2QF9A

Crystal structure of putative secreted protein duf305 from streptomyces coelicolor
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
172
structure length
162
Chain Sequence
AADSADAGFARDMSVHHQQAVEMSYIVRDRTDDEEVRRLAYDIAQTQANQRGMMIGWLDLWALPKVSSDPPMTWMGMGMPGMATDAEMKKLGTLDGKQAEVYYLQLMTEHHRGGVHMAKGCVERCTVGVEKRLARGMVESQESEIRLMADLLAERGAKEGHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative secreted protein
publication title Structure of putative secreted protein DUF305 from Streptomyces coelicolor.
rcsb
source organism Streptomyces coelicolor a3(2)
molecule tags Structural genomics, unknown function
total genus 55
structure length 162
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03713 DUF305 Domain of unknown function (DUF305)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2qf9A01
4YKHA 5LBHA 3PZAA 3Q4OA 1KRQA 4ITWA 4LPJA 2V2RA 3R2LA 2Z6MA 4RC7B 3PVYA 4LYUA 2V2PA 1GWGA 2F7NA 3Q4RA 5J8SA 2FL0A 1IERA 4ZKHA 1AEWA 3E6SA 3KXUA 1UVHA 3E1OA 4DI0A 1MFRA 4PG1A 4DASA 3SH6A 3NOZX 1S3QA 1JYBA 4EVBA 1JGCA 1VEIA 4RC7A 3AJOA 3ISEA 3Q4QA 4TOCA 5JACA 1QYBA 2CHPA 5J93A 3RD0A 5JKLA 2GS4A 1O9IA 3ERZA 3F39A 4LQNA 4M33A 3F33A 2CHIA 5HJHA 2QQYA 4M35A 1R03A 3AF7X 2HTNA 5GOUA 4AM2A 1RYTA 3F36A 4PGKA 5GU3X 3QB9A 3QD8A 3AK9A 4ZMCA 2FFXJ 1OTKA 2ZA8A 3VNXA 1TKPA 2GYQA 5LG2A 1S2ZA 2BJYA 2XJMA 1LKPA 2CLUA 5JKMG 1TK6A 1L8HA 3QHCA 3GHQA 5HJFA 2Y3QA 4ZL5A 3SIDA 5IX6A 1ZS3A 3AJQA 3ES3A 3EZ0A 2FJCA 3PWFA 2FG4A 3NP0X 2YW7A 2V2NA 4LPMA 3BVFA 1Z4AA 2CN6A 3F32A 2W0OA 3QZ3A 3A9QA 3AJPA 1VJXA 2XKQA 4ZTTA 5FFDA 4TODA 4MY7A 3PW8A 4TOHA 4CMYA 2Z5PA 4LQJA 5CZUA 3O7RA 4TO9A 2WLAA 3BVKA 3E1NA 5GU0X 2JD80 2V15A 2RBDA 1RCEA 1EUMA 1ZUJA 1QGHA 2ZURX 1F30A 4ERUA 4XKSA 4DYZA 2Z5QA 3UOIA 5GN8B 4RC5A 3SHXA 2CLBA 3E1QA 5J9VA 1YUXA 4EVDA 3KA4A 2GYDA 4TOBA 5K52A 1JKUA 4ISMA 2V2OA 4CYAA 1BFRA 1RCGA 2IY4A 2C2FA 1HRSA 