3BVEA

Structural basis for the iron uptake mechanism of helicobacter pylori ferritin
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
173
structure length
173
Chain Sequence
HHHSQDPMLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIIFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ferritin
publication title Structural basis for the iron uptake mechanism of Helicobacter pylori ferritin
rcsb
source organism Helicobacter pylori
total genus 77
structure length 173
sequence length 173
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.16.3.2: Bacterial non-heme ferritin.
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3bveA00
2ZA8A 4AM5A 4KVQA 5D8SA 3MPSA 5FFCA 1RCDA 1NF4A 5GU2X 4KVSA 2GS4A 4IXKA 1LKPA 2Y3QA 4ZL5A 4DASA 2C6RA 1LKOA 3F32A 4TOGA 3E1PA 4Z5SA 3PW8C 1VEQA 1S2ZA 3GHQA 3IQ1A 2FFXJ 1JI4A 3UNOA 1SQ3A 3PWQA 4PG1A 1BFRA 2ZG8X 5GN8B 2VXIA 3WVVA 5IX6A 5JKLA 1JREA 2CN7A 5E1UA 3NOZX 3AJPA 1TKOA 3E1OA 1DVBA 2Z5QA 2ZURX 4LPJA 3ISFA 1VLGA 3PVTA 2FHAA 4LQHA 3F33A 5JACA 4RC5B 3F39A 2WTLA 3E1QA 1YV1A 3AJOA 1RYTA 4TOCA 2Z5PA 4ETRA 3BVEA 4LQJA 3E6SA 4EVBA 2F7NA 1TKPA 3AF8X 3AF7X 1SOFA 5CMQA 3IS7A 2ZA7A 3F36A 1F30A 3F34A 4EVDA 5GU1X 2FL0A 4IWKA 3GVYA 2BJYA 3BVFA 5FFDA 4DE6A 1Z6OA 3ERZA 1JI5A 1Z4AA 3AK9A 2FG4A 5J9VA 3EGMA 3R2KA 3O7SA 2XGWA 3BT5A 1H96A 1BG7A 4DYZA 2QQYA 3QZ3A 1RCGA 1ZUJA 2FJCA 3PVTB 2Z6MA 2ZG9X 4MUDA 3R2OA 3FVBA 1B71A 4CVPA 2V2NA 1YUXA 4MY7A 4ZKHA 4ERUA 4LYUA 2X170 3RAVA 4MJYA 2V2JA 2CLUA 2Z90A 1XZ1A 5D8PA 2WLAA 3RBCA 3KX9A 3HL1A 1HRSA 3RD0A 1NF6A 3KA9A 3E6RA 2CHIA 5ERJA 4Y08A 5D8YA 4TOAA 3QD8A 2GYQA 2CF7A 4CY9A 4CYBA 5JKMA 4ISPA 1AEWA 2V2LA 3T9JA 4CYAA 1MOJA 4TW3A 2ZA6A 3UOIA 1JGCA 3KA3A 4M33A 4CVSA 3R2LA 2JD70 3E1NA 5LS9A 3QHCA 2IB0A 2QF9A 1OTKA 1DPSA 4ZL6A 1RCEA 4CVTA 3PVRB 1MFRA 1RCCA 2FZFA 2FKZA 3HIUA 4TO9A 4XKSA 1L8IA 2PYBA 1IESA 5GOUA 3E2CA 1KRQA 2VXXA 3KXUA 5J93A 3EZUA 3FSEA 1XZ3A 4M35A 3R2SA 1JKVA 1VJXA 5JKMG 3Q4QA 5C6FA 5CZUA 3PWQC 3NP2X 3E1LA 5D8XA 5GU0X 1BCFA 3AJQA 3VNXA 4ITWA 1FHAA 3F38A 2Z5RA 5D8OA 3PVYA 1JTSA 4ZKXA 3ISEA 1JYBA 1NNQA 4ISMA 5FFEA 1EUMA 2YW7A 4LYXA 3R2RA 2OC5A 3RGDA 2C2JA 4CVRA 3Q4NA 3BVLA 1IERA 3U90A 2V2PA 3FI6A 3O7RA 1YUZA 3QHBA 2ITBA 3PVRA 3BVKA 2FG8A 2XJOA 4U3GA 4II4B 4PG0A 1O9RA 3UOFA 2V15A 3Q4RA 5FEJA 4XKTA 1TK6A 3H7GA 3OGHA 4RC6A 5GU3X 4M32A 1QYBA 1TJOA 1LB3A 2CEIA 1UMNA 4ZTTA 3PWFA 2W0OA 4DYUA 3PW8A 4RC7A 1ZS3A 2C41A 4LPNA 4CMYV 3EZ0A 3R2HA 2V2RA 4EVEA 3AF9X 4DZ0A 2XJNA 3Q4OA 4TOBA 1Z6OM 3OJ5A 1JIGA 3PVYB 4ITTA 1J30A 1R03A 5K52A 5J8SA 4REUA 1S30A 3BVIA 4TOEA 3QVDA 3KWOA 2CIHA 3GE4A 5LG8A 3PZAA 5HJHA 5AXSA 4ZKWA 3F35A 2V2OA 3A68A 3PW1B 4OYNA 5D8RA 3WVUA 3BKNA 5K53A 2CHPA 2YJKA 2IY4A 2C2FA 4MN9A 4ZMCA 4TOHA 1LKMA 2HTNA 1JKUA 3SH6A 2V2MA 4ZLWA 4TOFA 2HR5A 3SHXA 3TA8A 3IS8A 4II4A 1L8HA 3KA6A 4RC6B 5LG2A 3NP0X 4IWJA 4Z3BA 3E1JA 4DYXA 3RE7A 2YW6A 4RC7B 2UX1A 3KA4A 