2QF9A

Crystal structure of putative secreted protein duf305 from streptomyces coelicolor
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
172
structure length
162
Chain Sequence
AADSADAGFARDMSVHHQQAVEMSYIVRDRTDDEEVRRLAYDIAQTQANQRGMMIGWLDLWALPKVSSDPPMTWMGMGMPGMATDAEMKKLGTLDGKQAEVYYLQLMTEHHRGGVHMAKGCVERCTVGVEKRLARGMVESQESEIRLMADLLAERGAKEGHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative secreted protein
publication title Structure of putative secreted protein DUF305 from Streptomyces coelicolor.
rcsb
source organism Streptomyces coelicolor a3(2)
total genus 55
structure length 162
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03713 DUF305 Domain of unknown function (DUF305)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2qf9A01
4AM4A 4CYAA 3KXUA 3H7GA 4LQVA 4TW3A 5K53A 1SQ3A 3F34A 2BJYA 5D8QA 1AEWA 4OYNA 2V2RA 3KA9A 4CVTA 4EVCA 1Z6OM 4ZKWA 1NF6A 4LQHA 2X170 4KVSA 2FG8A 2D5KA 3EGMA 1JREA 5HQOA 2V2OA 1BCFA 2Z5QA 2BW1A 1JTSA 2V2NA 3NP0X 2ZG7X 3KX9A 3AK9A 3SIDA 5J9VA 3QHBA 1JYBA 2QF9A 4EVEA 3AJPA 2Z6MA 4MY7A 3KA3A 1NFVA 4CMYA 2JD80 3HIUA 4M35A 1ZS3A 3R2LA 4ERUA 5IX6A 3E1MA 3PWQA 2G4HA 3AK8A 2ZA8A 3F33A 4CVRA 3SH6A 4RC6B 3U90A 3MPSA 5I4JA 1MFRA 4LQJA 3UOFA 1JKUA 2YW6A 3PVYA 2FL0A 4CVPA 1BFRA 4TOCA 2V2JA 3A68A 4TO9A 5FFCA 1F33A 4ZTTA 2YJKA 3GVYA 2CHPA 1S2ZA 3ISEA 3Q4QA 3WVVA 4ISMA 4DZ0A 2IY4A 1LKOA 2FJCA 4IWJA 1B71A 3RE7A 4DI0A 1GWGA 3KA6A 4Z5SA 1RCCA 4LPMA 3RBCA 1L8HA 3F38A 3PWQC 3E1NA 4XGSA 5FEJA 3BVIA 5CMRA 4DYXA 3FVBA 3PW8A 5GU3X 2QQYA 4R42A 3ISFA 3IS8A 2IB0A 2CEIA 5LG2A 4RC7A 3R2OA 1VLGA 1TJOA 2BK6A 3QZ3A 3T9JA 3KWOA 1DVBA 1DATA 1R03A 4ZL5A 5D8RA 5LG8A 3R2HA 3F37A 3AF7X 3PVYB 4RC5A 1RCIA 2V2MA 2HR5A 4KVQA 5JKMG 3AJQA 1RCDA 3F32A 5J8WA 2WLUA 3FSEA 4MUDA 4CVSA 4P18A 3VNXA 5JACA 3PW8C 2CLUA 1KRQA 5FFEA 2YW7A 3PVRA 2C2UA 4DE6A 3WNWA 3E2CA 1XZ3A 3F39A 1JI5A 1UVHA 5GOUA 3SHXA 3O7SA 2ZURX 5JKMA 3PW1A 2Z5PA 2VXXA 3E1JA 4TOAA 2PYBA 5E1UA 5JKLG 3IQ1A 1JGCA 1JI4A 2UX1A 1SOFA 4Y08A 3QD8A 3AJOA 2RBDA 1DPSA 2GS4A 2HTNA 3PVTA 4LYXA 4II4A 4XKUA 4M33A 5K52A 2FKZA 2XJNA 2ZA6A 2JD60 3PZAA 4RC7B 4MKUA 3KA8A 1HRSA 2XJMA 2CIHA 5JKLA 2C41A 1OTKA 3E6RA 1TKPA 3Q4NA 2Z90A 2VZBA 4XKTA 4ZL6A 2WTLA 3R2MA 3AF8X 4ZJKA 4AM5A 1VEIA 4ISPA 5D8XA 2CHIA 4RC5B 3OJ5A 4DASA 5HJHA 2OC5A 1XZ1A 4TOGA 4TOEA 1F30A 5AXSA 3R2RA 2BKCA 5GU0X 1JIGA 3R2SA 2Z5RA 3ES3A 2XJOA 3BVLA 4PGKA 1ZUJA 2W0OA 3F35A 1LB3A 3E1PA 3QVDA 4A25A 2VXIA 4ML5A 1RCEA 4PG1A 2OH3A 4TOHA 1O9IA 5C6FA 4U3GA 3Q4OA 2FHAA 3BVEA 4LQNA 5GU1X 2WLAA 1MOJA 1N1QA 4IXKA 5D8YA 3O7RA 2ITBA 3F36A 5HJFA 1QYBA 3E1LA 3PVTB 4QUWA 1YV1A 1EUMA 4ZMCA 4RC6A 1S30A 1YUXA 3GHQA 1RCGA 5CZUA 1NNQA 4IWKA 4TODA 3Q4RA 2ZA7A 5FFBA 1J30A 4ITWA 2YJJA 4TOBA 4CYBA 2V2LA 5LS9A 1VELA 1LKPA 3BT5A 2V2PA 3BVKA 4TOFA 4XKSA 2C2FA 4CMYV 3NOZX 2XKQA 4MJYA 1RYTA 3RGDA 5GU2X 5ERJA 1H96A 2XGWA 3KA4A 2GYQA 5FFDA 1JKVA 3EZUA 4LPNA 