5GU1X 5E2DA 5GN8A 3QVDA 1DATA 4TOGA 2JD70 1F33A 4Z5SA 3BKNA 2ZG9X 4ZJKA 4PG0A 3HL1A 3H7GA 4AM5A 3UOFA 3PW1A 3NP2X 1B71A 3FSEA 2JD60 1NNQA 1S30A 2XGWA 3RBCA 5D8SA 3UNOA 2V2LA 3KA6A 3BVIA 2OH3A 2FZFA 3KX9A 5JKMA 4CMYV 3OJ5A 1NF6A 3F34A 4ZKWA 2HR5A 3PWQA 1SQ3A 2YW6A 3KA9A 3PVTA 3RGDA 4RC6B 5FEJA 3QHBA 3IQ1A 3KA8A 4LYXA 5CMRA 1XZ3A 1BCFA 3PVRA 3R2RA 4Y08A 1DPSA 4KVRA 1Z6OM 4II4B 2FHAA 1VELA 3R2KA 1VLGA 2QF9A 4P18A 4M34A 1UMNA 5D8OA 5LG8A 2UX1A 3E1MA 1YUZA 4ISPA 5J8WA 4RC6A 3BVEA 2ZG7X 4DYXA 2XJNA 1LKMA 4TOAA 4TW3A 3WVWA 3SE1A 4EVCA 4CVTA 5LS9A 4TOEA 1IESA 4MJYA 2VXXA 2CEIA 4RC5B 4II4A 4CVRA 3R2HA 5FFAA 5C6FA 2G4HA 1VEQA 3F35A 5AXSA 5ERKA 3RAVA 3KA3A 4EVEA 4CVPA 2IU2A 4XGSA 1JI5A 2XJOA 4CVSA 4ITTA 4ZL6A 3PWQC 1L8IA 4QUWA 1BG7A 5FFEA 4XKTA 5GU2X 1JI4A 3A68A 3PW1B 4Z3BA 2IB0A 3E1PA 1NFVA 5ERJA 3OGHA 5D8XA 3E2CA 3ISFA 4M32A 4KVQA 4IWJA 2ZA6A 1XZ1A 4A25A 2CIHA 4CYBA 2Z5RA 1RCDA 3F37A 3WNWA 4LQHA 4R42A 1RCIA 3BVLA 2V2JA 2CF7A 3TA8A 3FVBA 1N1QA 1TKOA 3EZUA 4RC8A 3PW8C 3FI6A 4ML5A 4DYUA 2VXIA 2ZG8X 4MN9A 4DE6A 5I4JA 4IXKA 5FFCA 3PVTB 4DZ0A 3AF8X 3R2OA 5D8RA 4E6KA 4OYNA 1RCCA 3HIUA 1MOJA 1JREA 3PVRB 3RE7A 4TOFA 2Z90A 2YJKA 2V2MA 2ITBA 4REUA 2FKZA 1SOFA 3R2MA 3Q4NA 1JTSA 4IWKA 4U3GA 3R2SA 4LQVA 3U90A 4PGIA 5JKLG 5CMQA 2FG8A 4ETRA 1YV1A 3KWOA 4LPNA 2WLUA 2BK6A 2C6RA 1JKVA 3IS8A 5D8YA 1FHAA 3T9JA 3IS7A 4KVSA 2C41A 3E6RA 4AM4A 2ZA7A 3WVUA 5D8PA 2PYBA 1LB3A 3E1LA 2YJJA 3E1JA 1O9RA 1Z6OA 1DVBA 1LKOA 2CN7A 4MKUA 4DYYA 2X170 2V2IA 4XKUA 1TJOA 2C2JA 2V2SA 5D8QA 3EGMA 4CY9A 5K53A 2BKCA 3AK8A 4ZKXA 1J30A 2D5KA 3WVVA 2VZBA 3GVYA 3MPSA 4ZLWA 3GE4A 3AF9X 4MUDA 2BW1A 3O7SA 3PVYB 2C2UA 5E1UA 1NF4A 2OC5A 1H96A 3F38A 2WTLA 5HQOA 1JIGA 5FFBA 3BT5A
chains in the Genus database with same CATH superfamily