5CMRA 1UVHA 2CN6A 5HJFA 1O9IA 4AM2A 4LPMA 1F33A 3SIDA 5HQOA 3WVWA 2GYDA 4LQVA 2C2UA 2BW1A 4ZJKA 2ZG7X 1S3QA 2RBDA 1GWGA 5FFAA 4A25A 4RC8A 2WLUA 2YJJA 1QGHA 1DATA 4DYYA 3R2MA 2BK6A 4E6KA 2BKCA 1RCIA 3KA8A 3PW1A 1VEIA 5FFBA 5J8WA 5JKLG 3A9QA 4M34A 4YKHA 4CMYA 2OH3A 4DI0A 3WNWA 2XJMA 2JD60 4TODA 5LBHA 2IU2A 1VELA 4AM4A 4XKUA 2VZBA 3E1MA 5GN8A 3SE1A 5D8QA 4EVCA 4PGIA 3QB9A 4ML5A 2CLBA 2V2SA 4XGSA 5E2DA 5I4JA 5ERKA 2XKQA 4KVRA 4P18A 2G4HA 2JD80 1NFVA 4LQNA 3AK8A 2D5KA 4RC5A 1N1QA 3F37A 4QUWA 4R42A 4MKUA 2V2IA 4PGKA 3ES3A
chains in the Genus database with same CATH superfamily
2ZA8A 4AM5A 4KVQA 5D8SA 3MPSA 5FFCA 1RCDA 1NF4A 5GU2X 4KVSA 2GS4A 4IXKA 1LKPA 2Y3QA 4ZL5A 3FRRA 4DASA 2C6RA 1LKOA 3F32A 4TOGA 3E1PA 4Z5SA 3PW8C 1VEQA 1S2ZA 3GHQA 3KHKA 3IQ1A 2FFXJ 1JI4A 3UNOA 1SQ3A 2Y44A 3PWQA 4PG1A 1BFRA 2ZG8X 5GN8B 2VXIA 3WVVA 5IX6A 4YVZA 5JKLA 1JREA 2CWLA 2CN7A 5E1UA 3NOZX 3AJPA 1TKOA 3E1OA 1DVBA 2Z5QA 2ZURX 4LPJA 3ISFA 1VLGA 3PVTA 2FHAA 4LQHA 3F33A 5JACA 4RC5B 3F39A 2WTLA 3E1QA 1YV1A 3AJOA 1RYTA 4TOCA 2Z5PA 4ETRA 3BVEA 4LQJA 2WWXB 3E6SA 4EVBA 2F7NA 1TKPA 3AF8X 3AF7X 1SOFA 5CMQA 3IS7A 2ZA7A 3F36A 1F30A 3F34A 4EVDA 5GU1X 2FL0A 4IWKA 2V8TA 3C23A 3GVYA 2BJYA 3BVFA 5FFDA 4DE6A 1Z6OA 3ERZA 1JI5A 1Z4AA 3AK9A 2FG4A 5J9VA 3EGMA 3R2KA 3O7SA 2XGWA 3BT5A 1H96A 1BG7A 4DYZA 2QQYA 3QZ3A 1RCGA 1ZUJA 2FJCA 3PVTB 2Z6MA 2ZG9X 4MUDA 3R2OA 3FVBA 1B71A 4CVPA 2V2NA 1YUXA 4MY7A 4ZKHA 4ERUA 4LYUA 2X170 3RAVA 4MJYA 2AR0A 2V2JA 3M6JA 2CLUA 2Z90A 1XZ1A 3C21A 5D8PA 2WLAA 3RBCA 3KX9A 3HL1A 1HRSA 3RD0A 1NF6A 3KA9A 3E6RA 2CHIA 5ERJA 4Y08A 5D8YA 4W4LB 4TOAA 3QD8A 4WJG4 2GYQA 2CF7A 4CY9A 2OKCA 4CYBA 4KXRB 3W54A 5JKMA 4ISPA 1AEWA 2V2LA 3T9JA 4CYAA 1MOJA 4TW3A 2ZA6A 3UOIA 1JGCA 3KA3A 4M33A 4CVSA 3R2LA 2JD70 3E1NA 5LS9A 3QHCA 3C1ZA 2IB0A 2QF9A 1OTKA 1DPSA 4ZL6A 1RCEA 4CVTA 3PVRB 1MFRA 1RCCA 2FZFA 2FKZA 3HIUA 4TO9A 4XKSA 1L8IA 2PYBA 1IESA 5GOUA 3E2CA 1KRQA 3D19A 2VXXA 3KXUA 5J93A 3EZUA 3FSEA 1XZ3A 4M35A 3R2SA 1JKVA 1VJXA 5JKMG 3N6OA 3Q4QA 5C6FA 5CZUA 3PWQC 3NP2X 3LKDA 3E1LA 3UFBA 5D8XA 5GU0X 1BCFA 3AJQA 3VNXA 4ITWA 1FHAA 3F38A 2Z5RA 5D8OA 3GGYA 3PVYA 1JTSA 3KDQA 4ZKXA 3ISEA 1JYBA 1NNQA 4YXMA 4ISMA 5FFEA 1EUMA 2YW7A 4LYXA 3R2RA 2OC5A 3RGDA 2C2JA 4CVRA 3Q4NA 3BVLA 1IERA 3U90A 2V2PA 3FI6A 4YXJA 3O7RA 1YUZA 3QHBA 2ITBA 3PVRA 3BVKA 2FG8A 2XJOA 4U3GA 4II4B 3VV9A 4PG0A 1O9RA 3UOFA 2V15A 3Q4RA 5FEJA 4XKTA 1TK6A 3H7GA 3OGHA 4RC6A 5GU3X 4M32A 1QYBA 1TJOA 5JDOA 1LB3A 2CEIA 1UMNA 4ZTTA 2V8UA 3PWFA 2W0OA 4DYUA 3PW8A 4W4KB 4RC7A 1ZS3A 2C41A 4LPNA 4CMYV 3EZ0A 3R2HA 2V2RA 4EVEA 3AF9X 4DZ0A 2XJNA 3Q4OA 2G38B 4TOBA 1Z6OM 3OJ5A 1JIGA 3PVYB 4ITTA 1J30A 1R03A 5K52A 5J8SA 4REUA 1S30A 3BVIA 4TOEA 4E40A 3QVDA 3KWOA 2CIHA 3GE4A 5LG8A 3PZAA 5HJHA 5AXSA 4ZKWA 3F35A 2V2OA 3A68A 3PW1B 4OYNA 5D8RA 3WVUA 3BKNA 5K53A 2CHPA 2YJKA 2IY4A 2C2FA 4MN9A 4ZMCA 4TOHA 1LKMA 2HTNA 1JKUA 4MXPA 3SH6A 2V2MA 4ZLWA 