4ITWA

Anaerobic crystal structure of iron soaked (75 min) ferritin from pseudo-nitzschia multiseries
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
156
structure length
155
Chain Sequence
b'EELLDLFNRQVTQEFTASQVYLSASIWFDQNDWEGMAAYMLAESAEEREHGLGFVDFANKRNIPIELQAVPAPVSAEWSSPEDVWQSILELEQANTRSLLNLAEAASTCHDFAVMAFLNPFHLQQVNEEDKIGSILAKVTDENRTPGLLRSLDVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferritin
publication title Mechanism of ferrous iron binding and oxidation by ferritin from a pennate diatom.
pubmed doi rcsb
source organism Pseudo-nitzschia multiseries
molecule tags Transport protein
total genus 72
structure length 155
sequence length 156
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4itwA00
1DPSA 5FFCA 2FG4A 1RCEA 4ZLWA 3KA8A 1NFVA 5GU1X 1YV1A 3AK9A 2Z90A 1TJOA 5D8PA 2Z6MA 1VEIA 4PGIA 4RC6A 1TKOA 5D8XA 3PVTB 5C6FA 3U90A 4ZL5A 4KVRA 4ML5A 5J93A 2WTLA 4CVRA 2FHAA 1VEQA 4CMYA 1TK6A 2FZFA 3F35A 1O9IA 4M34A 4A25A 4LQJA 3E1LA 3BVIA 1AEWA 5K53A 3OJ5A 2V2JA 5HQOA 2CEIA 1FHAA 2WLAA 3E1MA 4ISPA 4ITWA 1LKPA 2F7NA 1R03A 3BVLA 3IS7A 3KA3A 2XJMA 1QYBA 5E2DA 1VJXA 2YJKA 5FFEA 1LKOA 1N1QA 4MJYA 2CLBA 2VXXA 5I4JA 4EVEA 1LKMA 2CN7A 3PVRB 2C2JA 3PZAA 4E6KA 4ITTA 5LG2A 5CMQA 4IWJA 3F37A 5D8SA 4U3GA 2BK6A 1YUZA 2ZG9X 4TOHA 4RC7B 1RCIA 1JYBA 3H7GA 3UOFA 4Y08A 1J30A 2C41A 3BKNA 4EVBA 4CVPA 1Z6OA 4DYUA 2CLUA 1VELA 3GE4A 1ZS3A 2V2LA 3WVWA 3IQ1A 2XGWA 2XJNA 4XKTA 3GHQA 2V2SA 1IESA 3E1NA 3T9JA 4RC8A 3UOIA 1KRQA 4XKSA 3AK8A 4II4B 4M35A 1RYTA 3Q4NA 2ZA7A 5JKMG 3E1PA 2GYDA 3QD8A 1LB3A 3ISFA 5D8QA 4ZJKA 2UX1A 5J8WA 4DI0A 4TO9A 4XGSA 2CIHA 3KA6A 5LG8A 4P18A 1UVHA 4XKUA 4MN9A 3AF7X 3QHCA 4ZL6A 2GYQA 1JKVA 3PVYB 3E2CA 2VXIA 1S2ZA 3E6SA 5ERJA 5FFBA 1XZ1A 3KX9A 5CMRA 2V2PA 1S30A 1O9RA 3AF8X 4LQVA 2RBDA 1JREA 1XZ3A 1H96A 1OTKA 3QVDA 3HIUA 2C2FA 3R2KA 2ZG7X 5E1UA 1GWGA 3WVUA 4MY7A 1IERA 3Q4RA 3E1QA 4IXKA 3PW8A 3PW8C 3BT5A 3NOZX 2OH3A 4CYAA 5GN8A 4CYBA 3QB9A 3O7SA 4PGKA 3TA8A 4ETRA 4EVCA 4LYUA 3WNWA 1TKPA 2BJYA 2YW6A 4ERUA 3A68A 5CZUA 5J9VA 3R2HA 5FEJA 5HJFA 4DE6A 1UMNA 4RC6B 3O7RA 1Z4AA 3FI6A 5JACA 2CF7A 1JGCA 3SH6A 3WVVA 3E1OA 3PW1A 5GU0X 5HJHA 5IX6A 2Y3QA 3MPSA 3SHXA 3QHBA 4OYNA 4RC5A 4IWKA 1JTSA 1QGHA 4TW3A 2FKZA 4LYXA 3F39A 3UNOA 1YUXA 4AM4A 2GS4A 3PWFA 3RE7A 2C2UA 1JIGA 1NNQA 4DYZA 4Z5SA 4REUA 1RCDA 2CHPA 4DYXA 4ZTTA 2BKCA 3PVTA 2HTNA 2V2IA 3VNXA 4M32A 3RD0A 5GOUA 4LPMA 2G4HA 1L8HA 2ZA8A 3E6RA 4TOAA 4ZKXA 3A9QA 2FFXJ 1BCFA 1B71A 3BVEA 5ERKA 2ZURX 3RGDA 3FVBA 3R2OA 3BVKA 1RCGA 5JKMA 2Z5PA 4TOCA 4DYYA 4M33A 5JKLG 2FL0A 1BFRA 2W0OA 2FG8A 3NP2X 3KWOA 3AJPA 4AM2A 3AJQA 2Z5QA 5JKLA 3R2SA 3F32A 5K52A 3RAVA 4TOFA 3SE1A 2VZBA 3FSEA 3PVRA 5GU2X 4LPJA 4MUDA 2CHIA 2V2NA 2V15A 4CVSA 4RC7A 3RBCA 2JD60 1Z6OM 2ITBA 2V2MA 4ZKHA 1MFRA 4Z3BA 1BG7A 3R2RA 3F33A 1ZUJA 2HR5A 4R42A 3KA4A 3IS8A 2ZG8X 3R2LA 4TOBA 5D8OA 2JD70 3QZ3A 4CVTA 5LS9A 4KVSA 4CMYV 2IB0A 