3BVEA

Structural basis for the iron uptake mechanism of helicobacter pylori ferritin
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
173
structure length
173
Chain Sequence
HHHSQDPMLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIIFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferritin
publication title Structural basis for the iron uptake mechanism of Helicobacter pylori ferritin
rcsb
source organism Helicobacter pylori
molecule tags Oxidoreductase
total genus 77
structure length 173
sequence length 173
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.16.3.2: Bacterial non-heme ferritin.
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3bveA00
4DE6A 3E6RA 2G4HA 4AM2A 2CHPA 4TOFA 4TW3A 1BFRA 1IESA 5AXSA 3F35A 4P18A 3ISFA 5CMRA 4CVRA 3PW8C 3FSEA 4TOCA 1YUXA 2Z5QA 4ZLWA 2V15A 4TO9A 2C2UA 4RC5A 4LYUA 5CZUA 1S2ZA 3O7SA 3R2KA 1JKVA 2CIHA 2PYBA 2BK6A 5GU1X 2V2JA 3AK9A 2CN6A 3SE1A 4CVSA 4ZMCA 3A68A 3E1LA 3KX9A 3HL1A 4RC7A 4IWKA 3PZAA 4OYNA 3U90A 2FHAA 1JREA 3PWFA 4RC5B 5IX6A 3AK8A 4LPNA 1TKOA 3KXUA 4E6KA 3MPSA 4II4A 2CLBA 2RBDA 3R2SA 5I4JA 1RCDA 1JYBA 1JIGA 2FZFA 4R42A 4RC7B 3UOFA 1NF4A 5J9VA 2IB0A 2Z5PA 3NP2X 5HJHA 3E1JA 4LQHA 2XGWA 4CYAA 4II4B 4LPJA 4TOGA 3BVIA 4EVBA 5HJFA 3GHQA 3E1OA 1MOJA 2HTNA 3AF9X 1LKPA 1RCIA 4TOBA 4XKTA 2ZA7A 4PG0A 4PGIA 4ERUA 4RC6A 1VJXA 4QUWA 3T9JA 2BJYA 3EZ0A 1VEQA 4ZL5A 1NFVA 3UNOA 1L8HA 3H7GA 2BKCA 1VEIA 4RC6B 5D8RA 3PW1B 2WLUA 3ES3A 3TA8A 2FFXJ 4PGKA 4Y08A 5HQOA 2Z5RA 3NP0X 1ZS3A 1SQ3A 1R03A 2YJKA 5FFCA 2ITBA 3AJQA 3PVTA 3WNWA 5JKLA 4ZKXA 1S3QA 4DYXA 2GYQA 1TKPA 3E1QA 4CVPA 3PWQA 4KVSA 2ZURX 3F38A 2X170 4ITWA 4LQNA 2UX1A 1GWGA 3PVTB 4AM4A 3BKNA 3PWQC 4LQVA 3BT5A 2F7NA 3BVKA 5FEJA 2C41A 1DPSA 2JD60 3QD8A 4EVEA 5GOUA 3ERZA 3FI6A 2BW1A 4ML5A 4DASA 1SOFA 1VELA 5ERKA 5JACA 5GN8A 2YW6A 4EVDA 1DVBA 3F39A 4DYUA 2V2LA 3GE4A 1RCEA 2WLAA 3R2LA 4U3GA 2ZA8A 1UMNA 1ZUJA 3RGDA 3EZUA 3F36A 4MKUA 3F37A 1LKMA 3QHCA 1OTKA 1S30A 3AJOA 5GN8B 2VZBA 3E6SA 5E2DA 4ZKHA 1O9IA 5D8YA 1YV1A 1JI5A 1RCGA 2XJOA 3F33A 2JD80 2C2JA 3OGHA 2XJMA 4ZKWA 3SHXA 4XGSA 2IU2A 2V2RA 3R2MA 2CHIA 4KVQA 2YW7A 1Z6OM 2CEIA 4M32A 2C6RA 2HR5A 3RAVA 5GU3X 3QHBA 5D8SA 5K53A 4DZ0A 3BVFA 4ITTA 1XZ1A 1KRQA 5ERJA 3WVWA 3IS7A 5J8SA 4DYYA 5FFEA 1Z6OA 4MY7A 3FVBA 4KVRA 1H96A 3QZ3A 2V2IA 1XZ3A 2D5KA 3AF7X 4XKUA 5D8OA 5JKLG 4TOAA 3R2RA 2GS4A 3ISEA 1JI4A 3SIDA 4XKSA 2QF9A 2VXXA 5D8QA 5GU2X 3AJPA 1NF6A 2WTLA 3KA6A 4ETRA 2ZG9X 3IQ1A 4TODA 2V2PA 5J93A 3F32A 4M33A 1TK6A 4TOHA 5CMQA 4Z5SA 3RD0A 5GU0X 5JKMG 1RYTA 3QB9A 1AEWA 3AF8X 3PW8A 3Q4RA 5JKMA 4REUA 1DATA 1L8IA 1JTSA 3R2HA 3Q4QA 4M35A 3E1PA 3BVEA 2VXIA 1HRSA 2XJNA 2V2SA 4AM5A 2OH3A 3F34A 3VNXA 4TOEA 3E2CA 3KA9A 5FFBA 1Z4AA 5LS9A 4ISMA 2YJJA 1FHAA 2CF7A 4LPMA 4MUDA 4Z3BA 3R2OA 2V2OA 3WVVA 5J8WA 4CVTA 2V2MA 2V2NA 3EGMA 4PG1A 3OJ5A 3KA8A 5FFDA 1LB3A 3RE7A 3Q4NA 4IXKA 1UVHA 2C2FA 3RBCA 