4TOFA 2HR5A 3V3KB 3SHXA 3TA8A 3IS8A 4II4A 1L8HA 3KA6A 4RC6B 5JDOB 5LG2A 3NP0X 4IWJA 4Z3BA 3E1JA 4DYXA 3RE7A 2YW6A 4RC7B 2UX1A 3KA4A 5CMRA 2MGYA 1UVHA 2CN6A 5HJFA 1O9IA 4AM2A 4LPMA 1F33A 3SIDA 5HQOA 3WVWA 2GYDA 4X0JA 3JZ9A 4LQVA 3L0MA 2C2UA 2BW1A 4ZJKA 2ZG7X 1S3QA 2RBDA 1GWGA 5FFAA 4A25A 4RC8A 2WLUA 2YJJA 1QGHA 1DATA 3JZAB 4DYYA 3R2MA 3DBYA 2BK6A 4E6KA 2BKCA 1RCIA 3KA8A 3PW1A 1VEIA 5FFBA 5J8WA 5JKLG 3A9QA 2N02A 4M34A 4YKHA 4CMYA 2OH3A 4DI0A 3WNWA 3GGZA 2XJMA 2JD60 4TODA 5LBHA 2IU2A 5HU6D 1VELA 4AM4A 4XKUA 2VZBA 3E1MA 5GN8A 3C1YA 3SE1A 5D8QA 4EVCA 4PGIA 3QB9A 4ML5A 2CLBA 2V2SA 4XGSA 5E2DA 5I4JA 5ERKA 2XKQA 3FRSA 4KVRA 4P18A 2G4HA 2JD80 1NFVA 3VVAA 4LQNA 3AK8A 2D5KA 4RC5A 1N1QA 3F37A 4QUWA 4R42A 4MKUA 2V2IA 4PGKA 3ES3A
chains in the Genus database with same CATH topology
2ZA8A 4AM5A 4KVQA 5D8SA 3MPSA 5FFCA 1RCDA 1NF4A 5GU2X 4KVSA 2GS4A 4IXKA 1LKPA 2Y3QA 4ZL5A 3FRRA 4DASA 2C6RA 1LKOA 3F32A 4TOGA 3E1PA 4Z5SA 3PW8C 1VEQA 1S2ZA 3GHQA 3KHKA 3IQ1A 2FFXJ 1JI4A 3UNOA 1SQ3A 2Y44A 3PWQA 4PG1A 1BFRA 2ZG8X 5GN8B 2VXIA 3WVVA 5IX6A 4YVZA 5JKLA 1JREA 2CWLA 2CN7A 5E1UA 3NOZX 3AJPA 1TKOA 3E1OA 1DVBA 2Z5QA 2ZURX 4LPJA 3ISFA 1VLGA 3PVTA 2FHAA 4LQHA 3F33A 5JACA 4RC5B 3F39A 2WTLA 3E1QA 1YV1A 3AJOA 1RYTA 4TOCA 2Z5PA 4ETRA 3BVEA 4LQJA 2WWXB 3E6SA 4EVBA 2F7NA 1TKPA 3AF8X 3AF7X 1SOFA 5CMQA 3IS7A 2ZA7A 3F36A 1F30A 3F34A 4EVDA 5GU1X 2FL0A 4IWKA 2V8TA 3C23A 3GVYA 2BJYA 3BVFA 5FFDA 4DE6A 1Z6OA 3ERZA 1JI5A 1Z4AA 3AK9A 2FG4A 5J9VA 3EGMA 3R2KA 3O7SA 2XGWA 3BT5A 1H96A 1BG7A 4DYZA 2QQYA 3QZ3A 1RCGA 1ZUJA 2FJCA 3PVTB 2Z6MA 2ZG9X 4MUDA 3R2OA 3FVBA 1B71A 4CVPA 2V2NA 1YUXA 4MY7A 4ZKHA 4ERUA 4LYUA 2X170 3RAVA 4MJYA 2AR0A 2V2JA 3M6JA 2CLUA 2Z90A 1XZ1A 3C21A 5D8PA 2WLAA 3RBCA 3KX9A 3HL1A 1HRSA 3RD0A 1NF6A 3KA9A 3E6RA 2CHIA 5ERJA 4Y08A 5D8YA 4W4LB 4TOAA 3QD8A 4WJG4 2GYQA 2CF7A 4CY9A 2OKCA 4CYBA 4KXRB 3W54A 5JKMA 4ISPA 1AEWA 2V2LA 3T9JA 4CYAA 1MOJA 4TW3A 2ZA6A 3UOIA 1JGCA 3KA3A 4M33A 4CVSA 3R2LA 2JD70 3E1NA 5LS9A 3QHCA 3C1ZA 2IB0A 2QF9A 1OTKA 1DPSA 4ZL6A 1RCEA 4CVTA 3PVRB 1MFRA 1RCCA 2FZFA 2FKZA 3HIUA 4TO9A 4XKSA 1L8IA 2PYBA 1IESA 5GOUA 3E2CA 1KRQA 3D19A 2VXXA 3KXUA 5J93A 3EZUA 3FSEA 1XZ3A 4M35A 3R2SA 1JKVA 1VJXA 5JKMG 3N6OA 3Q4QA 5C6FA 5CZUA 3PWQC 3NP2X 3LKDA 3E1LA 3UFBA 5D8XA 5GU0X 1BCFA 3AJQA 3VNXA 4ITWA 1FHAA 3F38A 2Z5RA 5D8OA 3GGYA 3PVYA 1JTSA 3KDQA 4ZKXA 3ISEA 1JYBA 1NNQA 4YXMA 4ISMA 5FFEA 1EUMA 2YW7A 4LYXA 3R2RA 2OC5A 3RGDA 2C2JA 4CVRA 3Q4NA 3BVLA 1IERA 3U90A 2V2PA 3FI6A 4YXJA 3O7RA 1YUZA 3QHBA 2ITBA 3PVRA 3BVKA 2FG8A 2XJOA 4U3GA 4II4B 3VV9A 4PG0A 1O9RA 3UOFA 2V15A 3Q4RA 5FEJA 4XKTA 1TK6A 3H7GA 3OGHA 4RC6A 5GU3X 4M32A 1QYBA 1TJOA 5JDOA 1LB3A 2CEIA 1UMNA 4ZTTA 2V8UA 3PWFA 2W0OA 4DYUA 3PW8A 4W4KB 4RC7A 1ZS3A 2C41A 4LPNA 4CMYV 3EZ0A 3R2HA 2V2RA 4EVEA 3AF9X 4DZ0A 2XJNA 3Q4OA 2G38B 4TOBA 1Z6OM 3OJ5A 1JIGA 3PVYB 4ITTA 1J30A 1R03A 5K52A 5J8SA 4REUA 1S30A 3BVIA 4TOEA 