3OGHA 1JKUA 4DASA 3EZ0A 1EUMA 2CN6A 2YJJA 4MKUA 3HL1A 3E1JA 2OC5A 4TOEA 5FFDA 4II4A 3NP0X 3ISEA 2ZA6A 2FJCA 3BVFA 4YKHA 2Z5RA 4PG0A 2PYBA 4ZKWA 4LQHA 5J8SA 5LBHA 3R2MA 3F36A 3GVYA 3ERZA 3F38A 4QUWA 1SOFA 1JI5A 4EVDA 5GU3X 2BW1A 2QF9A 2X170 5D8YA 2V2RA 3PVYA 4KVQA 3KXUA 5FFAA 4ZMCA 2YW7A 1SQ3A 1F30A 5D8RA 5GN8B 3EZUA 3KA9A 3Q4OA 4LPNA 3PWQA 4PG1A 3EGMA 3PWQC 5AXSA 2IU2A 2C6RA 4AM5A 1JI4A 3AF9X 2QQYA 4LQNA 1NF4A 4TODA 1VLGA 3Q4QA 1MOJA 1S3QA 4TOGA 4ISMA 1RCCA 4DZ0A 2XJOA 1F33A 1HRSA 3PW1B 2XKQA 2WLUA 1L8IA 3SIDA 3AJOA 1DVBA 4CY9A 1NF6A 2IY4A 3F34A 4RC5B 2D5KA 1DATA 2V2OA 3ES3A 2JD80
chains in the Genus database with same CATH superfamily
1DPSA 3W54A 5FFCA 2FG4A 1RCEA 4ZLWA 3KA8A 1NFVA 5GU1X 1YV1A 3AK9A 2Z90A 1TJOA 5D8PA 2Z6MA 1VEIA 3C21A 4PGIA 4RC6A 1TKOA 5D8XA 3PVTB 5C6FA 3U90A 4ZL5A 4KVRA 4ML5A 5J93A 2WTLA 4CVRA 3GGYA 2FHAA 1VEQA 4CMYA 1TK6A 2FZFA 3F35A 1O9IA 4M34A 3V3KB 4A25A 4LQJA 3E1LA 3BVIA 2OKCA 1AEWA 5K53A 2AR0A 3OJ5A 2V2JA 5HQOA 2CEIA 1FHAA 2WLAA 3E1MA 4ISPA 4ITWA 1LKPA 2F7NA 1R03A 3BVLA 3IS7A 3KA3A 2XJMA 1QYBA 3KDQA 3JZAB 5E2DA 1VJXA 2YJKA 5FFEA 1LKOA 1N1QA 4MJYA 2CLBA 2VXXA 5I4JA 4EVEA 1LKMA 2CN7A 3PVRB 2C2JA 3PZAA 4E6KA 3LKDA 4ITTA 5LG2A 5CMQA 4IWJA 3F37A 5D8SA 4U3GA 2BK6A 1YUZA 2ZG9X 4TOHA 4RC7B 1RCIA 1JYBA 3H7GA 3UOFA 4Y08A 1J30A 2C41A 3BKNA 5JDOB 4EVBA 3M6JA 4E40A 4CVPA 1Z6OA 4DYUA 2CLUA 1VELA 3GE4A 2WWXB 1ZS3A 2V2LA 3WVWA 3IQ1A 2XGWA 2XJNA 4XKTA 3GHQA 2V2SA 1IESA 3E1NA 3T9JA 4RC8A 3UOIA 3DBYA 1KRQA 4XKSA 3AK8A 4II4B 4M35A 1RYTA 3Q4NA 2ZA7A 5JKMG 3E1PA 2GYDA 3QD8A 1LB3A 3ISFA 5D8QA 4ZJKA 2UX1A 5J8WA 4DI0A 4TO9A 4XGSA 2CIHA 3KA6A 5LG8A 4P18A 1UVHA 4XKUA 4MN9A 3AF7X 3QHCA 4ZL6A 2GYQA 1JKVA 3PVYB 3E2CA 2VXIA 1S2ZA 3E6SA 3C1ZA 5ERJA 5FFBA 1XZ1A 3KX9A 5CMRA 2V2PA 1S30A 1O9RA 3AF8X 4LQVA 2RBDA 1JREA 1XZ3A 1H96A 1OTKA 3QVDA 3HIUA 2C2FA 3R2KA 2ZG7X 5E1UA 1GWGA 4YXMA 3WVUA 3VV9A 4MY7A 1IERA 3Q4RA 3E1QA 4IXKA 3PW8A 3PW8C 3BT5A 3NOZX 2OH3A 3JZ9A 4CYAA 5GN8A 4CYBA 3QB9A 3O7SA 4PGKA 3TA8A 4ETRA 4EVCA 4LYUA 3WNWA 1TKPA 2BJYA 2YW6A 4ERUA 3A68A 5CZUA 5J9VA 3R2HA 5FEJA 5HJFA 3KHKA 4DE6A 1UMNA 4RC6B 3O7RA 1Z4AA 3FI6A 5JACA 2CF7A 1JGCA 3SH6A 3WVVA 3E1OA 3PW1A 5GU0X 5HJHA 5IX6A 2Y3QA 3MPSA 3SHXA 3QHBA 4OYNA 4RC5A 4IWKA 1JTSA 1QGHA 4TW3A 2FKZA 4LYXA 3F39A 3UNOA 2V8UA 1YUXA 4AM4A 2GS4A 3PWFA 4W4LB 3RE7A 2C2UA 1JIGA 1NNQA 4DYZA 4Z5SA 4REUA 1RCDA 2CHPA 4DYXA 4ZTTA 2BKCA 3PVTA 2HTNA 2V8TA 2V2IA 3VNXA 4M32A 3RD0A 4W4KB 5GOUA 4LPMA 2G4HA 3N6OA 1L8HA 2ZA8A 3E6RA 4TOAA 4ZKXA 3GGZA 3A9QA 2FFXJ 1BCFA 1B71A 3BVEA 5ERKA 4YXJA 2ZURX 3RGDA 3FVBA 3R2OA 3BVKA 1RCGA 5JKMA 2Z5PA 4TOCA 4DYYA 4M33A 5JKLG 2FL0A 1BFRA 2W0OA 2FG8A 3NP2X 3KWOA 3AJPA 4AM2A 3AJQA 2Z5QA 2Y44A 5JKLA 3R2SA 3F32A 5K52A 3RAVA 4KXRB 4TOFA 3SE1A 2VZBA 3FSEA 4MXPA 4X0JA 3PVRA 5GU2X 4LPJA 4MUDA 2CHIA 2V2NA 2V15A 4CVSA 3FRSA 4RC7A 3RBCA 2JD60 1Z6OM 2ITBA 2V2MA 4WJG4 4ZKHA 1MFRA 4Z3BA 1BG7A 