3PVYA 2ZA6A 4CYBA 1TJOA 4EVCA 3KWOA 1MFRA 3HIUA 3NOZX 3E1MA 4A25A 4CMYV 2ZG8X 4IWJA 5FFAA 2FKZA 3GVYA 4LQJA 2CLUA 3PVRA 2FJCA 1NNQA 3PVYB 2CN7A 3SH6A 5E1UA 3O7RA 2Z90A 1QYBA 4MJYA 3E1NA 3IS8A 1O9RA 3Q4OA 1JGCA 4MN9A 1J30A 3PW1A 3PVRB 2FG4A 5LG8A 2ZG7X 4ISPA 4RC8A 4ZJKA 1F30A 1N1QA 5LBHA 2W0OA 2Z6MA 2Y3QA 3WVUA 1QGHA 3A9QA 2QQYA 4ZTTA 1VLGA 2XKQA 3KA4A 4DYZA 1JKUA 2IY4A 3UOIA 1YUZA 4LYXA 3KA3A 2GYDA 4YKHA 3QVDA 5C6FA 5K52A 3BVLA 4M34A 1BCFA 4ZL6A 1BG7A 5D8PA 5LG2A 1IERA 2JD70 5D8XA 1F33A 1RCCA 4DI0A 2FG8A 2FL0A 4CMYA 4CY9A 1LKOA 1B71A 1EUMA 2OC5A
chains in the Genus database with same CATH superfamily
4DE6A 5HU6D 3E6RA 2G4HA 4AM2A 2CHPA 4TOFA 4TW3A 1BFRA 1IESA 3M6JA 2V8TA 3F35A 5AXSA 4P18A 3ISFA 5CMRA 4CVRA 3PW8C 3FSEA 4TOCA 1YUXA 2Z5QA 4ZLWA 2MGYA 2V15A 4TO9A 2C2UA 4RC5A 4LYUA 5CZUA 3C1YA 1S2ZA 3O7SA 3R2KA 1JKVA 2CIHA 2PYBA 2BK6A 3KDQA 5GU1X 2V2JA 3AK9A 2CN6A 3SE1A 4CVSA 3UFBA 3A68A 4ZMCA 3E1LA 3KX9A 3HL1A 4RC7A 4IWKA 3PZAA 3FRRA 4OYNA 3U90A 2FHAA 1JREA 3PWFA 4RC5B 5IX6A 3AK8A 4LPNA 1TKOA 3KXUA 4E6KA 4II4A 3MPSA 2CLBA 3JZAB 2RBDA 4X0JA 3R2SA 5I4JA 1RCDA 1JYBA 1JIGA 2FZFA 4R42A 4RC7B 3UOFA 1NF4A 5J9VA 2IB0A 2Z5PA 3NP2X 4W4LB 4YVZA 5HJHA 3E1JA 4LQHA 2XGWA 4CYAA 4II4B 4LPJA 4TOGA 3BVIA 4EVBA 5HJFA 3GGZA 5JDOA 3GHQA 3E1OA 1MOJA 2HTNA 3AF9X 1LKPA 1RCIA 4TOBA 4XKTA 2ZA7A 4PG0A 4PGIA 4ERUA 4RC6A 1VJXA 4QUWA 3T9JA 2BJYA 3EZ0A 1VEQA 2Y44A 4ZL5A 5JDOB 2WWXB 1NFVA 3UNOA 1L8HA 3H7GA 2BKCA 1VEIA 4RC6B 5D8RA 4WJG4 3PW1B 2WLUA 3ES3A 3TA8A 2FFXJ 4PGKA 4Y08A 5HQOA 2Z5RA 3NP0X 1ZS3A 1SQ3A 1R03A 2YJKA 5FFCA 2ITBA 3AJQA 3PVTA 3WNWA 4YXMA 5JKLA 3GGYA 4ZKXA 1S3QA 4DYXA 2GYQA 1TKPA 3E1QA 4CVPA 3PWQA 3DBYA 4KVSA 2ZURX 3KHKA 3F38A 2X170 4ITWA 4LQNA 2UX1A 1GWGA 3PVTB 4AM4A 3BKNA 3PWQC 4LQVA 3BT5A 2F7NA 3BVKA 5FEJA 2C41A 3C21A 1DPSA 2JD60 3QD8A 4EVEA 5GOUA 3ERZA 3FI6A 3LKDA 2BW1A 4ML5A 4DASA 1SOFA 1VELA 5ERKA 5JACA 5GN8A 2YW6A 4EVDA 2AR0A 1DVBA 2OKCA 3F39A 4DYUA 2V2LA 3GE4A 1RCEA 2WLAA 3R2LA 4U3GA 2ZA8A 1UMNA 1ZUJA 3RGDA 3EZUA 3F36A 4MKUA 4MXPA 3F37A 1LKMA 3QHCA 1OTKA 1S30A 3AJOA 5GN8B 2VZBA 3E6SA 5E2DA 4ZKHA 1O9IA 5D8YA 1YV1A 1JI5A 1RCGA 2XJOA 4E40A 3F33A 2JD80 2C2JA 3OGHA 2XJMA 4ZKWA 3SHXA 3C1ZA 3VV9A 4XGSA 2IU2A 2V2RA 3R2MA 2CHIA 4KVQA 2YW7A 1Z6OM 2CEIA 4M32A 2C6RA 2HR5A 3RAVA 5GU3X 3QHBA 5D8SA 5K53A 4DZ0A 3BVFA 3N6OA 1XZ1A 1KRQA 4ITTA 5ERJA 3WVWA 3IS7A 5J8SA 4DYYA 5FFEA 1Z6OA 4MY7A 3FVBA 4KVRA 1H96A 3QZ3A 3FRSA 2V2IA 1XZ3A 2D5KA 3AF7X 4XKUA 5D8OA 5JKLG 4TOAA 3R2RA 2GS4A 3ISEA 1JI4A 3SIDA 4XKSA 2QF9A 2VXXA 5D8QA 3V3KB 5GU2X 3AJPA 1NF6A 2WTLA 3KA6A 4ETRA 2ZG9X 3IQ1A 4TODA 2V2PA 5J93A 3F32A 3C23A 4M33A 1TK6A 4TOHA 5CMQA 4Z5SA 3RD0A 5GU0X 5JKMG 1RYTA 3QB9A 1AEWA 3AF8X 3PW8A 3Q4RA 5JKMA 4REUA 1DATA 1L8IA 1JTSA 3R2HA 2N02A 3Q4QA 4M35A 3E1PA 3BVEA 2VXIA 2G38B 1HRSA 2XJNA 2V2SA 4AM5A 2OH3A 3F34A 4KXRB 3VNXA 4TOEA 3JZ9A 3E2CA 3KA9A 5FFBA 1Z4AA 5LS9A 4ISMA 