4E40A 3QVDA 3KWOA 2CIHA 3GE4A 5LG8A 3PZAA 5HJHA 5AXSA 4ZKWA 3F35A 2V2OA 3A68A 3PW1B 4OYNA 5D8RA 3WVUA 3BKNA 5K53A 2CHPA 2YJKA 2IY4A 2C2FA 4MN9A 4ZMCA 4TOHA 1LKMA 2HTNA 1JKUA 4MXPA 3SH6A 2V2MA 4ZLWA 4TOFA 2HR5A 3V3KB 3SHXA 3TA8A 3IS8A 4II4A 1L8HA 3KA6A 4RC6B 5JDOB 5LG2A 3NP0X 4IWJA 4Z3BA 3E1JA 4DYXA 3RE7A 2YW6A 4RC7B 2UX1A 3KA4A 5CMRA 2MGYA 1UVHA 2CN6A 5HJFA 1O9IA 4AM2A 4LPMA 1F33A 3SIDA 5HQOA 3WVWA 2GYDA 4X0JA 3JZ9A 4LQVA 3L0MA 2C2UA 2BW1A 4ZJKA 2ZG7X 1S3QA 2RBDA 1GWGA 5FFAA 4A25A 4RC8A 2WLUA 2YJJA 1QGHA 1DATA 3JZAB 4DYYA 3R2MA 3DBYA 2BK6A 4E6KA 2BKCA 1RCIA 3KA8A 3PW1A 1VEIA 5FFBA 5J8WA 5JKLG 3A9QA 2N02A 4M34A 4YKHA 4CMYA 2OH3A 4DI0A 3WNWA 3GGZA 2XJMA 2JD60 4TODA 5LBHA 2IU2A 5HU6D 1VELA 4AM4A 4XKUA 2VZBA 3E1MA 5GN8A 3C1YA 3SE1A 5D8QA 4EVCA 4PGIA 3QB9A 4ML5A 2CLBA 2V2SA 4XGSA 5E2DA 5I4JA 5ERKA 2XKQA 3FRSA 4KVRA 4P18A 2G4HA 2JD80 1NFVA 3VVAA 4LQNA 3AK8A 2D5KA 4RC5A 1N1QA 3F37A 4QUWA 4R42A 4MKUA 2V2IA 4PGKA 3ES3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZA8 A;  4AM5 A;  4KVQ A;  5D8S A;  3MPS A;  5FFC A;  1RCD A;  1NF4 A;  5GU2 X;  4KVS A;  2GS4 A;  4IXK A;  1LKP A;  2Y3Q A;  4ZL5 A;  4DAS A;  2C6R A;  1LKO A;  3F32 A;  4TOG A;  3E1P A;  4Z5S A;  3PW8 C;  1VEQ A;  1S2Z A;  3GHQ A;  3IQ1 A;  2FFX J;  1JI4 A;  3UNO A;  1SQ3 A;  3PWQ A;  4PG1 A;  1BFR A;  2ZG8 X;  5GN8 B;  2VXI A;  3WVV A;  5IX6 A;  5JKL A;  1JRE A;  2CN7 A;  5E1U A;  3NOZ X;  3AJP A;  1TKO A;  3E1O A;  1DVB A;  2Z5Q A;  2ZUR X;  4LPJ A;  3ISF A;  1VLG A;  3PVT A;  2FHA A;  4LQH A;  3F33 A;  5JAC A;  4RC5 B;  3F39 A;  2WTL A;  3E1Q A;  1YV1 A;  3AJO A;  1RYT A;  4TOC A;  2Z5P A;  4ETR A;  3BVE A;  4LQJ A;  3E6S A;  4EVB A;  2F7N A;  1TKP A;  3AF8 X;  3AF7 X;  1SOF A;  5CMQ A;  3IS7 A;  2ZA7 A;  3F36 A;  1F30 A;  3F34 A;  4EVD A;  5GU1 X;  2FL0 A;  4IWK A;  3GVY A;  2BJY A;  3BVF A;  5FFD A;  4DE6 A;  1Z6O A;  3ERZ A;  1JI5 A;  1Z4A A;  3AK9 A;  2FG4 A;  5J9V A;  3EGM A;  3R2K A;  3O7S A;  2XGW A;  3BT5 A;  1H96 A;  1BG7 A;  4DYZ A;  2QQY A;  3QZ3 A;  1RCG A;  1ZUJ A;  2FJC A;  3PVT B;  2Z6M A;  2ZG9 X;  4MUD A;  3R2O A;  3FVB A;  1B71 A;  4CVP A;  2V2N A;  1YUX A;  4MY7 A;  4ZKH A;  4ERU A;  4LYU A;  2X17 0;  3RAV A;  4MJY A;  2V2J A;  2CLU A;  2Z90 A;  1XZ1 A;  5D8P A;  2WLA A;  3RBC A;  3KX9 A;  3HL1 A;  1HRS A;  3RD0 A;  1NF6 A;  3KA9 A;  3E6R A;  2CHI A;  5ERJ A;  4Y08 A;  5D8Y A;  4TOA A;  3QD8 A;  2GYQ A;  2CF7 A;  4CY9 A;  4CYB A;  5JKM A;  4ISP A;  1AEW A;  2V2L A;  3T9J A;  4CYA A;  1MOJ A;  4TW3 A;  2ZA6 A;  3UOI A;  1JGC A;  3KA3 A;  4M33 A;  4CVS A;  3R2L A;  2JD7 0;  3E1N A;  5LS9 A;  3QHC A;  2IB0 A;  2QF9 A;  1OTK A;  1DPS A;  4ZL6 A;  1RCE A;  4CVT A;  3PVR B;  1MFR A;  1RCC A;  2FZF A;  2FKZ A;  3HIU A;  4TO9 A;  4XKS A;  1L8I A;  2PYB A;  1IES A;  5GOU A;  3E2C A;  1KRQ A;  2VXX A;  3KXU A;  5J93 A;  3EZU A;  3FSE A;  1XZ3 A;  