3R2RA 3F33A 1ZUJA 5JDOA 2HR5A 4R42A 3KA4A 3IS8A 2ZG8X 3R2LA 4TOBA 5D8OA 2JD70 3QZ3A 4CVTA 3UFBA 5LS9A 4KVSA 4CMYV 2IB0A 3OGHA 1JKUA 4DASA 3EZ0A 1EUMA 2CN6A 2YJJA 4MKUA 3HL1A 3E1JA 2OC5A 4TOEA 5FFDA 4II4A 3NP0X 3ISEA 2ZA6A 2FJCA 3BVFA 4YKHA 2Z5RA 4PG0A 2PYBA 4ZKWA 4LQHA 5J8SA 5LBHA 3R2MA 3F36A 3GVYA 3ERZA 3F38A 4QUWA 1SOFA 4YVZA 1JI5A 4EVDA 5GU3X 2BW1A 2QF9A 2X170 5D8YA 5HU6D 2V2RA 3PVYA 4KVQA 3KXUA 5FFAA 4ZMCA 2YW7A 1SQ3A 1F30A 5D8RA 5GN8B 3EZUA 3KA9A 3Q4OA 4LPNA 3PWQA 4PG1A 3L0MA 3EGMA 3PWQC 5AXSA 2IU2A 2C6RA 4AM5A 3C23A 1JI4A 3AF9X 3FRRA 2QQYA 4LQNA 1NF4A 4TODA 3C1YA 1VLGA 3Q4QA 1MOJA 1S3QA 4TOGA 4ISMA 1RCCA 4DZ0A 2XJOA 2G38B 1F33A 1HRSA 3PW1B 2XKQA 2WLUA 1L8IA 2CWLA 3SIDA 2MGYA 3AJOA 1DVBA 3VVAA 4CY9A 1NF6A 2IY4A 3F34A 4RC5B 2N02A 2D5KA 1DATA 2V2OA 3ES3A 3D19A 2JD80
chains in the Genus database with same CATH topology
1DPSA 3W54A 5FFCA 2FG4A 1RCEA 4ZLWA 3KA8A 1NFVA 5GU1X 1YV1A 3AK9A 2Z90A 1TJOA 5D8PA 2Z6MA 1VEIA 3C21A 4PGIA 4RC6A 1TKOA 5D8XA 3PVTB 5C6FA 3U90A 4ZL5A 4KVRA 4ML5A 5J93A 2WTLA 4CVRA 3GGYA 2FHAA 1VEQA 4CMYA 1TK6A 2FZFA 3F35A 1O9IA 4M34A 3V3KB 4A25A 4LQJA 3E1LA 3BVIA 2OKCA 1AEWA 5K53A 2AR0A 3OJ5A 2V2JA 5HQOA 2CEIA 1FHAA 2WLAA 3E1MA 4ISPA 4ITWA 1LKPA 2F7NA 1R03A 3BVLA 3IS7A 3KA3A 2XJMA 1QYBA 3KDQA 3JZAB 5E2DA 1VJXA 2YJKA 5FFEA 1LKOA 1N1QA 4MJYA 2CLBA 2VXXA 5I4JA 4EVEA 1LKMA 2CN7A 3PVRB 2C2JA 3PZAA 4E6KA 3LKDA 4ITTA 5LG2A 5CMQA 4IWJA 3F37A 5D8SA 4U3GA 2BK6A 1YUZA 2ZG9X 4TOHA 4RC7B 1RCIA 1JYBA 3H7GA 3UOFA 4Y08A 1J30A 2C41A 3BKNA 5JDOB 4EVBA 3M6JA 4E40A 4CVPA 1Z6OA 4DYUA 2CLUA 1VELA 3GE4A 2WWXB 1ZS3A 2V2LA 3WVWA 3IQ1A 2XGWA 2XJNA 4XKTA 3GHQA 2V2SA 1IESA 3E1NA 3T9JA 4RC8A 3UOIA 3DBYA 1KRQA 4XKSA 3AK8A 4II4B 4M35A 1RYTA 3Q4NA 2ZA7A 5JKMG 3E1PA 2GYDA 3QD8A 1LB3A 3ISFA 5D8QA 4ZJKA 2UX1A 5J8WA 4DI0A 4TO9A 4XGSA 2CIHA 3KA6A 5LG8A 4P18A 1UVHA 4XKUA 4MN9A 3AF7X 3QHCA 4ZL6A 2GYQA 1JKVA 3PVYB 3E2CA 2VXIA 1S2ZA 3E6SA 3C1ZA 5ERJA 5FFBA 1XZ1A 3KX9A 5CMRA 2V2PA 1S30A 1O9RA 3AF8X 4LQVA 2RBDA 1JREA 1XZ3A 1H96A 1OTKA 3QVDA 3HIUA 2C2FA 3R2KA 2ZG7X 5E1UA 1GWGA 4YXMA 3WVUA 3VV9A 4MY7A 1IERA 3Q4RA 3E1QA 4IXKA 3PW8A 3PW8C 3BT5A 3NOZX 2OH3A 3JZ9A 4CYAA 5GN8A 4CYBA 3QB9A 3O7SA 4PGKA 3TA8A 4ETRA 4EVCA 4LYUA 3WNWA 1TKPA 2BJYA 2YW6A 4ERUA 3A68A 5CZUA 5J9VA 3R2HA 5FEJA 5HJFA 3KHKA 4DE6A 1UMNA 4RC6B 3O7RA 1Z4AA 3FI6A 5JACA 2CF7A 1JGCA 3SH6A 3WVVA 3E1OA 3PW1A 5GU0X 5HJHA 5IX6A 2Y3QA 3MPSA 3SHXA 3QHBA 4OYNA 4RC5A 4IWKA 1JTSA 1QGHA 4TW3A 2FKZA 4LYXA 3F39A 3UNOA 2V8UA 1YUXA 4AM4A 2GS4A 3PWFA 4W4LB 3RE7A 2C2UA 1JIGA 1NNQA 4DYZA 4Z5SA 4REUA 1RCDA 2CHPA 4DYXA 4ZTTA 2BKCA 3PVTA 2HTNA 2V8TA 2V2IA 3VNXA 4M32A 3RD0A 4W4KB 5GOUA 4LPMA 2G4HA 3N6OA 1L8HA 2ZA8A 3E6RA 4TOAA 4ZKXA 3GGZA 3A9QA 2FFXJ 1BCFA 1B71A 3BVEA 5ERKA 4YXJA 2ZURX 3RGDA 3FVBA 3R2OA 3BVKA 1RCGA 5JKMA 2Z5PA 4TOCA 4DYYA 4M33A 5JKLG 2FL0A 1BFRA 2W0OA 2FG8A 3NP2X 3KWOA 3AJPA 4AM2A 3AJQA 2Z5QA 2Y44A 