2YJJA 1FHAA 2CF7A 4LPMA 4MUDA 4Z3BA 3R2OA 2V2OA 3WVVA 5J8WA 4CVTA 2V2MA 2V2NA 3EGMA 4PG1A 3OJ5A 3D19A 3KA8A 5FFDA 1LB3A 3RE7A 3W54A 3Q4NA 4IXKA 1UVHA 2C2FA 3RBCA 3PVYA 2ZA6A 4CYBA 1TJOA 4EVCA 3KWOA 1MFRA 3HIUA 3NOZX 3E1MA 4A25A 4CMYV 2ZG8X 4IWJA 5FFAA 2FKZA 3GVYA 4LQJA 2CLUA 3PVRA 2FJCA 1NNQA 3PVYB 2CN7A 3SH6A 5E1UA 3O7RA 2Z90A 1QYBA 4MJYA 3E1NA 3IS8A 1O9RA 3Q4OA 1JGCA 4MN9A 1J30A 3PW1A 3PVRB 2FG4A 5LG8A 2ZG7X 4ISPA 4RC8A 4ZJKA 1F30A 1N1QA 5LBHA 2W0OA 2Z6MA 2Y3QA 3WVUA 1QGHA 3A9QA 2QQYA 4ZTTA 1VLGA 2XKQA 3KA4A 4DYZA 1JKUA 2IY4A 3UOIA 4YXJA 1YUZA 4LYXA 3KA3A 2GYDA 4YKHA 3QVDA 3VVAA 5C6FA 5K52A 3BVLA 4M34A 1BCFA 4ZL6A 1BG7A 3L0MA 5D8PA 5LG2A 2V8UA 1IERA 2JD70 5D8XA 1F33A 1RCCA 4DI0A 2FG8A 2FL0A 4CMYA 4CY9A 1LKOA 4W4KB 2CWLA 1B71A 1EUMA 2OC5A
chains in the Genus database with same CATH topology
4DE6A 5HU6D 3E6RA 2G4HA 4AM2A 2CHPA 4TOFA 4TW3A 1BFRA 1IESA 3M6JA 2V8TA 3F35A 5AXSA 4P18A 3ISFA 5CMRA 4CVRA 3PW8C 3FSEA 4TOCA 1YUXA 2Z5QA 4ZLWA 2MGYA 2V15A 4TO9A 2C2UA 4RC5A 4LYUA 5CZUA 3C1YA 1S2ZA 3O7SA 3R2KA 1JKVA 2CIHA 2PYBA 2BK6A 3KDQA 5GU1X 2V2JA 3AK9A 2CN6A 3SE1A 4CVSA 3UFBA 3A68A 4ZMCA 3E1LA 3KX9A 3HL1A 4RC7A 4IWKA 3PZAA 3FRRA 4OYNA 3U90A 2FHAA 1JREA 3PWFA 4RC5B 5IX6A 3AK8A 4LPNA 1TKOA 3KXUA 4E6KA 4II4A 3MPSA 2CLBA 3JZAB 2RBDA 4X0JA 3R2SA 5I4JA 1RCDA 1JYBA 1JIGA 2FZFA 4R42A 4RC7B 3UOFA 1NF4A 5J9VA 2IB0A 2Z5PA 3NP2X 4W4LB 4YVZA 5HJHA 3E1JA 4LQHA 2XGWA 4CYAA 4II4B 4LPJA 4TOGA 3BVIA 4EVBA 5HJFA 3GGZA 5JDOA 3GHQA 3E1OA 1MOJA 2HTNA 3AF9X 1LKPA 1RCIA 4TOBA 4XKTA 2ZA7A 4PG0A 4PGIA 4ERUA 4RC6A 1VJXA 4QUWA 3T9JA 2BJYA 3EZ0A 1VEQA 2Y44A 4ZL5A 5JDOB 2WWXB 1NFVA 3UNOA 1L8HA 3H7GA 2BKCA 1VEIA 4RC6B 5D8RA 4WJG4 3PW1B 2WLUA 3ES3A 3TA8A 2FFXJ 4PGKA 4Y08A 5HQOA 2Z5RA 3NP0X 1ZS3A 1SQ3A 1R03A 2YJKA 5FFCA 2ITBA 3AJQA 3PVTA 3WNWA 4YXMA 5JKLA 3GGYA 4ZKXA 1S3QA 4DYXA 2GYQA 1TKPA 3E1QA 4CVPA 3PWQA 3DBYA 4KVSA 2ZURX 3KHKA 3F38A 2X170 4ITWA 4LQNA 2UX1A 1GWGA 3PVTB 4AM4A 3BKNA 3PWQC 4LQVA 3BT5A 2F7NA 3BVKA 5FEJA 2C41A 3C21A 1DPSA 2JD60 3QD8A 4EVEA 5GOUA 3ERZA 3FI6A 3LKDA 2BW1A 4ML5A 4DASA 1SOFA 1VELA 5ERKA 5JACA 5GN8A 2YW6A 4EVDA 2AR0A 1DVBA 2OKCA 3F39A 4DYUA 2V2LA 3GE4A 1RCEA 2WLAA 3R2LA 4U3GA 2ZA8A 1UMNA 1ZUJA 3RGDA 3EZUA 3F36A 4MKUA 4MXPA 3F37A 1LKMA 3QHCA 1OTKA 1S30A 3AJOA 5GN8B 2VZBA 3E6SA 5E2DA 4ZKHA 1O9IA 5D8YA 1YV1A 1JI5A 1RCGA 2XJOA 4E40A 3F33A 2JD80 2C2JA 3OGHA 2XJMA 4ZKWA 3SHXA 3C1ZA 3VV9A 4XGSA 2IU2A 2V2RA 3R2MA 2CHIA 4KVQA 2YW7A 1Z6OM 2CEIA 4M32A 2C6RA 2HR5A 3RAVA 5GU3X 3QHBA 5D8SA 5K53A 4DZ0A 3BVFA 3N6OA 1XZ1A 1KRQA 4ITTA 5ERJA 3WVWA 3IS7A 5J8SA 4DYYA 5FFEA 1Z6OA 4MY7A 3FVBA 4KVRA 1H96A 3QZ3A 3FRSA 2V2IA 1XZ3A 2D5KA 3AF7X 4XKUA 5D8OA 5JKLG 4TOAA 3R2RA 2GS4A 3ISEA 1JI4A 3SIDA 4XKSA 2QF9A 2VXXA 5D8QA 3V3KB 5GU2X 3AJPA 1NF6A 2WTLA 3KA6A 4ETRA 2ZG9X 3IQ1A 4TODA 2V2PA 5J93A 3F32A 3C23A 4M33A 1TK6A 4TOHA 5CMQA 4Z5SA 3RD0A 5GU0X 5JKMG 1RYTA 3QB9A 