4E6KA 5LBHA 4ZKXA 2FZFA 5GN8A 2GYDA 5E2DA 1BG7A 5D8SA 1VEQA 4DYYA 3NP2X 3GE4A 4ITTA 5J8SA 4YKHA 1VJXA 4ZLWA 3AF9X 3FI6A 1QGHA 2V2SA 3R2KA 3QHCA 1IERA 2V2IA 2F7NA 1TKOA 4ZKHA 1NF4A 2C6RA 2CLBA 2FG4A 1LKMA 4EVDA 3IS7A 4M32A 3OGHA 3E6SA 5D8PA 4LYUA 2V15A 4REUA 1L8IA 4RC8A 2FFXJ 1S3QA 3PVRB 2Y3QA 2ZG9X 3RD0A 4KVRA 3WVWA 1FHAA 2CN6A 2CN7A 4PGIA 5D8OA 3TA8A 3HL1A 3PW1B 3BVFA 2IU2A 4DYZA 1IESA 1UMNA 3A9QA 4MN9A 4CY9A 1Z6OA 4ETRA 2JD70 3EZ0A 4LPJA 4EVBA 4AM2A 3BKNA 5ERKA 5GN8B 4II4B 3UNOA 1YUZA 2C2JA 3ERZA 4M34A 2ZG8X 1Z4AA 2CF7A 3WVUA 5CMQA 3QB9A 3RAVA 4DYUA 5J93A 1O9RA 3PWFA 4PG0A 1TK6A 5FFAA 4Z3BA 3E1OA 3UOIA 3SE1A 3E1QA
chains in the Genus database with same CATH superfamily
4AM4A 4CYAA 3KXUA 3H7GA 4LQVA 4TW3A 5K53A 1SQ3A 3F34A 2Y44A 3GGZA 2BJYA 5D8QA 1AEWA 4OYNA 2V2RA 3KA9A 4CVTA 4EVCA 1Z6OM 4ZKWA 1NF6A 4LQHA 3UFBA 2X170 4KVSA 2FG8A 2D5KA 3EGMA 1JREA 5HQOA 2V2OA 1BCFA 2Z5QA 2BW1A 1JTSA 2V2NA 3NP0X 4YXJA 2ZG7X 3KX9A 3AK9A 3SIDA 5J9VA 3QHBA 1JYBA 2QF9A 4EVEA 3N6OA 3AJPA 2Z6MA 4MY7A 3KA3A 1NFVA 4CMYA 2JD80 3HIUA 4M35A 1ZS3A 3R2LA 4ERUA 4W4KB 3E1MA 5IX6A 3PWQA 2G4HA 3AK8A 2ZA8A 3F33A 2V8UA 4CVRA 3SH6A 4RC6B 3U90A 3MPSA 5I4JA 1MFRA 4LQJA 3UOFA 1JKUA 2YW6A 3PVYA 2FL0A 4CVPA 1BFRA 4TOCA 2V2JA 3A68A 4TO9A 5FFCA 1F33A 4ZTTA 2YJKA 3GVYA 3V3KB 2CHPA 4YXMA 1S2ZA 3ISEA 3Q4QA 3WVVA 4ISMA 4DZ0A 2IY4A 1LKOA 2FJCA 4IWJA 1B71A 3RE7A 4DI0A 1GWGA 3KA6A 4Z5SA 1RCCA 4LPMA 3RBCA 1L8HA 3F38A 3FRRA 3PWQC 3E1NA 4XGSA 5FEJA 4YVZA 3BVIA 5CMRA 4DYXA 3FVBA 3PW8A 2V8TA 5GU3X 2QQYA 4R42A 3ISFA 3IS8A 2IB0A 2CEIA 5LG2A 4RC7A 3R2OA 1VLGA 1TJOA 2BK6A 3QZ3A 3T9JA 3KWOA 1DVBA 1DATA 1R03A 2AR0A 3KDQA 4ZL5A 5D8RA 5LG8A 3R2HA 3F37A 3AF7X 3PVYB 4RC5A 1RCIA 2V2MA 2HR5A 4KVQA 3M6JA 5JKMG 3AJQA 1RCDA 3F32A 5J8WA 2WLUA 3FSEA 4MUDA 3C1ZA 4CVSA 4P18A 3VNXA 5JACA 3PW8C 2CLUA 1KRQA 5FFEA 2YW7A 3PVRA 2C2UA 4DE6A 3WNWA 3E2CA 1XZ3A 3F39A 1JI5A 1UVHA 5GOUA 3SHXA 3O7SA 3DBYA 2ZURX 5JKMA 3PW1A 2Z5PA 2CWLA 2VXXA 3E1JA 4TOAA 2PYBA 5E1UA 3L0MA 5JKLG 3IQ1A 1JGCA 1JI4A 2UX1A 1SOFA 2OKCA 4Y08A 3QD8A 3AJOA 2RBDA 1DPSA 2GS4A 2HTNA 3PVTA 4LYXA 4II4A 4XKUA 4M33A 5K52A 2FKZA 2XJNA 2N02A 2ZA6A 2JD60 3PZAA 4RC7B 4MKUA 3KA8A 1HRSA 2XJMA 2CIHA 5JKLA 2C41A 1OTKA 3E6RA 1TKPA 3C23A 2Z90A 3Q4NA 2VZBA 4XKTA 4ZL6A 2WTLA 3R2MA 3AF8X 4ZJKA 4AM5A 1VEIA 4ISPA 5D8XA 2CHIA 4RC5B 3FRSA 3OJ5A 3GGYA 4DASA 5HJHA 2OC5A 1XZ1A 4TOGA 4TOEA 1F30A 5AXSA 3R2RA 2BKCA 5GU0X 1JIGA 3R2SA 2Z5RA 3ES3A 2XJOA 3BVLA 4PGKA 1ZUJA 2W0OA 3F35A 1LB3A 3E1PA 2MGYA 3QVDA 4X0JA 4A25A 2VXIA 4ML5A 1RCEA 3VV9A 4PG1A 2OH3A 4TOHA 1O9IA 5C6FA 4U3GA 3W54A 3Q4OA 5JDOA 2FHAA 3BVEA 3JZ9A 5GU1X 4LQNA 2WLAA 1MOJA 1N1QA 4IXKA 5D8YA 3O7RA 2ITBA 3F36A 5HJFA 1QYBA 3E1LA 3PVTB 4QUWA 1YV1A 1EUMA 4ZMCA 4RC6A 1S30A 1YUXA 3GHQA 1RCGA 5CZUA 1NNQA 4IWKA 4TODA 3Q4RA 2ZA7A 5FFBA 1J30A 4ITWA 2YJJA 4TOBA 4CYBA 2V2LA 5LS9A 1VELA 2WWXB 1LKPA 3LKDA 3BT5A 3JZAB 2V2PA 3BVKA 4TOFA 