5JKLA 3R2SA 3F32A 5K52A 3RAVA 4KXRB 4TOFA 3SE1A 2VZBA 3FSEA 4MXPA 4X0JA 3PVRA 5GU2X 4LPJA 4MUDA 2CHIA 2V2NA 2V15A 4CVSA 3FRSA 4RC7A 3RBCA 2JD60 1Z6OM 2ITBA 2V2MA 4WJG4 4ZKHA 1MFRA 4Z3BA 1BG7A 3R2RA 3F33A 1ZUJA 5JDOA 2HR5A 4R42A 3KA4A 3IS8A 2ZG8X 3R2LA 4TOBA 5D8OA 2JD70 3QZ3A 4CVTA 3UFBA 5LS9A 4KVSA 4CMYV 2IB0A 3OGHA 1JKUA 4DASA 3EZ0A 1EUMA 2CN6A 2YJJA 4MKUA 3HL1A 3E1JA 2OC5A 4TOEA 5FFDA 4II4A 3NP0X 3ISEA 2ZA6A 2FJCA 3BVFA 4YKHA 2Z5RA 4PG0A 2PYBA 4ZKWA 4LQHA 5J8SA 5LBHA 3R2MA 3F36A 3GVYA 3ERZA 3F38A 4QUWA 1SOFA 4YVZA 1JI5A 4EVDA 5GU3X 2BW1A 2QF9A 2X170 5D8YA 5HU6D 2V2RA 3PVYA 4KVQA 3KXUA 5FFAA 4ZMCA 2YW7A 1SQ3A 1F30A 5D8RA 5GN8B 3EZUA 3KA9A 3Q4OA 4LPNA 3PWQA 4PG1A 3L0MA 3EGMA 3PWQC 5AXSA 2IU2A 2C6RA 4AM5A 3C23A 1JI4A 3AF9X 3FRRA 2QQYA 4LQNA 1NF4A 4TODA 3C1YA 1VLGA 3Q4QA 1MOJA 1S3QA 4TOGA 4ISMA 1RCCA 4DZ0A 2XJOA 2G38B 1F33A 1HRSA 3PW1B 2XKQA 2WLUA 1L8IA 2CWLA 3SIDA 2MGYA 3AJOA 1DVBA 3VVAA 4CY9A 1NF6A 2IY4A 3F34A 4RC5B 2N02A 2D5KA 1DATA 2V2OA 3ES3A 3D19A 2JD80
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DPS A;  5FFC A;  2FG4 A;  1RCE A;  4ZLW A;  3KA8 A;  1NFV A;  5GU1 X;  1YV1 A;  3AK9 A;  2Z90 A;  1TJO A;  5D8P A;  2Z6M A;  1VEI A;  4PGI A;  4RC6 A;  1TKO A;  5D8X A;  3PVT B;  5C6F A;  3U90 A;  4ZL5 A;  4KVR A;  4ML5 A;  5J93 A;  2WTL A;  4CVR A;  2FHA A;  1VEQ A;  4CMY A;  1TK6 A;  2FZF A;  3F35 A;  1O9I A;  4M34 A;  4A25 A;  4LQJ A;  3E1L A;  3BVI A;  1AEW A;  5K53 A;  3OJ5 A;  2V2J A;  5HQO A;  2CEI A;  1FHA A;  2WLA A;  3E1M A;  4ISP A;  4ITW A;  1LKP A;  2F7N A;  1R03 A;  3BVL A;  3IS7 A;  3KA3 A;  2XJM A;  1QYB A;  5E2D A;  1VJX A;  2YJK A;  5FFE A;  1LKO A;  1N1Q A;  4MJY A;  2CLB A;  2VXX A;  5I4J A;  4EVE A;  1LKM A;  2CN7 A;  3PVR B;  2C2J A;  3PZA A;  4E6K A;  4ITT A;  5LG2 A;  5CMQ A;  4IWJ A;  3F37 A;  5D8S A;  4U3G A;  2BK6 A;  1YUZ A;  2ZG9 X;  4TOH A;  4RC7 B;  1RCI A;  1JYB A;  3H7G A;  3UOF A;  4Y08 A;  1J30 A;  2C41 A;  3BKN A;  4EVB A;  4CVP A;  1Z6O A;  4DYU A;  2CLU A;  1VEL A;  3GE4 A;  1ZS3 A;  2V2L A;  3WVW A;  3IQ1 A;  2XGW A;  2XJN A;  4XKT A;  3GHQ A;  2V2S A;  1IES A;  3E1N A;  3T9J A;  4RC8 A;  3UOI A;  1KRQ A;  4XKS A;  3AK8 A;  4II4 B;  4M35 A;  1RYT A;  3Q4N A;  2ZA7 A;  5JKM G;  3E1P A;  2GYD A;  3QD8 A;  1LB3 A;  3ISF A;  5D8Q A;  4ZJK A;  2UX1 A;  5J8W A;  4DI0 A;  4TO9 A;  4XGS A;  2CIH A;  3KA6 A;  5LG8 A;  4P18 A;  1UVH A;  4XKU A;  4MN9 A;  3AF7 X;  3QHC A;  4ZL6 A;  2GYQ A;  1JKV A;  3PVY B;  3E2C A;  2VXI A;  1S2Z A;  3E6S A;  5ERJ A;  5FFB A;  1XZ1 A;  3KX9 A;  5CMR A;  2V2P A;  1S30 A;  1O9R A;  3AF8 X;  4LQV A;  2RBD A;  1JRE A;  1XZ3 A;  1H96 A;  1OTK A;  3QVD A;  3HIU A;  2C2F A;  3R2K A;  2ZG7 X;  5E1U A;  1GWG A;  3WVU A;  4MY7 A;  1IER A;  3Q4R A;  3E1Q A;  4IXK A;  3PW8 A;  3PW8 C;  3BT5 A;  3NOZ X;  2OH3 A;  4CYA A;  5GN8 A;  4CYB A;  3QB9 A;  3O7S A;  4PGK A;  3TA8 A;  