1AEWA 3AF8X 3PW8A 3Q4RA 5JKMA 4REUA 1DATA 1L8IA 1JTSA 3R2HA 2N02A 3Q4QA 4M35A 3E1PA 3BVEA 2VXIA 2G38B 1HRSA 2XJNA 2V2SA 4AM5A 2OH3A 3F34A 4KXRB 3VNXA 4TOEA 3JZ9A 3E2CA 3KA9A 5FFBA 1Z4AA 5LS9A 4ISMA 2YJJA 1FHAA 2CF7A 4LPMA 4MUDA 4Z3BA 3R2OA 2V2OA 3WVVA 5J8WA 4CVTA 2V2MA 2V2NA 3EGMA 4PG1A 3OJ5A 3D19A 3KA8A 5FFDA 1LB3A 3RE7A 3W54A 3Q4NA 4IXKA 1UVHA 2C2FA 3RBCA 3PVYA 2ZA6A 4CYBA 1TJOA 4EVCA 3KWOA 1MFRA 3HIUA 3NOZX 3E1MA 4A25A 4CMYV 2ZG8X 4IWJA 5FFAA 2FKZA 3GVYA 4LQJA 2CLUA 3PVRA 2FJCA 1NNQA 3PVYB 2CN7A 3SH6A 5E1UA 3O7RA 2Z90A 1QYBA 4MJYA 3E1NA 3IS8A 1O9RA 3Q4OA 1JGCA 4MN9A 1J30A 3PW1A 3PVRB 2FG4A 5LG8A 2ZG7X 4ISPA 4RC8A 4ZJKA 1F30A 1N1QA 5LBHA 2W0OA 2Z6MA 2Y3QA 3WVUA 1QGHA 3A9QA 2QQYA 4ZTTA 1VLGA 2XKQA 3KA4A 4DYZA 1JKUA 2IY4A 3UOIA 4YXJA 1YUZA 4LYXA 3KA3A 2GYDA 4YKHA 3QVDA 3VVAA 5C6FA 5K52A 3BVLA 4M34A 1BCFA 4ZL6A 1BG7A 3L0MA 5D8PA 5LG2A 2V8UA 1IERA 2JD70 5D8XA 1F33A 1RCCA 4DI0A 2FG8A 2FL0A 4CMYA 4CY9A 1LKOA 4W4KB 2CWLA 1B71A 1EUMA 2OC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DE6 A;  3E6R A;  2G4H A;  4AM2 A;  2CHP A;  4TOF A;  4TW3 A;  1BFR A;  1IES A;  5AXS A;  3F35 A;  4P18 A;  3ISF A;  5CMR A;  4CVR A;  3PW8 C;  3FSE A;  4TOC A;  1YUX A;  2Z5Q A;  4ZLW A;  2V15 A;  4TO9 A;  2C2U A;  4RC5 A;  4LYU A;  5CZU A;  1S2Z A;  3O7S A;  3R2K A;  1JKV A;  2CIH A;  2PYB A;  2BK6 A;  5GU1 X;  2V2J A;  3AK9 A;  2CN6 A;  3SE1 A;  4CVS A;  4ZMC A;  3A68 A;  3E1L A;  3KX9 A;  3HL1 A;  4RC7 A;  4IWK A;  3PZA A;  4OYN A;  3U90 A;  2FHA A;  1JRE A;  3PWF A;  4RC5 B;  5IX6 A;  3AK8 A;  4LPN A;  1TKO A;  3KXU A;  4E6K A;  3MPS A;  4II4 A;  2CLB A;  2RBD A;  3R2S A;  5I4J A;  1RCD A;  1JYB A;  1JIG A;  2FZF A;  4R42 A;  4RC7 B;  3UOF A;  1NF4 A;  5J9V A;  2IB0 A;  2Z5P A;  3NP2 X;  5HJH A;  3E1J A;  4LQH A;  2XGW A;  4CYA A;  4II4 B;  4LPJ A;  4TOG A;  3BVI A;  4EVB A;  5HJF A;  3GHQ A;  3E1O A;  1MOJ A;  2HTN A;  3AF9 X;  1LKP A;  1RCI A;  4TOB A;  4XKT A;  2ZA7 A;  4PG0 A;  4PGI A;  4ERU A;  4RC6 A;  1VJX A;  4QUW A;  3T9J A;  2BJY A;  3EZ0 A;  1VEQ A;  4ZL5 A;  1NFV A;  3UNO A;  1L8H A;  3H7G A;  2BKC A;  1VEI A;  4RC6 B;  5D8R A;  3PW1 B;  2WLU A;  3ES3 A;  3TA8 A;  2FFX J;  4PGK A;  4Y08 A;  5HQO A;  2Z5R A;  3NP0 X;  1ZS3 A;  1SQ3 A;  1R03 A;  2YJK A;  5FFC A;  2ITB A;  3AJQ A;  3PVT A;  3WNW A;  5JKL A;  4ZKX A;  1S3Q A;  4DYX A;  2GYQ A;  1TKP A;  3E1Q A;  4CVP A;  3PWQ A;  4KVS A;  2ZUR X;  3F38 A;  2X17 0;  4ITW A;  4LQN A;  2UX1 A;  1GWG A;  3PVT B;  4AM4 A;  3BKN A;  3PWQ C;  4LQV A;  3BT5 A;  2F7N A;  3BVK A;  5FEJ A;  2C41 A;  1DPS A;  2JD6 0;  3QD8 A;  4EVE A;  5GOU A;  3ERZ A;  3FI6 A;  2BW1 A;  4ML5 A;  4DAS A;  1SOF A;  1VEL A;  5ERK A;  5JAC A;  5GN8 A;  2YW6 A;  4EVD A;  1DVB A;  3F39 A;  4DYU A;  2V2L A;  3GE4 A;  1RCE A;  2WLA A;  3R2L A;  4U3G A;  2ZA8 A;  1UMN A;  1ZUJ A;  3RGD A;  3EZU A;  3F36 A;  4MKU A;  3F37 