4XKSA 2C2FA 4CMYV 3NOZX 2XKQA 4MJYA 1RYTA 4W4LB 3RGDA 5GU2X 5ERJA 1H96A 2XGWA 3KA4A 2GYQA 5FFDA 1JKVA 3EZUA 4LPNA 4E6KA 5LBHA 4ZKXA 2FZFA 5GN8A 2GYDA 5E2DA 1BG7A 5D8SA 1VEQA 4DYYA 3NP2X 3GE4A 4ITTA 5JDOB 5J8SA 4YKHA 1VJXA 4ZLWA 3AF9X 3FI6A 1QGHA 2V2SA 3R2KA 3QHCA 1IERA 2V2IA 2F7NA 1TKOA 4ZKHA 1NF4A 2C6RA 2CLBA 2FG4A 1LKMA 2G38B 4EVDA 3IS7A 4M32A 3OGHA 3E6SA 5D8PA 4LYUA 2V15A 4REUA 1L8IA 4RC8A 2FFXJ 3C1YA 1S3QA 3PVRB 2Y3QA 2ZG9X 3RD0A 4KVRA 3WVWA 1FHAA 2CN6A 4MXPA 2CN7A 4PGIA 5D8OA 3TA8A 3HL1A 3PW1B 3BVFA 2IU2A 4DYZA 1IESA 1UMNA 3A9QA 4MN9A 4CY9A 3D19A 4KXRB 3C21A 1Z6OA 4ETRA 2JD70 3EZ0A 4LPJA 4EVBA 4AM2A 3BKNA 4E40A 5ERKA 5GN8B 4II4B 3UNOA 1YUZA 2C2JA 3VVAA 3ERZA 4M34A 2ZG8X 1Z4AA 2CF7A 3WVUA 5HU6D 5CMQA 3QB9A 3RAVA 4DYUA 5J93A 1O9RA 3KHKA 3PWFA 4PG0A 1TK6A 5FFAA 4WJG4 4Z3BA 3E1OA 3UOIA 3SE1A 3E1QA
chains in the Genus database with same CATH topology
4AM4A 4CYAA 3KXUA 3H7GA 4LQVA 4TW3A 5K53A 1SQ3A 3F34A 2Y44A 3GGZA 2BJYA 5D8QA 1AEWA 4OYNA 2V2RA 3KA9A 4CVTA 4EVCA 1Z6OM 4ZKWA 1NF6A 4LQHA 3UFBA 2X170 4KVSA 2FG8A 2D5KA 3EGMA 1JREA 5HQOA 2V2OA 1BCFA 2Z5QA 2BW1A 1JTSA 2V2NA 3NP0X 4YXJA 2ZG7X 3KX9A 3AK9A 3SIDA 5J9VA 3QHBA 1JYBA 2QF9A 4EVEA 3N6OA 3AJPA 2Z6MA 4MY7A 3KA3A 1NFVA 4CMYA 2JD80 3HIUA 4M35A 1ZS3A 3R2LA 4ERUA 4W4KB 3E1MA 5IX6A 3PWQA 2G4HA 3AK8A 2ZA8A 3F33A 2V8UA 4CVRA 3SH6A 4RC6B 3U90A 3MPSA 5I4JA 1MFRA 4LQJA 3UOFA 1JKUA 2YW6A 3PVYA 2FL0A 4CVPA 1BFRA 4TOCA 2V2JA 3A68A 4TO9A 5FFCA 1F33A 4ZTTA 2YJKA 3GVYA 3V3KB 2CHPA 4YXMA 1S2ZA 3ISEA 3Q4QA 3WVVA 4ISMA 4DZ0A 2IY4A 1LKOA 2FJCA 4IWJA 1B71A 3RE7A 4DI0A 1GWGA 3KA6A 4Z5SA 1RCCA 4LPMA 3RBCA 1L8HA 3F38A 3FRRA 3PWQC 3E1NA 4XGSA 5FEJA 4YVZA 3BVIA 5CMRA 4DYXA 3FVBA 3PW8A 2V8TA 5GU3X 2QQYA 4R42A 3ISFA 3IS8A 2IB0A 2CEIA 5LG2A 4RC7A 3R2OA 1VLGA 1TJOA 2BK6A 3QZ3A 3T9JA 3KWOA 1DVBA 1DATA 1R03A 2AR0A 3KDQA 4ZL5A 5D8RA 5LG8A 3R2HA 3F37A 3AF7X 3PVYB 4RC5A 1RCIA 2V2MA 2HR5A 4KVQA 3M6JA 5JKMG 3AJQA 1RCDA 3F32A 5J8WA 2WLUA 3FSEA 4MUDA 3C1ZA 4CVSA 4P18A 3VNXA 5JACA 3PW8C 2CLUA 1KRQA 5FFEA 2YW7A 3PVRA 2C2UA 4DE6A 3WNWA 3E2CA 1XZ3A 3F39A 1JI5A 1UVHA 5GOUA 3SHXA 3O7SA 3DBYA 2ZURX 5JKMA 3PW1A 2Z5PA 2CWLA 2VXXA 3E1JA 4TOAA 2PYBA 5E1UA 3L0MA 5JKLG 3IQ1A 1JGCA 1JI4A 2UX1A 1SOFA 2OKCA 4Y08A 3QD8A 3AJOA 2RBDA 1DPSA 2GS4A 2HTNA 3PVTA 4LYXA 4II4A 4XKUA 4M33A 5K52A 2FKZA 2XJNA 2N02A 2ZA6A 2JD60 3PZAA 4RC7B 4MKUA 3KA8A 1HRSA 2XJMA 2CIHA 5JKLA 2C41A 1OTKA 3E6RA 1TKPA 3C23A 2Z90A 3Q4NA 2VZBA 4XKTA 4ZL6A 2WTLA 3R2MA 3AF8X 4ZJKA 4AM5A 1VEIA 4ISPA 5D8XA 2CHIA 4RC5B 3FRSA 3OJ5A 3GGYA 4DASA 5HJHA 2OC5A 1XZ1A 4TOGA 4TOEA 1F30A 5AXSA 3R2RA 2BKCA 5GU0X 1JIGA 3R2SA 2Z5RA 3ES3A 2XJOA 3BVLA 4PGKA 1ZUJA 2W0OA 3F35A 1LB3A 3E1PA 2MGYA 3QVDA 4X0JA 4A25A 2VXIA 4ML5A 1RCEA 3VV9A 4PG1A 2OH3A 4TOHA 1O9IA 5C6FA 4U3GA 3W54A 3Q4OA 5JDOA 2FHAA 3BVEA 3JZ9A 5GU1X 4LQNA 2WLAA 1MOJA 1N1QA 4IXKA 5D8YA 3O7RA 2ITBA 3F36A 5HJFA 1QYBA 3E1LA 3PVTB 4QUWA 