4DYZ A;  3GGY A;  3KX9 A;  3LKD A;  3RD0 A;  4TOH A;  3A9Q A;  5C6F A;  3F34 A;  1DPS A;  2V2O A;  2Y3Q A;  3KHK A;  3GVY A;  2RBD A;  3D19 A;  4PG1 A;  5GOU A;  3C23 A;  4M35 A;  1BCF A;  4EVB A;  1RCC A;  2Y44 A;  5GN8 A;  4QUW A;  1RCG A;  1S30 A;  5JDO B;  5LG2 A;  3JZA B;  4IWJ A;  3PWQ A;  5J93 A;  3KA3 A;  3F37 A;  4EVE A;  1LB3 A;  2CEI A;  3H7G A;  3ES3 A;  3AF9 X;  3VV9 A;  4DAS A;  5D8S A;  1YUZ A;  2CN6 A;  4ZL6 A;  1BFR A;  3BVF A;  3L0M A;  4Y08 A;  3U90 A;  3Q4Q A;  4Z5S A;  2VXI A;  5JAC A;  2V2P A;  5GU1 X;  2WTL A;  4MJY A;  1IES A;  2YW6 A;  4KVS A;  2IU2 A;  1N1Q A;  1OTK A;  3R2O A;  3KXU A;  5J8W A;  2XJM A;  4M32 A;  4LQH A;  4PG0 A;  1S3Q A;  3R2L A;  4ZKH A;  2OC5 A;  2YW7 A;  3KA6 A;  1ZUJ A;  3UFB A;  3BVK A;  3EZU A;  1SOF A;  4DYY A;  4YVZ A;  2WLA A;  4P18 A;  2G38 B;  3F38 A;  5HJH A;  3RE7 A;  2FZF A;  3R2S A;  2ZG8 X;  5J9V A;  4LPN A;  3WVV A;  1FHA A;  1JYB A;  3FVB A;  1XZ1 A;  1MFR A;  3V3K B;  3GE4 A;  2ZA7 A;  1JI5 A;  4RC5 A;  4CYA A;  1QGH A;  3HL1 A;  4CVR A;  2C2J A;  2C2U A;  2YJK A;  1DVB A;  3ERZ A;  5GU2 X;  2CN7 A;  5E1U A;  2CLU A;  2IB0 A;  4ISM A;  4ZL5 A;  4LYU A;  4RC7 A;  2IY4 A;  3PVY A;  3Q4R A;  4TOF A;  4W4L B;  2JD6 0; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...