A;  1LKM A;  3QHC A;  1OTK A;  1S30 A;  3AJO A;  5GN8 B;  2VZB A;  3E6S A;  5E2D A;  4ZKH A;  1O9I A;  5D8Y A;  1YV1 A;  1JI5 A;  1RCG A;  2XJO A;  3F33 A;  2JD8 0;  2C2J A;  3OGH A;  2XJM A;  4ZKW A;  3SHX A;  4XGS A;  2IU2 A;  2V2R A;  3R2M A;  2CHI A;  4KVQ A;  2YW7 A;  1Z6O M;  2CEI A;  4M32 A;  2C6R A;  2HR5 A;  3RAV A;  5GU3 X;  3QHB A;  5D8S A;  5K53 A;  4DZ0 A;  3BVF A;  4ITT A;  1XZ1 A;  1KRQ A;  5ERJ A;  3WVW A;  3IS7 A;  5J8S A;  4DYY A;  5FFE A;  1Z6O A;  4MY7 A;  3FVB A;  4KVR A;  1H96 A;  3QZ3 A;  2V2I A;  1XZ3 A;  2D5K A;  3AF7 X;  4XKU A;  5D8O A;  5JKL G;  4TOA A;  3R2R A;  2GS4 A;  3ISE A;  1JI4 A;  3SID A;  4XKS A;  2QF9 A;  2VXX A;  5D8Q A;  5GU2 X;  3AJP A;  1NF6 A;  2WTL A;  3KA6 A;  4ETR A;  2ZG9 X;  3IQ1 A;  4TOD A;  2V2P A;  5J93 A;  3F32 A;  4M33 A;  1TK6 A;  4TOH A;  5CMQ A;  4Z5S A;  3RD0 A;  5GU0 X;  5JKM G;  1RYT A;  3QB9 A;  1AEW A;  3AF8 X;  3PW8 A;  3Q4R A;  5JKM A;  4REU A;  1DAT A;  1L8I A;  1JTS A;  3R2H A;  3Q4Q A;  4M35 A;  3E1P A;  3BVE A;  2VXI A;  1HRS A;  2XJN A;  2V2S A;  4AM5 A;  2OH3 A;  3F34 A;  3VNX A;  4TOE A;  3E2C A;  3KA9 A;  5FFB A;  1Z4A A;  5LS9 A;  4ISM A;  2YJJ A;  1FHA A;  2CF7 A;  4LPM A;  4MUD A;  4Z3B A;  3R2O A;  2V2O A;  3WVV A;  5J8W A;  4CVT A;  2V2M A;  2V2N A;  3EGM A;  4PG1 A;  3OJ5 A;  3KA8 A;  5FFD A;  1LB3 A;  3RE7 A;  3Q4N A;  4IXK A;  1UVH A;  2C2F A;  3RBC A;  3PVY A;  2ZA6 A;  4CYB A;  1TJO A;  4EVC A;  3KWO A;  1MFR A;  3HIU A;  3NOZ X;  3E1M A;  4A25 A;  4CMY V;  2ZG8 X;  4IWJ A;  5FFA A;  2FKZ A;  3GVY A;  4LQJ A;  2CLU A;  3PVR A;  2FJC A;  1NNQ A;  3PVY B;  2CN7 A;  3SH6 A;  5E1U A;  3O7R A;  2Z90 A;  1QYB A;  4MJY A;  3E1N A;  3IS8 A;  1O9R A;  3Q4O A;  1JGC A;  4MN9 A;  1J30 A;  3PW1 A;  3PVR B;  2FG4 A;  5LG8 A;  2ZG7 X;  4ISP A;  4RC8 A;  4ZJK A;  1F30 A;  1N1Q A;  5LBH A;  2W0O A;  2Z6M A;  2Y3Q A;  3WVU A;  1QGH A;  3A9Q A;  2QQY A;  4ZTT A;  1VLG A;  2XKQ A;  3KA4 A;  4DYZ A;  1JKU A;  2IY4 A;  3UOI A;  1YUZ A;  4LYX A;  3KA3 A;  2GYD A;  4YKH A;  3QVD A;  5C6F A;  5K52 A;  3BVL A;  4M34 A;  1BCF A;  4ZL6 A;  1BG7 A;  5D8P A;  5LG2 A;  1IER A;  2JD7 0;  5D8X A;  1F33 A;  1RCC A;  4DI0 A;  2FG8 A;  2FL0 A;  4CMY A;  4CY9 A;  1LKO A;  1B71 A;  1EUM A;  2OC5 A; 
#chains in the Genus database with same CATH topology
 4DE6 A;  5HU6 D;  3E6R A;  2G4H A;  4AM2 A;  2CHP A;  4TOF A;  4TW3 A;  1BFR A;  1IES A;  3M6J A;  2V8T A;  3F35 A;  5AXS A;  4P18 A;  3ISF A;  5CMR A;  4CVR A;  3PW8 C;  3FSE A;  4TOC A;  1YUX A;  2Z5Q A;  4ZLW A;  2MGY A;  2V15 A;  4TO9 A;  2C2U A;  4RC5 A;  4LYU A;  5CZU A;  3C1Y A;  1S2Z A;  3O7S A;  3R2K A;  1JKV A;  2CIH A;  2PYB A;  2BK6 A;  3KDQ A;  5GU1 X;  2V2J A;  3AK9 A;  2CN6 A;  3SE1 A;  4CVS A;  3UFB A;  3A68 A;  4ZMC A;  3E1L A;  3KX9 A;  3HL1 A;  4RC7 A;  4IWK A;  3PZA A;  3FRR A;  4OYN A;  3U90 A;  2FHA A;  1JRE