1YV1A 1EUMA 4ZMCA 4RC6A 1S30A 1YUXA 3GHQA 1RCGA 5CZUA 1NNQA 4IWKA 4TODA 3Q4RA 2ZA7A 5FFBA 1J30A 4ITWA 2YJJA 4TOBA 4CYBA 2V2LA 5LS9A 1VELA 2WWXB 1LKPA 3LKDA 3BT5A 3JZAB 2V2PA 3BVKA 4TOFA 4XKSA 2C2FA 4CMYV 3NOZX 2XKQA 4MJYA 1RYTA 4W4LB 3RGDA 5GU2X 5ERJA 1H96A 2XGWA 3KA4A 2GYQA 5FFDA 1JKVA 3EZUA 4LPNA 4E6KA 5LBHA 4ZKXA 2FZFA 5GN8A 2GYDA 5E2DA 1BG7A 5D8SA 1VEQA 4DYYA 3NP2X 3GE4A 4ITTA 5JDOB 5J8SA 4YKHA 1VJXA 4ZLWA 3AF9X 3FI6A 1QGHA 2V2SA 3R2KA 3QHCA 1IERA 2V2IA 2F7NA 1TKOA 4ZKHA 1NF4A 2C6RA 2CLBA 2FG4A 1LKMA 2G38B 4EVDA 3IS7A 4M32A 3OGHA 3E6SA 5D8PA 4LYUA 2V15A 4REUA 1L8IA 4RC8A 2FFXJ 3C1YA 1S3QA 3PVRB 2Y3QA 2ZG9X 3RD0A 4KVRA 3WVWA 1FHAA 2CN6A 4MXPA 2CN7A 4PGIA 5D8OA 3TA8A 3HL1A 3PW1B 3BVFA 2IU2A 4DYZA 1IESA 1UMNA 3A9QA 4MN9A 4CY9A 3D19A 4KXRB 3C21A 1Z6OA 4ETRA 2JD70 3EZ0A 4LPJA 4EVBA 4AM2A 3BKNA 4E40A 5ERKA 5GN8B 4II4B 3UNOA 1YUZA 2C2JA 3VVAA 3ERZA 4M34A 2ZG8X 1Z4AA 2CF7A 3WVUA 5HU6D 5CMQA 3QB9A 3RAVA 4DYUA 5J93A 1O9RA 3KHKA 3PWFA 4PG0A 1TK6A 5FFAA 4WJG4 4Z3BA 3E1OA 3UOIA 3SE1A 3E1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AM4 A;  4CYA A;  3KXU A;  3H7G A;  4LQV A;  4TW3 A;  5K53 A;  1SQ3 A;  3F34 A;  2BJY A;  5D8Q A;  1AEW A;  4OYN A;  2V2R A;  3KA9 A;  4CVT A;  4EVC A;  1Z6O M;  4ZKW A;  1NF6 A;  4LQH A;  2X17 0;  4KVS A;  2FG8 A;  2D5K A;  3EGM A;  1JRE A;  5HQO A;  2V2O A;  1BCF A;  2Z5Q A;  2BW1 A;  1JTS A;  2V2N A;  3NP0 X;  2ZG7 X;  3KX9 A;  3AK9 A;  3SID A;  5J9V A;  3QHB A;  1JYB A;  2QF9 A;  4EVE A;  3AJP A;  2Z6M A;  4MY7 A;  3KA3 A;  1NFV A;  4CMY A;  2JD8 0;  3HIU A;  4M35 A;  1ZS3 A;  3R2L A;  4ERU A;  5IX6 A;  3E1M A;  3PWQ A;  2G4H A;  3AK8 A;  2ZA8 A;  3F33 A;  4CVR A;  3SH6 A;  4RC6 B;  3U90 A;  3MPS A;  5I4J A;  1MFR A;  4LQJ A;  3UOF A;  1JKU A;  2YW6 A;  3PVY A;  2FL0 A;  4CVP A;  1BFR A;  4TOC A;  2V2J A;  3A68 A;  4TO9 A;  5FFC A;  1F33 A;  4ZTT A;  2YJK A;  3GVY A;  2CHP A;  1S2Z A;  3ISE A;  3Q4Q A;  3WVV A;  4ISM A;  4DZ0 A;  2IY4 A;  1LKO A;  2FJC A;  4IWJ A;  1B71 A;  3RE7 A;  4DI0 A;  1GWG A;  3KA6 A;  4Z5S A;  1RCC A;  4LPM A;  3RBC A;  1L8H A;  3F38 A;  3PWQ C;  3E1N A;  4XGS A;  5FEJ A;  3BVI A;  5CMR A;  4DYX A;  3FVB A;  3PW8 A;  5GU3 X;  2QQY A;  4R42 A;  3ISF A;  3IS8 A;  2IB0 A;  2CEI A;  5LG2 A;  4RC7 A;  3R2O A;  1VLG A;  1TJO A;  2BK6 A;  3QZ3 A;  3T9J A;  3KWO A;  1DVB A;  1DAT A;  1R03 A;  4ZL5 A;  5D8R A;  5LG8 A;  3R2H A;  3F37 A;  3AF7 X;  3PVY B;  4RC5 A;  1RCI A;  2V2M A;  2HR5 A;  4KVQ A;  5JKM G;  3AJQ A;  1RCD A;  3F32 A;  5J8W A;  2WLU A;  3FSE A;  4MUD A;  4CVS A;  4P18 A;  3VNX A;  5JAC A;  3PW8 C;  2CLU A;  1KRQ A;  5FFE A;  2YW7 A;  3PVR A;  2C2U A;  4DE6 A;  3WNW A;  3E2C A;  1XZ3 A;  3F39 A;  1JI5 A;  1UVH A;  5GOU A;  3SHX A;  3O7S A;  2ZUR X;  5JKM A;  3PW1 A;  2Z5P A;  2VXX A;  3E1J A;  4TOA A;  2PYB A;  5E1U A;  5JKL G;  3IQ1 A;  1JGC A;  1JI4 A;  2UX1 A;  1SOF A;  