4ETR A;  4EVC A;  4LYU A;  3WNW A;  1TKP A;  2BJY A;  2YW6 A;  4ERU A;  3A68 A;  5CZU A;  5J9V A;  3R2H A;  5FEJ A;  5HJF A;  4DE6 A;  1UMN A;  4RC6 B;  3O7R A;  1Z4A A;  3FI6 A;  5JAC A;  2CF7 A;  1JGC A;  3SH6 A;  3WVV A;  3E1O A;  3PW1 A;  5GU0 X;  5HJH A;  5IX6 A;  2Y3Q A;  3MPS A;  3SHX A;  3QHB A;  4OYN A;  4RC5 A;  4IWK A;  1JTS A;  1QGH A;  4TW3 A;  2FKZ A;  4LYX A;  3F39 A;  3UNO A;  1YUX A;  4AM4 A;  2GS4 A;  3PWF A;  3RE7 A;  2C2U A;  1JIG A;  1NNQ A;  4DYZ A;  4Z5S A;  4REU A;  1RCD A;  2CHP A;  4DYX A;  4ZTT A;  2BKC A;  3PVT A;  2HTN A;  2V2I A;  3VNX A;  4M32 A;  3RD0 A;  5GOU A;  4LPM A;  2G4H A;  1L8H A;  2ZA8 A;  3E6R A;  4TOA A;  4ZKX A;  3A9Q A;  2FFX J;  1BCF A;  1B71 A;  3BVE A;  5ERK A;  2ZUR X;  3RGD A;  3FVB A;  3R2O A;  3BVK A;  1RCG A;  5JKM A;  2Z5P A;  4TOC A;  4DYY A;  4M33 A;  5JKL G;  2FL0 A;  1BFR A;  2W0O A;  2FG8 A;  3NP2 X;  3KWO A;  3AJP A;  4AM2 A;  3AJQ A;  2Z5Q A;  5JKL A;  3R2S A;  3F32 A;  5K52 A;  3RAV A;  4TOF A;  3SE1 A;  2VZB A;  3FSE A;  3PVR A;  5GU2 X;  4LPJ A;  4MUD A;  2CHI A;  2V2N A;  2V15 A;  4CVS A;  4RC7 A;  3RBC A;  2JD6 0;  1Z6O M;  2ITB A;  2V2M A;  4ZKH A;  1MFR A;  4Z3B A;  1BG7 A;  3R2R A;  3F33 A;  1ZUJ A;  2HR5 A;  4R42 A;  3KA4 A;  3IS8 A;  2ZG8 X;  3R2L A;  4TOB A;  5D8O A;  2JD7 0;  3QZ3 A;  4CVT A;  5LS9 A;  4KVS A;  4CMY V;  2IB0 A;  3OGH A;  1JKU A;  4DAS A;  3EZ0 A;  1EUM A;  2CN6 A;  2YJJ A;  4MKU A;  3HL1 A;  3E1J A;  2OC5 A;  4TOE A;  5FFD A;  4II4 A;  3NP0 X;  3ISE A;  2ZA6 A;  2FJC A;  3BVF A;  4YKH A;  2Z5R A;  4PG0 A;  2PYB A;  4ZKW A;  4LQH A;  5J8S A;  5LBH A;  3R2M A;  3F36 A;  3GVY A;  3ERZ A;  3F38 A;  4QUW A;  1SOF A;  1JI5 A;  4EVD A;  5GU3 X;  2BW1 A;  2QF9 A;  2X17 0;  5D8Y A;  2V2R A;  3PVY A;  4KVQ A;  3KXU A;  5FFA A;  4ZMC A;  2YW7 A;  1SQ3 A;  1F30 A;  5D8R A;  5GN8 B;  3EZU A;  3KA9 A;  3Q4O A;  4LPN A;  3PWQ A;  4PG1 A;  3EGM A;  3PWQ C;  5AXS A;  2IU2 A;  2C6R A;  4AM5 A;  1JI4 A;  3AF9 X;  2QQY A;  4LQN A;  1NF4 A;  4TOD A;  1VLG A;  3Q4Q A;  1MOJ A;  1S3Q A;  4TOG A;  4ISM A;  1RCC A;  4DZ0 A;  2XJO A;  1F33 A;  1HRS A;  3PW1 B;  2XKQ A;  2WLU A;  1L8I A;  3SID A;  3AJO A;  1DVB A;  4CY9 A;  1NF6 A;  2IY4 A;  3F34 A;  4RC5 B;  2D5K A;  1DAT A;  2V2O A;  3ES3 A;  2JD8 0; 
#chains in the Genus database with same CATH topology
 1DPS A;  3W54 A;  5FFC A;  2FG4 A;  1RCE A;  4ZLW A;  3KA8 A;  1NFV A;  5GU1 X;  1YV1 A;  3AK9 A;  2Z90 A;  1TJO A;  5D8P A;  2Z6M A;  1VEI A;  3C21 A;  4PGI A;  4RC6 A;  1TKO A;  5D8X A;  3PVT B;  5C6F A;  3U90 A;  4ZL5 A;  4KVR A;  4ML5 A;  5J93 A;  2WTL A;  4CVR A;  3GGY A;  2FHA A;  1VEQ A;  4CMY A;  1TK6 A;  2FZF A;  3F35 A;  1O9I A;  4M34 A;  3V3K B;  4A25 A;  4LQJ A;  3E1L A;  3BVI A;  2OKC A;  1AEW A;  5K53 A;  2AR0 A;  3OJ5 A;  2V2J A;  5HQO A;  2CEI A;  1FHA A;  2WLA A;  3E1M A;  4ISP A;  4ITW A;  1LKP A;  