A;  3PWF A;  4RC5 B;  5IX6 A;  3AK8 A;  4LPN A;  1TKO A;  3KXU A;  4E6K A;  4II4 A;  3MPS A;  2CLB A;  3JZA B;  2RBD A;  4X0J A;  3R2S A;  5I4J A;  1RCD A;  1JYB A;  1JIG A;  2FZF A;  4R42 A;  4RC7 B;  3UOF A;  1NF4 A;  5J9V A;  2IB0 A;  2Z5P A;  3NP2 X;  4W4L B;  4YVZ A;  5HJH A;  3E1J A;  4LQH A;  2XGW A;  4CYA A;  4II4 B;  4LPJ A;  4TOG A;  3BVI A;  4EVB A;  5HJF A;  3GGZ A;  5JDO A;  3GHQ A;  3E1O A;  1MOJ A;  2HTN A;  3AF9 X;  1LKP A;  1RCI A;  4TOB A;  4XKT A;  2ZA7 A;  4PG0 A;  4PGI A;  4ERU A;  4RC6 A;  1VJX A;  4QUW A;  3T9J A;  2BJY A;  3EZ0 A;  1VEQ A;  2Y44 A;  4ZL5 A;  5JDO B;  2WWX B;  1NFV A;  3UNO A;  1L8H A;  3H7G A;  2BKC A;  1VEI A;  4RC6 B;  5D8R A;  4WJG 4;  3PW1 B;  2WLU A;  3ES3 A;  3TA8 A;  2FFX J;  4PGK A;  4Y08 A;  5HQO A;  2Z5R A;  3NP0 X;  1ZS3 A;  1SQ3 A;  1R03 A;  2YJK A;  5FFC A;  2ITB A;  3AJQ A;  3PVT A;  3WNW A;  4YXM A;  5JKL A;  3GGY A;  4ZKX A;  1S3Q A;  4DYX A;  2GYQ A;  1TKP A;  3E1Q A;  4CVP A;  3PWQ A;  3DBY A;  4KVS A;  2ZUR X;  3KHK A;  3F38 A;  2X17 0;  4ITW A;  4LQN A;  2UX1 A;  1GWG A;  3PVT B;  4AM4 A;  3BKN A;  3PWQ C;  4LQV A;  3BT5 A;  2F7N A;  3BVK A;  5FEJ A;  2C41 A;  3C21 A;  1DPS A;  2JD6 0;  3QD8 A;  4EVE A;  5GOU A;  3ERZ A;  3FI6 A;  3LKD A;  2BW1 A;  4ML5 A;  4DAS A;  1SOF A;  1VEL A;  5ERK A;  5JAC A;  5GN8 A;  2YW6 A;  4EVD A;  2AR0 A;  1DVB A;  2OKC A;  3F39 A;  4DYU A;  2V2L A;  3GE4 A;  1RCE A;  2WLA A;  3R2L A;  4U3G A;  2ZA8 A;  1UMN A;  1ZUJ A;  3RGD A;  3EZU A;  3F36 A;  4MKU A;  4MXP A;  3F37 A;  1LKM A;  3QHC A;  1OTK A;  1S30 A;  3AJO A;  5GN8 B;  2VZB A;  3E6S A;  5E2D A;  4ZKH A;  1O9I A;  5D8Y A;  1YV1 A;  1JI5 A;  1RCG A;  2XJO A;  4E40 A;  3F33 A;  2JD8 0;  2C2J A;  3OGH A;  2XJM A;  4ZKW A;  3SHX A;  3C1Z A;  3VV9 A;  4XGS A;  2IU2 A;  2V2R A;  3R2M A;  2CHI A;  4KVQ A;  2YW7 A;  1Z6O M;  2CEI A;  4M32 A;  2C6R A;  2HR5 A;  3RAV A;  5GU3 X;  3QHB A;  5D8S A;  5K53 A;  4DZ0 A;  3BVF A;  3N6O A;  1XZ1 A;  1KRQ A;  4ITT A;  5ERJ A;  3WVW A;  3IS7 A;  5J8S A;  4DYY A;  5FFE A;  1Z6O A;  4MY7 A;  3FVB A;  4KVR A;  1H96 A;  3QZ3 A;  3FRS A;  2V2I A;  1XZ3 A;  2D5K A;  3AF7 X;  4XKU A;  5D8O A;  5JKL G;  4TOA A;  3R2R A;  2GS4 A;  3ISE A;  1JI4 A;  3SID A;  4XKS A;  2QF9 A;  2VXX A;  5D8Q A;  3V3K B;  5GU2 X;  3AJP A;  1NF6 A;  2WTL A;  3KA6 A;  4ETR A;  2ZG9 X;  3IQ1 A;  4TOD A;  2V2P A;  5J93 A;  3F32 A;  3C23 A;  4M33 A;  1TK6 A;  4TOH A;  5CMQ A;  4Z5S A;  3RD0 A;  5GU0 X;  5JKM G;  1RYT A;  3QB9 A;  1AEW A;  3AF8 X;  3PW8 A;  3Q4R A;  5JKM A;  4REU A;  1DAT A;  1L8I A;  1JTS A;  3R2H A;  2N02 A;  3Q4Q A;  4M35 A;  3E1P A;  3BVE A;  2VXI A;  2G38 B;  1HRS A;  2XJN A;  2V2S A;  4AM5 A;  2OH3 A;  3F34 A;  4KXR B;  3VNX A;  4TOE A;  3JZ9 A;  3E2C A;  3KA9 A;  5FFB A;  1Z4A A;  5LS9 A;  4ISM A;  2YJJ A;  1FHA A;  2CF7 A;  4LPM A;  4MUD A;  4Z3B A;  3R2O