4Y08 A;  3QD8 A;  3AJO A;  2RBD A;  1DPS A;  2GS4 A;  2HTN A;  3PVT A;  4LYX A;  4II4 A;  4XKU A;  4M33 A;  5K52 A;  2FKZ A;  2XJN A;  2ZA6 A;  2JD6 0;  3PZA A;  4RC7 B;  4MKU A;  3KA8 A;  1HRS A;  2XJM A;  2CIH A;  5JKL A;  2C41 A;  1OTK A;  3E6R A;  1TKP A;  3Q4N A;  2Z90 A;  2VZB A;  4XKT A;  4ZL6 A;  2WTL A;  3R2M A;  3AF8 X;  4ZJK A;  4AM5 A;  1VEI A;  4ISP A;  5D8X A;  2CHI A;  4RC5 B;  3OJ5 A;  4DAS A;  5HJH A;  2OC5 A;  1XZ1 A;  4TOG A;  4TOE A;  1F30 A;  5AXS A;  3R2R A;  2BKC A;  5GU0 X;  1JIG A;  3R2S A;  2Z5R A;  3ES3 A;  2XJO A;  3BVL A;  4PGK A;  1ZUJ A;  2W0O A;  3F35 A;  1LB3 A;  3E1P A;  3QVD A;  4A25 A;  2VXI A;  4ML5 A;  1RCE A;  4PG1 A;  2OH3 A;  4TOH A;  1O9I A;  5C6F A;  4U3G A;  3Q4O A;  2FHA A;  3BVE A;  4LQN A;  5GU1 X;  2WLA A;  1MOJ A;  1N1Q A;  4IXK A;  5D8Y A;  3O7R A;  2ITB A;  3F36 A;  5HJF A;  1QYB A;  3E1L A;  3PVT B;  4QUW A;  1YV1 A;  1EUM A;  4ZMC A;  4RC6 A;  1S30 A;  1YUX A;  3GHQ A;  1RCG A;  5CZU A;  1NNQ A;  4IWK A;  4TOD A;  3Q4R A;  2ZA7 A;  5FFB A;  1J30 A;  4ITW A;  2YJJ A;  4TOB A;  4CYB A;  2V2L A;  5LS9 A;  1VEL A;  1LKP A;  3BT5 A;  2V2P A;  3BVK A;  4TOF A;  4XKS A;  2C2F A;  4CMY V;  3NOZ X;  2XKQ A;  4MJY A;  1RYT A;  3RGD A;  5GU2 X;  5ERJ A;  1H96 A;  2XGW A;  3KA4 A;  2GYQ A;  5FFD A;  1JKV A;  3EZU A;  4LPN A;  4E6K A;  5LBH A;  4ZKX A;  2FZF A;  5GN8 A;  2GYD A;  5E2D A;  1BG7 A;  5D8S A;  1VEQ A;  4DYY A;  3NP2 X;  3GE4 A;  4ITT A;  5J8S A;  4YKH A;  1VJX A;  4ZLW A;  3AF9 X;  3FI6 A;  1QGH A;  2V2S A;  3R2K A;  3QHC A;  1IER A;  2V2I A;  2F7N A;  1TKO A;  4ZKH A;  1NF4 A;  2C6R A;  2CLB A;  2FG4 A;  1LKM A;  4EVD A;  3IS7 A;  4M32 A;  3OGH A;  3E6S A;  5D8P A;  4LYU A;  2V15 A;  4REU A;  1L8I A;  4RC8 A;  2FFX J;  1S3Q A;  3PVR B;  2Y3Q A;  2ZG9 X;  3RD0 A;  4KVR A;  3WVW A;  1FHA A;  2CN6 A;  2CN7 A;  4PGI A;  5D8O A;  3TA8 A;  3HL1 A;  3PW1 B;  3BVF A;  2IU2 A;  4DYZ A;  1IES A;  1UMN A;  3A9Q A;  4MN9 A;  4CY9 A;  1Z6O A;  4ETR A;  2JD7 0;  3EZ0 A;  4LPJ A;  4EVB A;  4AM2 A;  3BKN A;  5ERK A;  5GN8 B;  4II4 B;  3UNO A;  1YUZ A;  2C2J A;  3ERZ A;  4M34 A;  2ZG8 X;  1Z4A A;  2CF7 A;  3WVU A;  5CMQ A;  3QB9 A;  3RAV A;  4DYU A;  5J93 A;  1O9R A;  3PWF A;  4PG0 A;  1TK6 A;  5FFA A;  4Z3B A;  3E1O A;  3UOI A;  3SE1 A;  3E1Q A; 
#chains in the Genus database with same CATH topology
 4AM4 A;  4CYA A;  3KXU A;  3H7G A;  4LQV A;  4TW3 A;  5K53 A;  1SQ3 A;  3F34 A;  2Y44 A;  3GGZ A;  2BJY A;  5D8Q A;  1AEW A;  4OYN A;  2V2R A;  3KA9 A;  4CVT A;  4EVC A;  1Z6O M;  4ZKW A;  1NF6 A;  4LQH A;  3UFB A;  2X17 0;  4KVS A;  2FG8 A;  2D5K A;  3EGM A;  1JRE A;  5HQO A;  2V2O A;  1BCF A;  2Z5Q A;  2BW1 A;  1JTS A;  2V2N A;  3NP0 X;  4YXJ A;  2ZG7 X;  3KX9 A;  3AK9 A;  3SID A;  5J9V A;  3QHB A;  1JYB A;  2QF9 A;  4EVE A;  3N6O A;  3AJP A;  2Z6M A;  4MY7 A;  3KA3 A;  1NFV A;  4CMY A;  2JD8 0;  