2F7N A;  1R03 A;  3BVL A;  3IS7 A;  3KA3 A;  2XJM A;  1QYB A;  3KDQ A;  3JZA B;  5E2D A;  1VJX A;  2YJK A;  5FFE A;  1LKO A;  1N1Q A;  4MJY A;  2CLB A;  2VXX A;  5I4J A;  4EVE A;  1LKM A;  2CN7 A;  3PVR B;  2C2J A;  3PZA A;  4E6K A;  3LKD A;  4ITT A;  5LG2 A;  5CMQ A;  4IWJ A;  3F37 A;  5D8S A;  4U3G A;  2BK6 A;  1YUZ A;  2ZG9 X;  4TOH A;  4RC7 B;  1RCI A;  1JYB A;  3H7G A;  3UOF A;  4Y08 A;  1J30 A;  2C41 A;  3BKN A;  5JDO B;  4EVB A;  3M6J A;  4E40 A;  4CVP A;  1Z6O A;  4DYU A;  2CLU A;  1VEL A;  3GE4 A;  2WWX B;  1ZS3 A;  2V2L A;  3WVW A;  3IQ1 A;  2XGW A;  2XJN A;  4XKT A;  3GHQ A;  2V2S A;  1IES A;  3E1N A;  3T9J A;  4RC8 A;  3UOI A;  3DBY A;  1KRQ A;  4XKS A;  3AK8 A;  4II4 B;  4M35 A;  1RYT A;  3Q4N A;  2ZA7 A;  5JKM G;  3E1P A;  2GYD A;  3QD8 A;  1LB3 A;  3ISF A;  5D8Q A;  4ZJK A;  2UX1 A;  5J8W A;  4DI0 A;  4TO9 A;  4XGS A;  2CIH A;  3KA6 A;  5LG8 A;  4P18 A;  1UVH A;  4XKU A;  4MN9 A;  3AF7 X;  3QHC A;  4ZL6 A;  2GYQ A;  1JKV A;  3PVY B;  3E2C A;  2VXI A;  1S2Z A;  3E6S A;  3C1Z A;  5ERJ A;  5FFB A;  1XZ1 A;  3KX9 A;  5CMR A;  2V2P A;  1S30 A;  1O9R A;  3AF8 X;  4LQV A;  2RBD A;  1JRE A;  1XZ3 A;  1H96 A;  1OTK A;  3QVD A;  3HIU A;  2C2F A;  3R2K A;  2ZG7 X;  5E1U A;  1GWG A;  4YXM A;  3WVU A;  3VV9 A;  4MY7 A;  1IER A;  3Q4R A;  3E1Q A;  4IXK A;  3PW8 A;  3PW8 C;  3BT5 A;  3NOZ X;  2OH3 A;  3JZ9 A;  4CYA A;  5GN8 A;  4CYB A;  3QB9 A;  3O7S A;  4PGK A;  3TA8 A;  4ETR A;  4EVC A;  4LYU A;  3WNW A;  1TKP A;  2BJY A;  2YW6 A;  4ERU A;  3A68 A;  5CZU A;  5J9V A;  3R2H A;  5FEJ A;  5HJF A;  3KHK A;  4DE6 A;  1UMN A;  4RC6 B;  3O7R A;  1Z4A A;  3FI6 A;  5JAC A;  2CF7 A;  1JGC A;  3SH6 A;  3WVV A;  3E1O A;  3PW1 A;  5GU0 X;  5HJH A;  5IX6 A;  2Y3Q A;  3MPS A;  3SHX A;  3QHB A;  4OYN A;  4RC5 A;  4IWK A;  1JTS A;  1QGH A;  4TW3 A;  2FKZ A;  4LYX A;  3F39 A;  3UNO A;  2V8U A;  1YUX A;  4AM4 A;  2GS4 A;  3PWF A;  4W4L B;  3RE7 A;  2C2U A;  1JIG A;  1NNQ A;  4DYZ A;  4Z5S A;  4REU A;  1RCD A;  2CHP A;  4DYX A;  4ZTT A;  2BKC A;  3PVT A;  2HTN A;  2V8T A;  2V2I A;  3VNX A;  4M32 A;  3RD0 A;  4W4K B;  5GOU A;  4LPM A;  2G4H A;  3N6O A;  1L8H A;  2ZA8 A;  3E6R A;  4TOA A;  4ZKX A;  3GGZ A;  3A9Q A;  2FFX J;  1BCF A;  1B71 A;  3BVE A;  5ERK A;  4YXJ A;  2ZUR X;  3RGD A;  3FVB A;  3R2O A;  3BVK A;  1RCG A;  5JKM A;  2Z5P A;  4TOC A;  4DYY A;  4M33 A;  5JKL G;  2FL0 A;  1BFR A;  2W0O A;  2FG8 A;  3NP2 X;  3KWO A;  3AJP A;  4AM2 A;  3AJQ A;  2Z5Q A;  2Y44 A;  5JKL A;  3R2S A;  3F32 A;  5K52 A;  3RAV A;  4KXR B;  4TOF A;  3SE1 A;  2VZB A;  3FSE A;  4MXP A;  4X0J A;  3PVR A;  5GU2 X;  4LPJ A;  4MUD A;  2CHI A;  2V2N A;  2V15 A;  4CVS A;  3FRS A;  4RC7 A;  3RBC A;  2JD6 0;  1Z6O M;  2ITB A;  2V2M A;  4WJG 4;  4ZKH A;  1MFR A;  4Z3B A;  1BG7 A;  3R2R A;  3F33 A;  1ZUJ A;  5JDO A;  2HR5 A;  4R42 A;  3KA4 A;  3IS8 A;  2ZG8 X;  3R2L A;  4TOB