4M35 A;  3R2S A;  1JKV A;  1VJX A;  5JKM G;  3Q4Q A;  5C6F A;  5CZU A;  3PWQ C;  3NP2 X;  3E1L A;  5D8X A;  5GU0 X;  1BCF A;  3AJQ A;  3VNX A;  4ITW A;  1FHA A;  3F38 A;  2Z5R A;  5D8O A;  3PVY A;  1JTS A;  4ZKX A;  3ISE A;  1JYB A;  1NNQ A;  4ISM A;  5FFE A;  1EUM A;  2YW7 A;  4LYX A;  3R2R A;  2OC5 A;  3RGD A;  2C2J A;  4CVR A;  3Q4N A;  3BVL A;  1IER A;  3U90 A;  2V2P A;  3FI6 A;  3O7R A;  1YUZ A;  3QHB A;  2ITB A;  3PVR A;  3BVK A;  2FG8 A;  2XJO A;  4U3G A;  4II4 B;  4PG0 A;  1O9R A;  3UOF A;  2V15 A;  3Q4R A;  5FEJ A;  4XKT A;  1TK6 A;  3H7G A;  3OGH A;  4RC6 A;  5GU3 X;  4M32 A;  1QYB A;  1TJO A;  1LB3 A;  2CEI A;  1UMN A;  4ZTT A;  3PWF A;  2W0O A;  4DYU A;  3PW8 A;  4RC7 A;  1ZS3 A;  2C41 A;  4LPN A;  4CMY V;  3EZ0 A;  3R2H A;  2V2R A;  4EVE A;  3AF9 X;  4DZ0 A;  2XJN A;  3Q4O A;  4TOB A;  1Z6O M;  3OJ5 A;  1JIG A;  3PVY B;  4ITT A;  1J30 A;  1R03 A;  5K52 A;  5J8S A;  4REU A;  1S30 A;  3BVI A;  4TOE A;  3QVD A;  3KWO A;  2CIH A;  3GE4 A;  5LG8 A;  3PZA A;  5HJH A;  5AXS A;  4ZKW A;  3F35 A;  2V2O A;  3A68 A;  3PW1 B;  4OYN A;  5D8R A;  3WVU A;  3BKN A;  5K53 A;  2CHP A;  2YJK A;  2IY4 A;  2C2F A;  4MN9 A;  4ZMC A;  4TOH A;  1LKM A;  2HTN A;  1JKU A;  3SH6 A;  2V2M A;  4ZLW A;  4TOF A;  2HR5 A;  3SHX A;  3TA8 A;  3IS8 A;  4II4 A;  1L8H A;  3KA6 A;  4RC6 B;  5LG2 A;  3NP0 X;  4IWJ A;  4Z3B A;  3E1J A;  4DYX A;  3RE7 A;  2YW6 A;  4RC7 B;  2UX1 A;  3KA4 A;  5CMR A;  1UVH A;  2CN6 A;  5HJF A;  1O9I A;  4AM2 A;  4LPM A;  1F33 A;  3SID A;  5HQO A;  3WVW A;  2GYD A;  4LQV A;  2C2U A;  2BW1 A;  4ZJK A;  2ZG7 X;  1S3Q A;  2RBD A;  1GWG A;  5FFA A;  4A25 A;  4RC8 A;  2WLU A;  2YJJ A;  1QGH A;  1DAT A;  4DYY A;  3R2M A;  2BK6 A;  4E6K A;  2BKC A;  1RCI A;  3KA8 A;  3PW1 A;  1VEI A;  5FFB A;  5J8W A;  5JKL G;  3A9Q A;  4M34 A;  4YKH A;  4CMY A;  2OH3 A;  4DI0 A;  3WNW A;  2XJM A;  2JD6 0;  4TOD A;  5LBH A;  2IU2 A;  1VEL A;  4AM4 A;  4XKU A;  2VZB A;  3E1M A;  5GN8 A;  3SE1 A;  5D8Q A;  4EVC A;  4PGI A;  3QB9 A;  4ML5 A;  2CLB A;  2V2S A;  4XGS A;  5E2D A;  5I4J A;  5ERK A;  2XKQ A;  4KVR A;  4P18 A;  2G4H A;  2JD8 0;  1NFV A;  4LQN A;  3AK8 A;  2D5K A;  4RC5 A;  1N1Q A;  3F37 A;  4QUW A;  4R42 A;  4MKU A;  2V2I A;  4PGK A;  3ES3 A; 
#chains in the Genus database with same CATH topology
 2ZA8 A;  4AM5 A;  4KVQ A;  5D8S A;  3MPS A;  5FFC A;  1RCD A;  1NF4 A;  5GU2 X;  4KVS A;  2GS4 A;  4IXK A;  1LKP A;  2Y3Q A;  4ZL5 A;  3FRR A;  4DAS A;  2C6R A;  1LKO A;  3F32 A;  4TOG A;  3E1P A;  4Z5S A;  3PW8 C;  1VEQ A;  1S2Z A;  3GHQ A;  3KHK A;  3IQ1 A;  2FFX J;  1JI4 A;  3UNO A;  1SQ3 A;  2Y44 A;  3PWQ A;  4PG1 A;  1BFR A;  2ZG8 X;  5GN8 B;  2VXI A;  3WVV A;  5IX6 A;  4YVZ A;  5JKL A;  1JRE A;  2CWL A;  2CN7 A;  5E1U A;  3NOZ X;  3AJP A;  1TKO A;  3E1O A;  1DVB A;  2Z5Q A;  2ZUR X;  4LPJ A;  3ISF A;  1VLG A;  3PVT A;  2FHA A;  4LQH