3HIU A;  4M35 A;  1ZS3 A;  3R2L A;  4ERU A;  4W4K B;  3E1M A;  5IX6 A;  3PWQ A;  2G4H A;  3AK8 A;  2ZA8 A;  3F33 A;  2V8U A;  4CVR A;  3SH6 A;  4RC6 B;  3U90 A;  3MPS A;  5I4J A;  1MFR A;  4LQJ A;  3UOF A;  1JKU A;  2YW6 A;  3PVY A;  2FL0 A;  4CVP A;  1BFR A;  4TOC A;  2V2J A;  3A68 A;  4TO9 A;  5FFC A;  1F33 A;  4ZTT A;  2YJK A;  3GVY A;  3V3K B;  2CHP A;  4YXM A;  1S2Z A;  3ISE A;  3Q4Q A;  3WVV A;  4ISM A;  4DZ0 A;  2IY4 A;  1LKO A;  2FJC A;  4IWJ A;  1B71 A;  3RE7 A;  4DI0 A;  1GWG A;  3KA6 A;  4Z5S A;  1RCC A;  4LPM A;  3RBC A;  1L8H A;  3F38 A;  3FRR A;  3PWQ C;  3E1N A;  4XGS A;  5FEJ A;  4YVZ A;  3BVI A;  5CMR A;  4DYX A;  3FVB A;  3PW8 A;  2V8T A;  5GU3 X;  2QQY A;  4R42 A;  3ISF A;  3IS8 A;  2IB0 A;  2CEI A;  5LG2 A;  4RC7 A;  3R2O A;  1VLG A;  1TJO A;  2BK6 A;  3QZ3 A;  3T9J A;  3KWO A;  1DVB A;  1DAT A;  1R03 A;  2AR0 A;  3KDQ A;  4ZL5 A;  5D8R A;  5LG8 A;  3R2H A;  3F37 A;  3AF7 X;  3PVY B;  4RC5 A;  1RCI A;  2V2M A;  2HR5 A;  4KVQ A;  3M6J A;  5JKM G;  3AJQ A;  1RCD A;  3F32 A;  5J8W A;  2WLU A;  3FSE A;  4MUD A;  3C1Z A;  4CVS A;  4P18 A;  3VNX A;  5JAC A;  3PW8 C;  2CLU A;  1KRQ A;  5FFE A;  2YW7 A;  3PVR A;  2C2U A;  4DE6 A;  3WNW A;  3E2C A;  1XZ3 A;  3F39 A;  1JI5 A;  1UVH A;  5GOU A;  3SHX A;  3O7S A;  3DBY A;  2ZUR X;  5JKM A;  3PW1 A;  2Z5P A;  2CWL A;  2VXX A;  3E1J A;  4TOA A;  2PYB A;  5E1U A;  3L0M A;  5JKL G;  3IQ1 A;  1JGC A;  1JI4 A;  2UX1 A;  1SOF A;  2OKC A;  4Y08 A;  3QD8 A;  3AJO A;  2RBD A;  1DPS A;  2GS4 A;  2HTN A;  3PVT A;  4LYX A;  4II4 A;  4XKU A;  4M33 A;  5K52 A;  2FKZ A;  2XJN A;  2N02 A;  2ZA6 A;  2JD6 0;  3PZA A;  4RC7 B;  4MKU A;  3KA8 A;  1HRS A;  2XJM A;  2CIH A;  5JKL A;  2C41 A;  1OTK A;  3E6R A;  1TKP A;  3C23 A;  2Z90 A;  3Q4N A;  2VZB A;  4XKT A;  4ZL6 A;  2WTL A;  3R2M A;  3AF8 X;  4ZJK A;  4AM5 A;  1VEI A;  4ISP A;  5D8X A;  2CHI A;  4RC5 B;  3FRS A;  3OJ5 A;  3GGY A;  4DAS A;  5HJH A;  2OC5 A;  1XZ1 A;  4TOG A;  4TOE A;  1F30 A;  5AXS A;  3R2R A;  2BKC A;  5GU0 X;  1JIG A;  3R2S A;  2Z5R A;  3ES3 A;  2XJO A;  3BVL A;  4PGK A;  1ZUJ A;  2W0O A;  3F35 A;  1LB3 A;  3E1P A;  2MGY A;  3QVD A;  4X0J A;  4A25 A;  2VXI A;  4ML5 A;  1RCE A;  3VV9 A;  4PG1 A;  2OH3 A;  4TOH A;  1O9I A;  5C6F A;  4U3G A;  3W54 A;  3Q4O A;  5JDO A;  2FHA A;  3BVE A;  3JZ9 A;  5GU1 X;  4LQN A;  2WLA A;  1MOJ A;  1N1Q A;  4IXK A;  5D8Y A;  3O7R A;  2ITB A;  3F36 A;  5HJF A;  1QYB A;  3E1L A;  3PVT B;  4QUW A;  1YV1 A;  1EUM A;  4ZMC A;  4RC6 A;  1S30 A;  1YUX A;  3GHQ A;  1RCG A;  5CZU A;  1NNQ A;  4IWK A;  4TOD A;  3Q4R A;  2ZA7 A;  5FFB A;  1J30 A;  4ITW A;  2YJJ A;  4TOB A;  4CYB A;  2V2L A;  5LS9 A;  1VEL A;  2WWX B;  1LKP A;  3LKD A;  3BT5 A;  3JZA B;  2V2P A;  3BVK A;  4TOF A;  4XKS A;  2C2F A;  4CMY V;  3NOZ X;  2XKQ A;  4MJY A;  1RYT A;  4W4L B;  3RGD A;  5GU2 X;  5ERJ A;  1H96 A;  2XGW A;  3KA4 A;  