A;  2V2O A;  3WVV A;  5J8W A;  4CVT A;  2V2M A;  2V2N A;  3EGM A;  4PG1 A;  3OJ5 A;  3D19 A;  3KA8 A;  5FFD A;  1LB3 A;  3RE7 A;  3W54 A;  3Q4N A;  4IXK A;  1UVH A;  2C2F A;  3RBC A;  3PVY A;  2ZA6 A;  4CYB A;  1TJO A;  4EVC A;  3KWO A;  1MFR A;  3HIU A;  3NOZ X;  3E1M A;  4A25 A;  4CMY V;  2ZG8 X;  4IWJ A;  5FFA A;  2FKZ A;  3GVY A;  4LQJ A;  2CLU A;  3PVR A;  2FJC A;  1NNQ A;  3PVY B;  2CN7 A;  3SH6 A;  5E1U A;  3O7R A;  2Z90 A;  1QYB A;  4MJY A;  3E1N A;  3IS8 A;  1O9R A;  3Q4O A;  1JGC A;  4MN9 A;  1J30 A;  3PW1 A;  3PVR B;  2FG4 A;  5LG8 A;  2ZG7 X;  4ISP A;  4RC8 A;  4ZJK A;  1F30 A;  1N1Q A;  5LBH A;  2W0O A;  2Z6M A;  2Y3Q A;  3WVU A;  1QGH A;  3A9Q A;  2QQY A;  4ZTT A;  1VLG A;  2XKQ A;  3KA4 A;  4DYZ A;  1JKU A;  2IY4 A;  3UOI A;  4YXJ A;  1YUZ A;  4LYX A;  3KA3 A;  2GYD A;  4YKH A;  3QVD A;  3VVA A;  5C6F A;  5K52 A;  3BVL A;  4M34 A;  1BCF A;  4ZL6 A;  1BG7 A;  3L0M A;  5D8P A;  5LG2 A;  2V8U A;  1IER A;  2JD7 0;  5D8X A;  1F33 A;  1RCC A;  4DI0 A;  2FG8 A;  2FL0 A;  4CMY A;  4CY9 A;  1LKO A;  4W4K B;  2CWL A;  1B71 A;  1EUM A;  2OC5 A; 
#chains in the Genus database with same CATH homology
 4DE6 A;  5HU6 D;  3E6R A;  2G4H A;  4AM2 A;  2CHP A;  4TOF A;  4TW3 A;  1BFR A;  1IES A;  3M6J A;  2V8T A;  3F35 A;  5AXS A;  4P18 A;  3ISF A;  5CMR A;  4CVR A;  3PW8 C;  3FSE A;  4TOC A;  1YUX A;  2Z5Q A;  4ZLW A;  2MGY A;  2V15 A;  4TO9 A;  2C2U A;  4RC5 A;  4LYU A;  5CZU A;  3C1Y A;  1S2Z A;  3O7S A;  3R2K A;  1JKV A;  2CIH A;  2PYB A;  2BK6 A;  3KDQ A;  5GU1 X;  2V2J A;  3AK9 A;  2CN6 A;  3SE1 A;  4CVS A;  3UFB A;  3A68 A;  4ZMC A;  3E1L A;  3KX9 A;  3HL1 A;  4RC7 A;  4IWK A;  3PZA A;  3FRR A;  4OYN A;  3U90 A;  2FHA A;  1JRE A;  3PWF A;  4RC5 B;  5IX6 A;  3AK8 A;  4LPN A;  1TKO A;  3KXU A;  4E6K A;  4II4 A;  3MPS A;  2CLB A;  3JZA B;  2RBD A;  4X0J A;  3R2S A;  5I4J A;  1RCD A;  1JYB A;  1JIG A;  2FZF A;  4R42 A;  4RC7 B;  3UOF A;  1NF4 A;  5J9V A;  2IB0 A;  2Z5P A;  3NP2 X;  4W4L B;  4YVZ A;  5HJH A;  3E1J A;  4LQH A;  2XGW A;  4CYA A;  4II4 B;  4LPJ A;  4TOG A;  3BVI A;  4EVB A;  5HJF A;  3GGZ A;  5JDO A;  3GHQ A;  3E1O A;  1MOJ A;  2HTN A;  3AF9 X;  1LKP A;  1RCI A;  4TOB A;  4XKT A;  2ZA7 A;  4PG0 A;  4PGI A;  4ERU A;  4RC6 A;  1VJX A;  4QUW A;  3T9J A;  2BJY A;  3EZ0 A;  1VEQ A;  2Y44 A;  4ZL5 A;  5JDO B;  2WWX B;  1NFV A;  3UNO A;  1L8H A;  3H7G A;  2BKC A;  1VEI A;  4RC6 B;  5D8R A;  4WJG 4;  3PW1 B;  2WLU A;  3ES3 A;  3TA8 A;  2FFX J;  4PGK A;  4Y08 A;  5HQO A;  2Z5R A;  3NP0 X;  1ZS3 A;  1SQ3 A;  1R03 A;  2YJK A;  5FFC A;  2ITB A;  3AJQ A;  3PVT A;  3WNW A;  4YXM A;  5JKL A;  3GGY A;  4ZKX A;  1S3Q A;  4DYX A;  2GYQ A;  1TKP A;  3E1Q A;  4CVP A;  3PWQ A;  3DBY A;  4KVS A;  2ZUR X;  3KHK A;  3F38 A;  2X17 0;  4ITW A;  4LQN A;  2UX1 A;  1GWG A;  3PVT B;  4AM4 A;  3BKN A;  3PWQ C;  4LQV A;  3BT5 A;  2F7N A;  3BVK