A;  5D8O A;  2JD7 0;  3QZ3 A;  4CVT A;  3UFB A;  5LS9 A;  4KVS A;  4CMY V;  2IB0 A;  3OGH A;  1JKU A;  4DAS A;  3EZ0 A;  1EUM A;  2CN6 A;  2YJJ A;  4MKU A;  3HL1 A;  3E1J A;  2OC5 A;  4TOE A;  5FFD A;  4II4 A;  3NP0 X;  3ISE A;  2ZA6 A;  2FJC A;  3BVF A;  4YKH A;  2Z5R A;  4PG0 A;  2PYB A;  4ZKW A;  4LQH A;  5J8S A;  5LBH A;  3R2M A;  3F36 A;  3GVY A;  3ERZ A;  3F38 A;  4QUW A;  1SOF A;  4YVZ A;  1JI5 A;  4EVD A;  5GU3 X;  2BW1 A;  2QF9 A;  2X17 0;  5D8Y A;  5HU6 D;  2V2R A;  3PVY A;  4KVQ A;  3KXU A;  5FFA A;  4ZMC A;  2YW7 A;  1SQ3 A;  1F30 A;  5D8R A;  5GN8 B;  3EZU A;  3KA9 A;  3Q4O A;  4LPN A;  3PWQ A;  4PG1 A;  3L0M A;  3EGM A;  3PWQ C;  5AXS A;  2IU2 A;  2C6R A;  4AM5 A;  3C23 A;  1JI4 A;  3AF9 X;  3FRR A;  2QQY A;  4LQN A;  1NF4 A;  4TOD A;  3C1Y A;  1VLG A;  3Q4Q A;  1MOJ A;  1S3Q A;  4TOG A;  4ISM A;  1RCC A;  4DZ0 A;  2XJO A;  2G38 B;  1F33 A;  1HRS A;  3PW1 B;  2XKQ A;  2WLU A;  1L8I A;  2CWL A;  3SID A;  2MGY A;  3AJO A;  1DVB A;  3VVA A;  4CY9 A;  1NF6 A;  2IY4 A;  3F34 A;  4RC5 B;  2N02 A;  2D5K A;  1DAT A;  2V2O A;  3ES3 A;  3D19 A;  2JD8 0; 
#chains in the Genus database with same CATH homology
 1DPS A;  3W54 A;  5FFC A;  2FG4 A;  1RCE A;  4ZLW A;  3KA8 A;  1NFV A;  5GU1 X;  1YV1 A;  3AK9 A;  2Z90 A;  1TJO A;  5D8P A;  2Z6M A;  1VEI A;  3C21 A;  4PGI A;  4RC6 A;  1TKO A;  5D8X A;  3PVT B;  5C6F A;  3U90 A;  4ZL5 A;  4KVR A;  4ML5 A;  5J93 A;  2WTL A;  4CVR A;  3GGY A;  2FHA A;  1VEQ A;  4CMY A;  1TK6 A;  2FZF A;  3F35 A;  1O9I A;  4M34 A;  3V3K B;  4A25 A;  4LQJ A;  3E1L A;  3BVI A;  2OKC A;  1AEW A;  5K53 A;  2AR0 A;  3OJ5 A;  2V2J A;  5HQO A;  2CEI A;  1FHA A;  2WLA A;  3E1M A;  4ISP A;  4ITW A;  1LKP A;  2F7N A;  1R03 A;  3BVL A;  3IS7 A;  3KA3 A;  2XJM A;  1QYB A;  3KDQ A;  3JZA B;  5E2D A;  1VJX A;  2YJK A;  5FFE A;  1LKO A;  1N1Q A;  4MJY A;  2CLB A;  2VXX A;  5I4J A;  4EVE A;  1LKM A;  2CN7 A;  3PVR B;  2C2J A;  3PZA A;  4E6K A;  3LKD A;  4ITT A;  5LG2 A;  5CMQ A;  4IWJ A;  3F37 A;  5D8S A;  4U3G A;  2BK6 A;  1YUZ A;  2ZG9 X;  4TOH A;  4RC7 B;  1RCI A;  1JYB A;  3H7G A;  3UOF A;  4Y08 A;  1J30 A;  2C41 A;  3BKN A;  5JDO B;  4EVB A;  3M6J A;  4E40 A;  4CVP A;  1Z6O A;  4DYU A;  2CLU A;  1VEL A;  3GE4 A;  2WWX B;  1ZS3 A;  2V2L A;  3WVW A;  3IQ1 A;  2XGW A;  2XJN A;  4XKT A;  3GHQ A;  2V2S A;  1IES A;  3E1N A;  3T9J A;  4RC8 A;  3UOI A;  3DBY A;  1KRQ A;  4XKS A;  3AK8 A;  4II4 B;  4M35 A;  1RYT A;  3Q4N A;  2ZA7 A;  5JKM G;  3E1P A;  2GYD A;  3QD8 A;  1LB3 A;  3ISF A;  5D8Q A;  4ZJK A;  2UX1 A;  5J8W A;  4DI0 A;  4TO9 A;  4XGS A;  2CIH A;  3KA6 A;  5LG8 A;  4P18 A;  1UVH A;  4XKU A;  4MN9 A;  3AF7 X;  3QHC A;  4ZL6 A;  2GYQ A;  1JKV A;  3PVY B;  3E2C A;  2VXI A;  1S2Z A;  3E6S A;  3C1Z A;  5ERJ A;  5FFB A;  1XZ1 A;  3KX9 A;  5CMR A;  2V2P A;  1S30 A;  1O9R A;  3AF8 X;  4LQV A;  2RBD A;  1JRE A;  1XZ3 A;  