2GYQ A;  5FFD A;  1JKV A;  3EZU A;  4LPN A;  4E6K A;  5LBH A;  4ZKX A;  2FZF A;  5GN8 A;  2GYD A;  5E2D A;  1BG7 A;  5D8S A;  1VEQ A;  4DYY A;  3NP2 X;  3GE4 A;  4ITT A;  5JDO B;  5J8S A;  4YKH A;  1VJX A;  4ZLW A;  3AF9 X;  3FI6 A;  1QGH A;  2V2S A;  3R2K A;  3QHC A;  1IER A;  2V2I A;  2F7N A;  1TKO A;  4ZKH A;  1NF4 A;  2C6R A;  2CLB A;  2FG4 A;  1LKM A;  2G38 B;  4EVD A;  3IS7 A;  4M32 A;  3OGH A;  3E6S A;  5D8P A;  4LYU A;  2V15 A;  4REU A;  1L8I A;  4RC8 A;  2FFX J;  3C1Y A;  1S3Q A;  3PVR B;  2Y3Q A;  2ZG9 X;  3RD0 A;  4KVR A;  3WVW A;  1FHA A;  2CN6 A;  4MXP A;  2CN7 A;  4PGI A;  5D8O A;  3TA8 A;  3HL1 A;  3PW1 B;  3BVF A;  2IU2 A;  4DYZ A;  1IES A;  1UMN A;  3A9Q A;  4MN9 A;  4CY9 A;  3D19 A;  4KXR B;  3C21 A;  1Z6O A;  4ETR A;  2JD7 0;  3EZ0 A;  4LPJ A;  4EVB A;  4AM2 A;  3BKN A;  4E40 A;  5ERK A;  5GN8 B;  4II4 B;  3UNO A;  1YUZ A;  2C2J A;  3VVA A;  3ERZ A;  4M34 A;  2ZG8 X;  1Z4A A;  2CF7 A;  3WVU A;  5HU6 D;  5CMQ A;  3QB9 A;  3RAV A;  4DYU A;  5J93 A;  1O9R A;  3KHK A;  3PWF A;  4PG0 A;  1TK6 A;  5FFA A;  4WJG 4;  4Z3B A;  3E1O A;  3UOI A;  3SE1 A;  3E1Q A; 
#chains in the Genus database with same CATH homology
 4AM4 A;  4CYA A;  3KXU A;  3H7G A;  4LQV A;  4TW3 A;  5K53 A;  1SQ3 A;  3F34 A;  2Y44 A;  3GGZ A;  2BJY A;  5D8Q A;  1AEW A;  4OYN A;  2V2R A;  3KA9 A;  4CVT A;  4EVC A;  1Z6O M;  4ZKW A;  1NF6 A;  4LQH A;  3UFB A;  2X17 0;  4KVS A;  2FG8 A;  2D5K A;  3EGM A;  1JRE A;  5HQO A;  2V2O A;  1BCF A;  2Z5Q A;  2BW1 A;  1JTS A;  2V2N A;  3NP0 X;  4YXJ A;  2ZG7 X;  3KX9 A;  3AK9 A;  3SID A;  5J9V A;  3QHB A;  1JYB A;  2QF9 A;  4EVE A;  3N6O A;  3AJP A;  2Z6M A;  4MY7 A;  3KA3 A;  1NFV A;  4CMY A;  2JD8 0;  3HIU A;  4M35 A;  1ZS3 A;  3R2L A;  4ERU A;  4W4K B;  3E1M A;  5IX6 A;  3PWQ A;  2G4H A;  3AK8 A;  2ZA8 A;  3F33 A;  2V8U A;  4CVR A;  3SH6 A;  4RC6 B;  3U90 A;  3MPS A;  5I4J A;  1MFR A;  4LQJ A;  3UOF A;  1JKU A;  2YW6 A;  3PVY A;  2FL0 A;  4CVP A;  1BFR A;  4TOC A;  2V2J A;  3A68 A;  4TO9 A;  5FFC A;  1F33 A;  4ZTT A;  2YJK A;  3GVY A;  3V3K B;  2CHP A;  4YXM A;  1S2Z A;  3ISE A;  3Q4Q A;  3WVV A;  4ISM A;  4DZ0 A;  2IY4 A;  1LKO A;  2FJC A;  4IWJ A;  1B71 A;  3RE7 A;  4DI0 A;  1GWG A;  3KA6 A;  4Z5S A;  1RCC A;  4LPM A;  3RBC A;  1L8H A;  3F38 A;  3FRR A;  3PWQ C;  3E1N A;  4XGS A;  5FEJ A;  4YVZ A;  3BVI A;  5CMR A;  4DYX A;  3FVB A;  3PW8 A;  2V8T A;  5GU3 X;  2QQY A;  4R42 A;  3ISF A;  3IS8 A;  2IB0 A;  2CEI A;  5LG2 A;  4RC7 A;  3R2O A;  1VLG A;  1TJO A;  2BK6 A;  3QZ3 A;  3T9J A;  3KWO A;  1DVB A;  1DAT A;  1R03 A;  2AR0 A;  3KDQ A;  4ZL5 A;  5D8R A;  5LG8 A;  3R2H A;  3F37 A;  3AF7 X;  3PVY B;  4RC5 A;  1RCI A;  2V2M A;  2HR5 A;  4KVQ A;  3M6J A;  5JKM G;  3AJQ A;  1RCD A;  3F32 A;  5J8W A;  2WLU A;  3FSE A;  4MUD A;  3C1Z A;  4CVS A;  4P18 A;  3VNX A;  5JAC A;  3PW8 C;  2CLU A;  1KRQ A;  5FFE A;  2YW7 A;  3PVR