A;  3F33 A;  5JAC A;  4RC5 B;  3F39 A;  2WTL A;  3E1Q A;  1YV1 A;  3AJO A;  1RYT A;  4TOC A;  2Z5P A;  4ETR A;  3BVE A;  4LQJ A;  2WWX B;  3E6S A;  4EVB A;  2F7N A;  1TKP A;  3AF8 X;  3AF7 X;  1SOF A;  5CMQ A;  3IS7 A;  2ZA7 A;  3F36 A;  1F30 A;  3F34 A;  4EVD A;  5GU1 X;  2FL0 A;  4IWK A;  2V8T A;  3C23 A;  3GVY A;  2BJY A;  3BVF A;  5FFD A;  4DE6 A;  1Z6O A;  3ERZ A;  1JI5 A;  1Z4A A;  3AK9 A;  2FG4 A;  5J9V A;  3EGM A;  3R2K A;  3O7S A;  2XGW A;  3BT5 A;  1H96 A;  1BG7 A;  4DYZ A;  2QQY A;  3QZ3 A;  1RCG A;  1ZUJ A;  2FJC A;  3PVT B;  2Z6M A;  2ZG9 X;  4MUD A;  3R2O A;  3FVB A;  1B71 A;  4CVP A;  2V2N A;  1YUX A;  4MY7 A;  4ZKH A;  4ERU A;  4LYU A;  2X17 0;  3RAV A;  4MJY A;  2AR0 A;  2V2J A;  3M6J A;  2CLU A;  2Z90 A;  1XZ1 A;  3C21 A;  5D8P A;  2WLA A;  3RBC A;  3KX9 A;  3HL1 A;  1HRS A;  3RD0 A;  1NF6 A;  3KA9 A;  3E6R A;  2CHI A;  5ERJ A;  4Y08 A;  5D8Y A;  4W4L B;  4TOA A;  3QD8 A;  4WJG 4;  2GYQ A;  2CF7 A;  4CY9 A;  2OKC A;  4CYB A;  4KXR B;  3W54 A;  5JKM A;  4ISP A;  1AEW A;  2V2L A;  3T9J A;  4CYA A;  1MOJ A;  4TW3 A;  2ZA6 A;  3UOI A;  1JGC A;  3KA3 A;  4M33 A;  4CVS A;  3R2L A;  2JD7 0;  3E1N A;  5LS9 A;  3QHC A;  3C1Z A;  2IB0 A;  2QF9 A;  1OTK A;  1DPS A;  4ZL6 A;  1RCE A;  4CVT A;  3PVR B;  1MFR A;  1RCC A;  2FZF A;  2FKZ A;  3HIU A;  4TO9 A;  4XKS A;  1L8I A;  2PYB A;  1IES A;  5GOU A;  3E2C A;  1KRQ A;  3D19 A;  2VXX A;  3KXU A;  5J93 A;  3EZU A;  3FSE A;  1XZ3 A;  4M35 A;  3R2S A;  1JKV A;  1VJX A;  5JKM G;  3N6O A;  3Q4Q A;  5C6F A;  5CZU A;  3PWQ C;  3NP2 X;  3LKD A;  3E1L A;  3UFB A;  5D8X A;  5GU0 X;  1BCF A;  3AJQ A;  3VNX A;  4ITW A;  1FHA A;  3F38 A;  2Z5R A;  5D8O A;  3GGY A;  3PVY A;  1JTS A;  3KDQ A;  4ZKX A;  3ISE A;  1JYB A;  1NNQ A;  4YXM A;  4ISM A;  5FFE A;  1EUM A;  2YW7 A;  4LYX A;  3R2R A;  2OC5 A;  3RGD A;  2C2J A;  4CVR A;  3Q4N A;  3BVL A;  1IER A;  3U90 A;  2V2P A;  3FI6 A;  4YXJ A;  3O7R A;  1YUZ A;  3QHB A;  2ITB A;  3PVR A;  3BVK A;  2FG8 A;  2XJO A;  4U3G A;  4II4 B;  3VV9 A;  4PG0 A;  1O9R A;  3UOF A;  2V15 A;  3Q4R A;  5FEJ A;  4XKT A;  1TK6 A;  3H7G A;  3OGH A;  4RC6 A;  5GU3 X;  4M32 A;  1QYB A;  1TJO A;  5JDO A;  1LB3 A;  2CEI A;  1UMN A;  4ZTT A;  2V8U A;  3PWF A;  2W0O A;  4DYU A;  3PW8 A;  4W4K B;  4RC7 A;  1ZS3 A;  2C41 A;  4LPN A;  4CMY V;  3EZ0 A;  3R2H A;  2V2R A;  4EVE A;  3AF9 X;  4DZ0 A;  2XJN A;  3Q4O A;  2G38 B;  4TOB A;  1Z6O M;  3OJ5 A;  1JIG A;  3PVY B;  4ITT A;  1J30 A;  1R03 A;  5K52 A;  5J8S A;  4REU A;  1S30 A;  3BVI A;  4TOE A;  4E40 A;  3QVD A;  3KWO A;  2CIH A;  3GE4 A;  5LG8 A;  3PZA A;  5HJH A;  5AXS A;  4ZKW A;  3F35 A;  2V2O A;  3A68 A;  3PW1 B;  4OYN A;  5D8R A;  3WVU A;  3BKN A;  5K53 A;  2CHP A;  2YJK A;  2IY4 A;  2C2F A;  4MN9 A;  4ZMC A;  4TOH A;  1LKM A;  2HTN A;  1JKU A;  4MXP A;  3SH6 A;  2V2M A;  4ZLW A;  4TOF A;  2HR5 A;  3V3K B;  3SHX