4YKHA 5LBHA 3PZAA 3Q4OA 1KRQA 4ITWA 4W4KB 4LPJA 2V2RA 5JDOA 3R2LA 2Z6MA 4RC7B 3PVYA 4LYUA 2V2PA 1GWGA 2F7NA 3Q4RA 5J8SA 2FL0A 1IERA 4ZKHA 1AEWA 3VV9A 3E6SA 3KXUA 1UVHA 3E1OA 4DI0A 1MFRA 4PG1A 4DASA 3SH6A 3NOZX 1S3QA 3C1YA 1JYBA 4EVBA 1JGCA 1VEIA 4RC7A 3AJOA 3ISEA 3Q4QA 4TOCA 5JACA 4YXJA 1QYBA 2CHPA 5J93A 3RD0A 2CWLA 5JKLA 2GS4A 1O9IA 3ERZA 3F39A 4LQNA 4M33A 3F33A 2CHIA 5HJHA 2QQYA 4M35A 1R03A 3AF7X 2HTNA 4X0JA 5GOUA 4AM2A 1RYTA 3F36A 4PGKA 5GU3X 3QB9A 3QD8A 3AK9A 4ZMCA 2FFXJ 3FRRA 1OTKA 2ZA8A 3JZ9A 1TKPA 3VNXA 2GYQA 5LG2A 1S2ZA 2BJYA 2XJMA 1LKPA 2CLUA 5JKMG 1TK6A 1L8HA 3QHCA 3GHQA 5HJFA 2Y3QA 4ZL5A 3SIDA 5IX6A 1ZS3A 3AJQA 4KXRB 3ES3A 3EZ0A 2FJCA 3PWFA 4WJG4 2FG4A 3NP0X 2YW7A 2V2NA 4LPMA 3BVFA 1Z4AA 2CN6A 3F32A 2W0OA 3QZ3A 3A9QA 3AJPA 1VJXA 2XKQA 4ZTTA 5FFDA 4TODA 4MY7A 3PW8A 4TOHA 4CMYA 2Z5PA 4LQJA 5CZUA 3O7RA 4TO9A 2WLAA 3BVKA 3C21A 3E1NA 5GU0X 2JD80 2V15A 2RBDA 1RCEA 5JDOB 1EUMA 1ZUJA 1QGHA 2ZURX 1F30A 4ERUA 4XKSA 4DYZA 2Z5QA 3UOIA 5GN8B 4RC5A 3SHXA 2CLBA 3E1QA 5J9VA 1YUXA 4EVDA 3KA4A 2GYDA 4TOBA 5K52A 1JKUA 4ISMA 2V2OA 4CYAA 1BFRA 1RCGA 2IY4A 2C2FA 1HRSA 4MXPA 5GU1X 5E2DA 5GN8A 3QVDA 1DATA 4TOGA 3LKDA 2JD70 1F33A 4Z5SA 3BKNA 2ZG9X 4ZJKA 2V8UA 4PG0A 3HL1A 3H7GA 4AM5A 3UOFA 3PW1A 3NP2X 2AR0A 1B71A 3FSEA 2JD60 1NNQA 1S30A 2XGWA 3RBCA 5D8SA 3UNOA 2V2LA 3KA6A 3BVIA 2G38B 2OH3A 2FZFA 3KX9A 5JKMA 4CMYV 3OJ5A 1NF6A 3F34A 4ZKWA 2HR5A 3L0MA 3PWQA 1SQ3A 2YW6A 3KA9A 3JZAB 3PVTA 3RGDA 4RC6B 5FEJA 3QHBA 4YVZA 3IQ1A 3KA8A 4LYXA 5CMRA 1XZ3A 1BCFA 3PVRA 3R2RA 4Y08A 1DPSA 5HU6D 4KVRA 1Z6OM 4II4B 2FHAA 1VELA 3R2KA 1VLGA 2QF9A 4P18A 4M34A 1UMNA 5D8OA 5LG8A 2UX1A 3E1MA 1YUZA 4ISPA 5J8WA 4RC6A 3BVEA 2ZG7X 4DYXA 2XJNA 1LKMA 4TOAA 4TW3A 3WVWA 3SE1A 4EVCA 4CVTA 5LS9A 4TOEA 1IESA 4MJYA 2VXXA 2CEIA 4RC5B 4II4A 4CVRA 3R2HA 3UFBA 5FFAA 5C6FA 2G4HA 1VEQA 3F35A 5AXSA 4YXMA 5ERKA 4W4LB 3RAVA 3KA3A 4EVEA 4CVPA 2IU2A 4XGSA 1JI5A 2XJOA 4CVSA 4ITTA 4ZL6A 3PWQC 1L8IA 4QUWA 1BG7A 5FFEA 3VVAA 4XKTA 5GU2X 1JI4A 3A68A 3PW1B 4Z3BA 