A;  5FEJ A;  2C41 A;  3C21 A;  1DPS A;  2JD6 0;  3QD8 A;  4EVE A;  5GOU A;  3ERZ A;  3FI6 A;  3LKD A;  2BW1 A;  4ML5 A;  4DAS A;  1SOF A;  1VEL A;  5ERK A;  5JAC A;  5GN8 A;  2YW6 A;  4EVD A;  2AR0 A;  1DVB A;  2OKC A;  3F39 A;  4DYU A;  2V2L A;  3GE4 A;  1RCE A;  2WLA A;  3R2L A;  4U3G A;  2ZA8 A;  1UMN A;  1ZUJ A;  3RGD A;  3EZU A;  3F36 A;  4MKU A;  4MXP A;  3F37 A;  1LKM A;  3QHC A;  1OTK A;  1S30 A;  3AJO A;  5GN8 B;  2VZB A;  3E6S A;  5E2D A;  4ZKH A;  1O9I A;  5D8Y A;  1YV1 A;  1JI5 A;  1RCG A;  2XJO A;  4E40 A;  3F33 A;  2JD8 0;  2C2J A;  3OGH A;  2XJM A;  4ZKW A;  3SHX A;  3C1Z A;  3VV9 A;  4XGS A;  2IU2 A;  2V2R A;  3R2M A;  2CHI A;  4KVQ A;  2YW7 A;  1Z6O M;  2CEI A;  4M32 A;  2C6R A;  2HR5 A;  3RAV A;  5GU3 X;  3QHB A;  5D8S A;  5K53 A;  4DZ0 A;  3BVF A;  3N6O A;  1XZ1 A;  1KRQ A;  4ITT A;  5ERJ A;  3WVW A;  3IS7 A;  5J8S A;  4DYY A;  5FFE A;  1Z6O A;  4MY7 A;  3FVB A;  4KVR A;  1H96 A;  3QZ3 A;  3FRS A;  2V2I A;  1XZ3 A;  2D5K A;  3AF7 X;  4XKU A;  5D8O A;  5JKL G;  4TOA A;  3R2R A;  2GS4 A;  3ISE A;  1JI4 A;  3SID A;  4XKS A;  2QF9 A;  2VXX A;  5D8Q A;  3V3K B;  5GU2 X;  3AJP A;  1NF6 A;  2WTL A;  3KA6 A;  4ETR A;  2ZG9 X;  3IQ1 A;  4TOD A;  2V2P A;  5J93 A;  3F32 A;  3C23 A;  4M33 A;  1TK6 A;  4TOH A;  5CMQ A;  4Z5S A;  3RD0 A;  5GU0 X;  5JKM G;  1RYT A;  3QB9 A;  1AEW A;  3AF8 X;  3PW8 A;  3Q4R A;  5JKM A;  4REU A;  1DAT A;  1L8I A;  1JTS A;  3R2H A;  2N02 A;  3Q4Q A;  4M35 A;  3E1P A;  3BVE A;  2VXI A;  2G38 B;  1HRS A;  2XJN A;  2V2S A;  4AM5 A;  2OH3 A;  3F34 A;  4KXR B;  3VNX A;  4TOE A;  3JZ9 A;  3E2C A;  3KA9 A;  5FFB A;  1Z4A A;  5LS9 A;  4ISM A;  2YJJ A;  1FHA A;  2CF7 A;  4LPM A;  4MUD A;  4Z3B A;  3R2O A;  2V2O A;  3WVV A;  5J8W A;  4CVT A;  2V2M A;  2V2N A;  3EGM A;  4PG1 A;  3OJ5 A;  3D19 A;  3KA8 A;  5FFD A;  1LB3 A;  3RE7 A;  3W54 A;  3Q4N A;  4IXK A;  1UVH A;  2C2F A;  3RBC A;  3PVY A;  2ZA6 A;  4CYB A;  1TJO A;  4EVC A;  3KWO A;  1MFR A;  3HIU A;  3NOZ X;  3E1M A;  4A25 A;  4CMY V;  2ZG8 X;  4IWJ A;  5FFA A;  2FKZ A;  3GVY A;  4LQJ A;  2CLU A;  3PVR A;  2FJC A;  1NNQ A;  3PVY B;  2CN7 A;  3SH6 A;  5E1U A;  3O7R A;  2Z90 A;  1QYB A;  4MJY A;  3E1N A;  3IS8 A;  1O9R A;  3Q4O A;  1JGC A;  4MN9 A;  1J30 A;  3PW1 A;  3PVR B;  2FG4 A;  5LG8 A;  2ZG7 X;  4ISP A;  4RC8 A;  4ZJK A;  1F30 A;  1N1Q A;  5LBH A;  2W0O A;  2Z6M A;  2Y3Q A;  3WVU A;  1QGH A;  3A9Q A;  2QQY A;  4ZTT A;  1VLG A;  2XKQ A;  3KA4 A;  4DYZ A;  1JKU A;  2IY4 A;  3UOI A;  4YXJ A;  1YUZ A;  4LYX A;  3KA3 A;  2GYD A;  4YKH A;  3QVD A;  3VVA A;  5C6F A;  5K52 A;  3BVL A;  4M34 A;  1BCF A;  4ZL6 A;  1BG7 A;  3L0M A;  5D8P A;  5LG2 A;  2V8U A;  1IER A;  2JD7 0;  5D8X A;  1F33 A;  1RCC A;  4DI0 A;  2FG8 A;  2FL0 A;  4CMY A;  4CY9 A;  1LKO A;  4W4K B;  2CWL A;  1B71 A;  1EUM A;  2OC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...