1H96 A;  1OTK A;  3QVD A;  3HIU A;  2C2F A;  3R2K A;  2ZG7 X;  5E1U A;  1GWG A;  4YXM A;  3WVU A;  3VV9 A;  4MY7 A;  1IER A;  3Q4R A;  3E1Q A;  4IXK A;  3PW8 A;  3PW8 C;  3BT5 A;  3NOZ X;  2OH3 A;  3JZ9 A;  4CYA A;  5GN8 A;  4CYB A;  3QB9 A;  3O7S A;  4PGK A;  3TA8 A;  4ETR A;  4EVC A;  4LYU A;  3WNW A;  1TKP A;  2BJY A;  2YW6 A;  4ERU A;  3A68 A;  5CZU A;  5J9V A;  3R2H A;  5FEJ A;  5HJF A;  3KHK A;  4DE6 A;  1UMN A;  4RC6 B;  3O7R A;  1Z4A A;  3FI6 A;  5JAC A;  2CF7 A;  1JGC A;  3SH6 A;  3WVV A;  3E1O A;  3PW1 A;  5GU0 X;  5HJH A;  5IX6 A;  2Y3Q A;  3MPS A;  3SHX A;  3QHB A;  4OYN A;  4RC5 A;  4IWK A;  1JTS A;  1QGH A;  4TW3 A;  2FKZ A;  4LYX A;  3F39 A;  3UNO A;  2V8U A;  1YUX A;  4AM4 A;  2GS4 A;  3PWF A;  4W4L B;  3RE7 A;  2C2U A;  1JIG A;  1NNQ A;  4DYZ A;  4Z5S A;  4REU A;  1RCD A;  2CHP A;  4DYX A;  4ZTT A;  2BKC A;  3PVT A;  2HTN A;  2V8T A;  2V2I A;  3VNX A;  4M32 A;  3RD0 A;  4W4K B;  5GOU A;  4LPM A;  2G4H A;  3N6O A;  1L8H A;  2ZA8 A;  3E6R A;  4TOA A;  4ZKX A;  3GGZ A;  3A9Q A;  2FFX J;  1BCF A;  1B71 A;  3BVE A;  5ERK A;  4YXJ A;  2ZUR X;  3RGD A;  3FVB A;  3R2O A;  3BVK A;  1RCG A;  5JKM A;  2Z5P A;  4TOC A;  4DYY A;  4M33 A;  5JKL G;  2FL0 A;  1BFR A;  2W0O A;  2FG8 A;  3NP2 X;  3KWO A;  3AJP A;  4AM2 A;  3AJQ A;  2Z5Q A;  2Y44 A;  5JKL A;  3R2S A;  3F32 A;  5K52 A;  3RAV A;  4KXR B;  4TOF A;  3SE1 A;  2VZB A;  3FSE A;  4MXP A;  4X0J A;  3PVR A;  5GU2 X;  4LPJ A;  4MUD A;  2CHI A;  2V2N A;  2V15 A;  4CVS A;  3FRS A;  4RC7 A;  3RBC A;  2JD6 0;  1Z6O M;  2ITB A;  2V2M A;  4WJG 4;  4ZKH A;  1MFR A;  4Z3B A;  1BG7 A;  3R2R A;  3F33 A;  1ZUJ A;  5JDO A;  2HR5 A;  4R42 A;  3KA4 A;  3IS8 A;  2ZG8 X;  3R2L A;  4TOB A;  5D8O A;  2JD7 0;  3QZ3 A;  4CVT A;  3UFB A;  5LS9 A;  4KVS A;  4CMY V;  2IB0 A;  3OGH A;  1JKU A;  4DAS A;  3EZ0 A;  1EUM A;  2CN6 A;  2YJJ A;  4MKU A;  3HL1 A;  3E1J A;  2OC5 A;  4TOE A;  5FFD A;  4II4 A;  3NP0 X;  3ISE A;  2ZA6 A;  2FJC A;  3BVF A;  4YKH A;  2Z5R A;  4PG0 A;  2PYB A;  4ZKW A;  4LQH A;  5J8S A;  5LBH A;  3R2M A;  3F36 A;  3GVY A;  3ERZ A;  3F38 A;  4QUW A;  1SOF A;  4YVZ A;  1JI5 A;  4EVD A;  5GU3 X;  2BW1 A;  2QF9 A;  2X17 0;  5D8Y A;  5HU6 D;  2V2R A;  3PVY A;  4KVQ A;  3KXU A;  5FFA A;  4ZMC A;  2YW7 A;  1SQ3 A;  1F30 A;  5D8R A;  5GN8 B;  3EZU A;  3KA9 A;  3Q4O A;  4LPN A;  3PWQ A;  4PG1 A;  3L0M A;  3EGM A;  3PWQ C;  5AXS A;  2IU2 A;  2C6R A;  4AM5 A;  3C23 A;  1JI4 A;  3AF9 X;  3FRR A;  2QQY A;  4LQN A;  1NF4 A;  4TOD A;  3C1Y A;  1VLG A;  3Q4Q A;  1MOJ A;  1S3Q A;  4TOG A;  4ISM A;  1RCC A;  4DZ0 A;  2XJO A;  2G38 B;  1F33 A;  1HRS A;  3PW1 B;  2XKQ A;  2WLU A;  1L8I A;  2CWL A;  3SID A;  2MGY A;  3AJO A;  1DVB A;  3VVA A;  4CY9 A;  1NF6 A;  2IY4 A;  3F34 A;  4RC5 B;  2N02 A;  2D5K A;  1DAT A;  2V2O A;  3ES3 A;  3D19 A;  2JD8 0; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...