2IB0A 3V3KB 3E1PA 3W54A 1NFVA 5ERJA 3OGHA 5D8XA 3E2CA 3ISFA 4M32A 3D19A 4KVQA 4IWJA 2ZA6A 1XZ1A 4E40A 4A25A 2CIHA 4CYBA 2Z5RA 1RCDA 2MGYA 3F37A 3WNWA 4LQHA 4R42A 2V8TA 1RCIA 3BVLA 2V2JA 2CF7A 3TA8A 3FRSA 3FVBA 1N1QA 1TKOA 3GGZA 3EZUA 4RC8A 3PW8C 3FI6A 4ML5A 4DYUA 2VXIA 2ZG8X 4MN9A 4DE6A 5I4JA 4IXKA 5FFCA 3PVTB 4DZ0A 3AF8X 3R2OA 5D8RA 4E6KA 4OYNA 1RCCA 3HIUA 1MOJA 1JREA 3PVRB 3RE7A 4TOFA 2Z90A 2YJKA 2V2MA 3DBYA 2ITBA 4REUA 3C1ZA 2FKZA 1SOFA 3R2MA 3Q4NA 1JTSA 4IWKA 4U3GA 3R2SA 2WWXB 4LQVA 3U90A 2N02A 4PGIA 5JKLG 3KDQA 5CMQA 2FG8A 4ETRA 1YV1A 3KWOA 3N6OA 2OKCA 4LPNA 2WLUA 2BK6A 2C6RA 1JKVA 3IS8A 5D8YA 1FHAA 3T9JA 3IS7A 4KVSA 2C41A 3E6RA 4AM4A 2ZA7A 3WVUA 5D8PA 2PYBA 1LB3A 3E1LA 2YJJA 3E1JA 1O9RA 1Z6OA 1DVBA 1LKOA 3C23A 2CN7A 4MKUA 4DYYA 2X170 3KHKA 2V2IA 4XKUA 1TJOA 2C2JA 2V2SA 5D8QA 3EGMA 4CY9A 5K53A 2BKCA 3AK8A 4ZKXA 1J30A 2D5KA 3WVVA 2Y44A 2VZBA 3M6JA 3GVYA 3MPSA 4ZLWA 3GE4A 3AF9X 3GGYA 4MUDA 2BW1A 3O7SA 3PVYB 2C2UA 5E1UA 1NF4A 2OC5A 1H96A 3F38A 2WTLA 5HQOA 1JIGA 5FFBA 3BT5A
chains in the Genus database with same CATH topology
4YKHA 5LBHA 3PZAA 3Q4OA 1KRQA 4ITWA 4W4KB 4LPJA 2V2RA 5JDOA 3R2LA 2Z6MA 4RC7B 3PVYA 4LYUA 2V2PA 1GWGA 2F7NA 3Q4RA 5J8SA 2FL0A 1IERA 4ZKHA 1AEWA 3VV9A 3E6SA 3KXUA 1UVHA 3E1OA 4DI0A 1MFRA 4PG1A 4DASA 3SH6A 3NOZX 1S3QA 3C1YA 1JYBA 4EVBA 1JGCA 1VEIA 4RC7A 3AJOA 3ISEA 3Q4QA 4TOCA 5JACA 4YXJA 1QYBA 2CHPA 5J93A 3RD0A 2CWLA 5JKLA 2GS4A 1O9IA 3ERZA 3F39A 4LQNA 4M33A 3F33A 2CHIA 5HJHA 2QQYA 4M35A 1R03A 3AF7X 2HTNA 4X0JA 5GOUA 4AM2A 1RYTA 3F36A 4PGKA 5GU3X 3QB9A 3QD8A 3AK9A 4ZMCA 2FFXJ 3FRRA 1OTKA 2ZA8A 3JZ9A 1TKPA 3VNXA 2GYQA 5LG2A 1S2ZA 2BJYA 2XJMA 1LKPA 2CLUA 5JKMG 1TK6A 1L8HA 3QHCA 3GHQA 5HJFA 2Y3QA 4ZL5A 3SIDA 5IX6A 1ZS3A 3AJQA 4KXRB 3ES3A 3EZ0A 2FJCA 3PWFA 4WJG4 2FG4A 3NP0X 2YW7A 2V2NA 4LPMA 3BVFA 1Z4AA 2CN6A 3F32A 2W0OA 3QZ3A 3A9QA 3AJPA 1VJXA 2XKQA 4ZTTA 5FFDA 