A;  2C2U A;  4DE6 A;  3WNW A;  3E2C A;  1XZ3 A;  3F39 A;  1JI5 A;  1UVH A;  5GOU A;  3SHX A;  3O7S A;  3DBY A;  2ZUR X;  5JKM A;  3PW1 A;  2Z5P A;  2CWL A;  2VXX A;  3E1J A;  4TOA A;  2PYB A;  5E1U A;  3L0M A;  5JKL G;  3IQ1 A;  1JGC A;  1JI4 A;  2UX1 A;  1SOF A;  2OKC A;  4Y08 A;  3QD8 A;  3AJO A;  2RBD A;  1DPS A;  2GS4 A;  2HTN A;  3PVT A;  4LYX A;  4II4 A;  4XKU A;  4M33 A;  5K52 A;  2FKZ A;  2XJN A;  2N02 A;  2ZA6 A;  2JD6 0;  3PZA A;  4RC7 B;  4MKU A;  3KA8 A;  1HRS A;  2XJM A;  2CIH A;  5JKL A;  2C41 A;  1OTK A;  3E6R A;  1TKP A;  3C23 A;  2Z90 A;  3Q4N A;  2VZB A;  4XKT A;  4ZL6 A;  2WTL A;  3R2M A;  3AF8 X;  4ZJK A;  4AM5 A;  1VEI A;  4ISP A;  5D8X A;  2CHI A;  4RC5 B;  3FRS A;  3OJ5 A;  3GGY A;  4DAS A;  5HJH A;  2OC5 A;  1XZ1 A;  4TOG A;  4TOE A;  1F30 A;  5AXS A;  3R2R A;  2BKC A;  5GU0 X;  1JIG A;  3R2S A;  2Z5R A;  3ES3 A;  2XJO A;  3BVL A;  4PGK A;  1ZUJ A;  2W0O A;  3F35 A;  1LB3 A;  3E1P A;  2MGY A;  3QVD A;  4X0J A;  4A25 A;  2VXI A;  4ML5 A;  1RCE A;  3VV9 A;  4PG1 A;  2OH3 A;  4TOH A;  1O9I A;  5C6F A;  4U3G A;  3W54 A;  3Q4O A;  5JDO A;  2FHA A;  3BVE A;  3JZ9 A;  5GU1 X;  4LQN A;  2WLA A;  1MOJ A;  1N1Q A;  4IXK A;  5D8Y A;  3O7R A;  2ITB A;  3F36 A;  5HJF A;  1QYB A;  3E1L A;  3PVT B;  4QUW A;  1YV1 A;  1EUM A;  4ZMC A;  4RC6 A;  1S30 A;  1YUX A;  3GHQ A;  1RCG A;  5CZU A;  1NNQ A;  4IWK A;  4TOD A;  3Q4R A;  2ZA7 A;  5FFB A;  1J30 A;  4ITW A;  2YJJ A;  4TOB A;  4CYB A;  2V2L A;  5LS9 A;  1VEL A;  2WWX B;  1LKP A;  3LKD A;  3BT5 A;  3JZA B;  2V2P A;  3BVK A;  4TOF A;  4XKS A;  2C2F A;  4CMY V;  3NOZ X;  2XKQ A;  4MJY A;  1RYT A;  4W4L B;  3RGD A;  5GU2 X;  5ERJ A;  1H96 A;  2XGW A;  3KA4 A;  2GYQ A;  5FFD A;  1JKV A;  3EZU A;  4LPN A;  4E6K A;  5LBH A;  4ZKX A;  2FZF A;  5GN8 A;  2GYD A;  5E2D A;  1BG7 A;  5D8S A;  1VEQ A;  4DYY A;  3NP2 X;  3GE4 A;  4ITT A;  5JDO B;  5J8S A;  4YKH A;  1VJX A;  4ZLW A;  3AF9 X;  3FI6 A;  1QGH A;  2V2S A;  3R2K A;  3QHC A;  1IER A;  2V2I A;  2F7N A;  1TKO A;  4ZKH A;  1NF4 A;  2C6R A;  2CLB A;  2FG4 A;  1LKM A;  2G38 B;  4EVD A;  3IS7 A;  4M32 A;  3OGH A;  3E6S A;  5D8P A;  4LYU A;  2V15 A;  4REU A;  1L8I A;  4RC8 A;  2FFX J;  3C1Y A;  1S3Q A;  3PVR B;  2Y3Q A;  2ZG9 X;  3RD0 A;  4KVR A;  3WVW A;  1FHA A;  2CN6 A;  4MXP A;  2CN7 A;  4PGI A;  5D8O A;  3TA8 A;  3HL1 A;  3PW1 B;  3BVF A;  2IU2 A;  4DYZ A;  1IES A;  1UMN A;  3A9Q A;  4MN9 A;  4CY9 A;  3D19 A;  4KXR B;  3C21 A;  1Z6O A;  4ETR A;  2JD7 0;  3EZ0 A;  4LPJ A;  4EVB A;  4AM2 A;  3BKN A;  4E40 A;  5ERK A;  5GN8 B;  4II4 B;  3UNO A;  1YUZ A;  2C2J A;  3VVA A;  3ERZ A;  4M34 A;  2ZG8 X;  1Z4A A;  2CF7 A;  3WVU A;  5HU6 D;  5CMQ A;  3QB9 A;  3RAV A;  4DYU A;  5J93 A;  1O9R A;  3KHK A;  3PWF A;  4PG0 A;  1TK6 A;  5FFA A;  4WJG 4;  4Z3B A;  3E1O A;  3UOI A;  3SE1 A;  3E1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...