A;  3TA8 A;  3IS8 A;  4II4 A;  1L8H A;  3KA6 A;  4RC6 B;  5JDO B;  5LG2 A;  3NP0 X;  4IWJ A;  4Z3B A;  3E1J A;  4DYX A;  3RE7 A;  2YW6 A;  4RC7 B;  2UX1 A;  3KA4 A;  5CMR A;  2MGY A;  1UVH A;  2CN6 A;  5HJF A;  1O9I A;  4AM2 A;  4LPM A;  1F33 A;  3SID A;  5HQO A;  3WVW A;  2GYD A;  4X0J A;  3JZ9 A;  4LQV A;  3L0M A;  2C2U A;  2BW1 A;  4ZJK A;  2ZG7 X;  1S3Q A;  2RBD A;  1GWG A;  5FFA A;  4A25 A;  4RC8 A;  2WLU A;  2YJJ A;  1QGH A;  1DAT A;  3JZA B;  4DYY A;  3R2M A;  3DBY A;  2BK6 A;  4E6K A;  2BKC A;  1RCI A;  3KA8 A;  3PW1 A;  1VEI A;  5FFB A;  5J8W A;  5JKL G;  3A9Q A;  2N02 A;  4M34 A;  4YKH A;  4CMY A;  2OH3 A;  4DI0 A;  3WNW A;  3GGZ A;  2XJM A;  2JD6 0;  4TOD A;  5LBH A;  2IU2 A;  5HU6 D;  1VEL A;  4AM4 A;  4XKU A;  2VZB A;  3E1M A;  5GN8 A;  3C1Y A;  3SE1 A;  5D8Q A;  4EVC A;  4PGI A;  3QB9 A;  4ML5 A;  2CLB A;  2V2S A;  4XGS A;  5E2D A;  5I4J A;  5ERK A;  2XKQ A;  3FRS A;  4KVR A;  4P18 A;  2G4H A;  2JD8 0;  1NFV A;  3VVA A;  4LQN A;  3AK8 A;  2D5K A;  4RC5 A;  1N1Q A;  3F37 A;  4QUW A;  4R42 A;  4MKU A;  2V2I A;  4PGK A;  3ES3 A; 
#chains in the Genus database with same CATH homology
 2ZA8 A;  4AM5 A;  4KVQ A;  5D8S A;  3MPS A;  5FFC A;  1RCD A;  1NF4 A;  5GU2 X;  4KVS A;  2GS4 A;  4IXK A;  1LKP A;  2Y3Q A;  4ZL5 A;  3FRR A;  4DAS A;  2C6R A;  1LKO A;  3F32 A;  4TOG A;  3E1P A;  4Z5S A;  3PW8 C;  1VEQ A;  1S2Z A;  3GHQ A;  3KHK A;  3IQ1 A;  2FFX J;  1JI4 A;  3UNO A;  1SQ3 A;  2Y44 A;  3PWQ A;  4PG1 A;  1BFR A;  2ZG8 X;  5GN8 B;  2VXI A;  3WVV A;  5IX6 A;  4YVZ A;  5JKL A;  1JRE A;  2CWL A;  2CN7 A;  5E1U A;  3NOZ X;  3AJP A;  1TKO A;  3E1O A;  1DVB A;  2Z5Q A;  2ZUR X;  4LPJ A;  3ISF A;  1VLG A;  3PVT A;  2FHA A;  4LQH A;  3F33 A;  5JAC A;  4RC5 B;  3F39 A;  2WTL A;  3E1Q A;  1YV1 A;  3AJO A;  1RYT A;  4TOC A;  2Z5P A;  4ETR A;  3BVE A;  4LQJ A;  2WWX B;  3E6S A;  4EVB A;  2F7N A;  1TKP A;  3AF8 X;  3AF7 X;  1SOF A;  5CMQ A;  3IS7 A;  2ZA7 A;  3F36 A;  1F30 A;  3F34 A;  4EVD A;  5GU1 X;  2FL0 A;  4IWK A;  2V8T A;  3C23 A;  3GVY A;  2BJY A;  3BVF A;  5FFD A;  4DE6 A;  1Z6O A;  3ERZ A;  1JI5 A;  1Z4A A;  3AK9 A;  2FG4 A;  5J9V A;  3EGM A;  3R2K A;  3O7S A;  2XGW A;  3BT5 A;  1H96 A;  1BG7 A;  4DYZ A;  2QQY A;  3QZ3 A;  1RCG A;  1ZUJ A;  2FJC A;  3PVT B;  2Z6M A;  2ZG9 X;  4MUD A;  3R2O A;  3FVB A;  1B71 A;  4CVP A;  2V2N A;  1YUX A;  4MY7 A;  4ZKH A;  4ERU A;  4LYU A;  2X17 0;  3RAV A;  4MJY A;  2AR0 A;  2V2J A;  3M6J A;  2CLU A;  2Z90 A;  1XZ1 A;  3C21 A;  5D8P A;  2WLA A;  3RBC A;  3KX9 A;  3HL1 A;  1HRS A;  3RD0 A;  1NF6 A;  3KA9 A;  3E6R A;  2CHI A;  5ERJ A;  4Y08 A;  5D8Y A;  4W4L B;  4TOA A;  3QD8 A;  4WJG 4;  2GYQ A;  2CF7 A;  4CY9 A;  2OKC A;  4CYB A;  4KXR B;  3W54 A;  5JKM A;  4ISP A;  1AEW A;  2V2L A;  3T9J A;  4CYA A;  1MOJ A;  4TW3 A;  2ZA6 A;  3UOI A;  1JGC A;  3KA3 A;  4M33 A;  4CVS A;  3R2L A;  