4TODA 4MY7A 3PW8A 4TOHA 4CMYA 2Z5PA 4LQJA 5CZUA 3O7RA 4TO9A 2WLAA 3BVKA 3C21A 3E1NA 5GU0X 2JD80 2V15A 2RBDA 1RCEA 5JDOB 1EUMA 1ZUJA 1QGHA 2ZURX 1F30A 4ERUA 4XKSA 4DYZA 2Z5QA 3UOIA 5GN8B 4RC5A 3SHXA 2CLBA 3E1QA 5J9VA 1YUXA 4EVDA 3KA4A 2GYDA 4TOBA 5K52A 1JKUA 4ISMA 2V2OA 4CYAA 1BFRA 1RCGA 2IY4A 2C2FA 1HRSA 4MXPA 5GU1X 5E2DA 5GN8A 3QVDA 1DATA 4TOGA 3LKDA 2JD70 1F33A 4Z5SA 3BKNA 2ZG9X 4ZJKA 2V8UA 4PG0A 3HL1A 3H7GA 4AM5A 3UOFA 3PW1A 3NP2X 2AR0A 1B71A 3FSEA 2JD60 1NNQA 1S30A 2XGWA 3RBCA 5D8SA 3UNOA 2V2LA 3KA6A 3BVIA 2G38B 2OH3A 2FZFA 3KX9A 5JKMA 4CMYV 3OJ5A 1NF6A 3F34A 4ZKWA 2HR5A 3L0MA 3PWQA 1SQ3A 2YW6A 3KA9A 3JZAB 3PVTA 3RGDA 4RC6B 5FEJA 3QHBA 4YVZA 3IQ1A 3KA8A 4LYXA 5CMRA 1XZ3A 1BCFA 3PVRA 3R2RA 4Y08A 1DPSA 5HU6D 4KVRA 1Z6OM 4II4B 2FHAA 1VELA 3R2KA 1VLGA 2QF9A 4P18A 4M34A 1UMNA 5D8OA 5LG8A 2UX1A 3E1MA 1YUZA 4ISPA 5J8WA 4RC6A 3BVEA 2ZG7X 4DYXA 2XJNA 1LKMA 4TOAA 4TW3A 3WVWA 3SE1A 4EVCA 4CVTA 5LS9A 4TOEA 1IESA 4MJYA 2VXXA 2CEIA 4RC5B 4II4A 4CVRA 3R2HA 3UFBA 5FFAA 5C6FA 2G4HA 1VEQA 3F35A 5AXSA 4YXMA 5ERKA 4W4LB 3RAVA 3KA3A 4EVEA 4CVPA 2IU2A 4XGSA 1JI5A 2XJOA 4CVSA 4ITTA 4ZL6A 3PWQC 1L8IA 4QUWA 1BG7A 5FFEA 3VVAA 4XKTA 5GU2X 1JI4A 3A68A 3PW1B 4Z3BA 2IB0A 3V3KB 3E1PA 3W54A 1NFVA 5ERJA 3OGHA 5D8XA 3E2CA 3ISFA 4M32A 3D19A 4KVQA 4IWJA 2ZA6A 1XZ1A 4E40A 4A25A 2CIHA 4CYBA 2Z5RA 1RCDA 2MGYA 3F37A 3WNWA 4LQHA 4R42A 2V8TA 1RCIA 3BVLA 2V2JA 2CF7A 3TA8A 3FRSA 3FVBA 1N1QA 1TKOA 3GGZA 3EZUA 4RC8A 3PW8C 3FI6A 4ML5A 4DYUA 2VXIA 2ZG8X 4MN9A 4DE6A 5I4JA 4IXKA 5FFCA 3PVTB 4DZ0A 3AF8X 3R2OA 5D8RA 4E6KA 4OYNA 1RCCA 3HIUA 1MOJA 1JREA 3PVRB 3RE7A 4TOFA 2Z90A 2YJKA 2V2MA 3DBYA 2ITBA 4REUA 3C1ZA 2FKZA 1SOFA 3R2MA 3Q4NA 1JTSA 4IWKA 4U3GA 3R2SA 2WWXB 4LQVA 3U90A 2N02A 4PGIA 5JKLG 3KDQA 5CMQA 2FG8A 4ETRA 1YV1A 3KWOA 3N6OA 2OKCA 4LPNA 2WLUA 2BK6A 2C6RA 1JKVA 3IS8A 5D8YA 1FHAA 3T9JA 3IS7A 4KVSA 2C41A 3E6RA 4AM4A 2ZA7A 3WVUA 5D8PA 2PYBA 1LB3A 3E1LA 2YJJA 3E1JA 1O9RA 1Z6OA 1DVBA 1LKOA 3C23A 2CN7A 4MKUA 4DYYA 2X170 3KHKA 2V2IA 4XKUA 1TJOA 2C2JA 2V2SA 5D8QA 3EGMA 4CY9A 5K53A 2BKCA 3AK8A 4ZKXA 1J30A 2D5KA 3WVVA 2Y44A 2VZBA 3M6JA 3GVYA 3MPSA 4ZLWA 3GE4A 3AF9X 3GGYA 4MUDA 2BW1A 3O7SA 3PVYB 2C2UA 5E1UA 1NF4A 2OC5A 1H96A 3F38A 2WTLA 5HQOA 1JIGA 5FFBA 3BT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YKH A;  5LBH A;  3PZA A;  3Q4O A;  1KRQ A;  4ITW A;  4LPJ A;  2V2R A;  3R2L A;  2Z6M A;  4RC7 B;  3PVY A;  4LYU A;  2V2P A;  1GWG A;  2F7N A;  3Q4R A;  5J8S A;  2FL0 A;  1IER A;  4ZKH A;  1AEW A;  3E6S A;  3KXU A;  1UVH A;  3E1O A;  4DI0 A;  1MFR A;  4PG1 A;  4DAS A;  3SH6 A;  3NOZ X;  1S3Q A;  1JYB A;  4EVB A;  1JGC A;  1VEI A;  4RC7 A;  3AJO A;  3ISE A;  3Q4Q A;  4TOC A;  5JAC A;  1QYB A;  2CHP A;  5J93 A;  3RD0 A;  5JKL A;  2GS4 A;  1O9I A;  3ERZ A;  3F39 A;  4LQN A;  4M33 A;  3F33 A;  2CHI A;  5HJH A;  2QQY A;  4M35 A;  1R03 A;  3AF7 X;  2HTN A;  5GOU A;  4AM2 A;  1RYT A;  3F36 A;  4PGK A;  5GU3 X;  3QB9 A;  3QD8 A;  3AK9 A;  4ZMC A;  2FFX J;  1OTK A;  2ZA8 A;  3VNX A;  1TKP A;  2GYQ A;  5LG2 A;  1S2Z A;  2BJY A;  2XJM A;  1LKP A;  2CLU A;  5JKM G;  1TK6 A;  1L8H A;  3QHC A;  3GHQ A;  5HJF A;  2Y3Q A;  4ZL5 A;  3SID A;  5IX6 A;  1ZS3 A;  3AJQ A;  3ES3 A;  3EZ0 A;  2FJC A;  3PWF A;  2FG4 A;  3NP0 X;  2YW7 A;  2V2N A;  4LPM A;  3BVF A;  1Z4A A;  2CN6 A;  3F32 A;  2W0O A;  3QZ3 A;  3A9Q A;  3AJP A;  1VJX A;  2XKQ A;  4ZTT A;  5FFD A;  4TOD A;  4MY7 A;  3PW8 A;  4TOH A;  4CMY A;  2Z5P A;  4LQJ A;  5CZU A;  3O7R A;  4TO9 A;  2WLA A;  3BVK A;  3E1N A;  5GU0 X;  2JD8 0;  2V15 A;  2RBD A;  1RCE A;  1EUM A;  1ZUJ A;  1QGH A;  2ZUR X;  1F30 A;  4ERU A;  4XKS A;  4DYZ A;  2Z5Q A;  3UOI A;  5GN8 B;  4RC5 A;  3SHX A;  2CLB A;  3E1Q A;  5J9V A;  1YUX A;  4EVD A;  3KA4 A;  2GYD A;  4TOB A;  5K52 A;  1JKU A;  4ISM