2JD7 0;  3E1N A;  5LS9 A;  3QHC A;  3C1Z A;  2IB0 A;  2QF9 A;  1OTK A;  1DPS A;  4ZL6 A;  1RCE A;  4CVT A;  3PVR B;  1MFR A;  1RCC A;  2FZF A;  2FKZ A;  3HIU A;  4TO9 A;  4XKS A;  1L8I A;  2PYB A;  1IES A;  5GOU A;  3E2C A;  1KRQ A;  3D19 A;  2VXX A;  3KXU A;  5J93 A;  3EZU A;  3FSE A;  1XZ3 A;  4M35 A;  3R2S A;  1JKV A;  1VJX A;  5JKM G;  3N6O A;  3Q4Q A;  5C6F A;  5CZU A;  3PWQ C;  3NP2 X;  3LKD A;  3E1L A;  3UFB A;  5D8X A;  5GU0 X;  1BCF A;  3AJQ A;  3VNX A;  4ITW A;  1FHA A;  3F38 A;  2Z5R A;  5D8O A;  3GGY A;  3PVY A;  1JTS A;  3KDQ A;  4ZKX A;  3ISE A;  1JYB A;  1NNQ A;  4YXM A;  4ISM A;  5FFE A;  1EUM A;  2YW7 A;  4LYX A;  3R2R A;  2OC5 A;  3RGD A;  2C2J A;  4CVR A;  3Q4N A;  3BVL A;  1IER A;  3U90 A;  2V2P A;  3FI6 A;  4YXJ A;  3O7R A;  1YUZ A;  3QHB A;  2ITB A;  3PVR A;  3BVK A;  2FG8 A;  2XJO A;  4U3G A;  4II4 B;  3VV9 A;  4PG0 A;  1O9R A;  3UOF A;  2V15 A;  3Q4R A;  5FEJ A;  4XKT A;  1TK6 A;  3H7G A;  3OGH A;  4RC6 A;  5GU3 X;  4M32 A;  1QYB A;  1TJO A;  5JDO A;  1LB3 A;  2CEI A;  1UMN A;  4ZTT A;  2V8U A;  3PWF A;  2W0O A;  4DYU A;  3PW8 A;  4W4K B;  4RC7 A;  1ZS3 A;  2C41 A;  4LPN A;  4CMY V;  3EZ0 A;  3R2H A;  2V2R A;  4EVE A;  3AF9 X;  4DZ0 A;  2XJN A;  3Q4O A;  2G38 B;  4TOB A;  1Z6O M;  3OJ5 A;  1JIG A;  3PVY B;  4ITT A;  1J30 A;  1R03 A;  5K52 A;  5J8S A;  4REU A;  1S30 A;  3BVI A;  4TOE A;  4E40 A;  3QVD A;  3KWO A;  2CIH A;  3GE4 A;  5LG8 A;  3PZA A;  5HJH A;  5AXS A;  4ZKW A;  3F35 A;  2V2O A;  3A68 A;  3PW1 B;  4OYN A;  5D8R A;  3WVU A;  3BKN A;  5K53 A;  2CHP A;  2YJK A;  2IY4 A;  2C2F A;  4MN9 A;  4ZMC A;  4TOH A;  1LKM A;  2HTN A;  1JKU A;  4MXP A;  3SH6 A;  2V2M A;  4ZLW A;  4TOF A;  2HR5 A;  3V3K B;  3SHX A;  3TA8 A;  3IS8 A;  4II4 A;  1L8H A;  3KA6 A;  4RC6 B;  5JDO B;  5LG2 A;  3NP0 X;  4IWJ A;  4Z3B A;  3E1J A;  4DYX A;  3RE7 A;  2YW6 A;  4RC7 B;  2UX1 A;  3KA4 A;  5CMR A;  2MGY A;  1UVH A;  2CN6 A;  5HJF A;  1O9I A;  4AM2 A;  4LPM A;  1F33 A;  3SID A;  5HQO A;  3WVW A;  2GYD A;  4X0J A;  3JZ9 A;  4LQV A;  3L0M A;  2C2U A;  2BW1 A;  4ZJK A;  2ZG7 X;  1S3Q A;  2RBD A;  1GWG A;  5FFA A;  4A25 A;  4RC8 A;  2WLU A;  2YJJ A;  1QGH A;  1DAT A;  3JZA B;  4DYY A;  3R2M A;  3DBY A;  2BK6 A;  4E6K A;  2BKC A;  1RCI A;  3KA8 A;  3PW1 A;  1VEI A;  5FFB A;  5J8W A;  5JKL G;  3A9Q A;  2N02 A;  4M34 A;  4YKH A;  4CMY A;  2OH3 A;  4DI0 A;  3WNW A;  3GGZ A;  2XJM A;  2JD6 0;  4TOD A;  5LBH A;  2IU2 A;  5HU6 D;  1VEL A;  4AM4 A;  4XKU A;  2VZB A;  3E1M A;  5GN8 A;  3C1Y A;  3SE1 A;  5D8Q A;  4EVC A;  4PGI A;  3QB9 A;  4ML5 A;  2CLB A;  2V2S A;  4XGS A;  5E2D A;  5I4J A;  5ERK A;  2XKQ A;  3FRS A;  4KVR A;  4P18 A;  2G4H A;  2JD8 0;  1NFV A;  3VVA A;  4LQN A;  3AK8 A;  2D5K A;  4RC5 A;  1N1Q A;  3F37 A;  4QUW A;  4R42 A;  4MKU A;  2V2I A;  4PGK A;  3ES3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...