A;  2V2O A;  4CYA A;  1BFR A;  1RCG A;  2IY4 A;  2C2F A;  1HRS A;  5GU1 X;  5E2D A;  5GN8 A;  3QVD A;  1DAT A;  4TOG A;  2JD7 0;  1F33 A;  4Z5S A;  3BKN A;  2ZG9 X;  4ZJK A;  4PG0 A;  3HL1 A;  3H7G A;  4AM5 A;  3UOF A;  3PW1 A;  3NP2 X;  1B71 A;  3FSE A;  2JD6 0;  1NNQ A;  1S30 A;  2XGW A;  3RBC A;  5D8S A;  3UNO A;  2V2L A;  3KA6 A;  3BVI A;  2OH3 A;  2FZF A;  3KX9 A;  5JKM A;  4CMY V;  3OJ5 A;  1NF6 A;  3F34 A;  4ZKW A;  2HR5 A;  3PWQ A;  1SQ3 A;  2YW6 A;  3KA9 A;  3PVT A;  3RGD A;  4RC6 B;  5FEJ A;  3QHB A;  3IQ1 A;  3KA8 A;  4LYX A;  5CMR A;  1XZ3 A;  1BCF A;  3PVR A;  3R2R A;  4Y08 A;  1DPS A;  4KVR A;  1Z6O M;  4II4 B;  2FHA A;  1VEL A;  3R2K A;  1VLG A;  2QF9 A;  4P18 A;  4M34 A;  1UMN A;  5D8O A;  5LG8 A;  2UX1 A;  3E1M A;  1YUZ A;  4ISP A;  5J8W A;  4RC6 A;  3BVE A;  2ZG7 X;  4DYX A;  2XJN A;  1LKM A;  4TOA A;  4TW3 A;  3WVW A;  3SE1 A;  4EVC A;  4CVT A;  5LS9 A;  4TOE A;  1IES A;  4MJY A;  2VXX A;  2CEI A;  4RC5 B;  4II4 A;  4CVR A;  3R2H A;  5FFA A;  5C6F A;  2G4H A;  1VEQ A;  3F35 A;  5AXS A;  5ERK A;  3RAV A;  3KA3 A;  4EVE A;  4CVP A;  2IU2 A;  4XGS A;  1JI5 A;  2XJO A;  4CVS A;  4ITT A;  4ZL6 A;  3PWQ C;  1L8I A;  4QUW A;  1BG7 A;  5FFE A;  4XKT A;  5GU2 X;  1JI4 A;  3A68 A;  3PW1 B;  4Z3B A;  2IB0 A;  3E1P A;  1NFV A;  5ERJ A;  3OGH A;  5D8X A;  3E2C A;  3ISF A;  4M32 A;  4KVQ A;  4IWJ A;  2ZA6 A;  1XZ1 A;  4A25 A;  2CIH A;  4CYB A;  2Z5R A;  1RCD A;  3F37 A;  3WNW A;  4LQH A;  4R42 A;  1RCI A;  3BVL A;  2V2J A;  2CF7 A;  3TA8 A;  3FVB A;  1N1Q A;  1TKO A;  3EZU A;  4RC8 A;  3PW8 C;  3FI6 A;  4ML5 A;  4DYU A;  2VXI A;  2ZG8 X;  4MN9 A;  4DE6 A;  5I4J A;  4IXK A;  5FFC A;  3PVT B;  4DZ0 A;  3AF8 X;  3R2O A;  5D8R A;  4E6K A;  4OYN A;  1RCC A;  3HIU A;  1MOJ A;  1JRE A;  3PVR B;  3RE7 A;  4TOF A;  2Z90 A;  2YJK A;  2V2M A;  2ITB A;  4REU A;  2FKZ A;  1SOF A;  3R2M A;  3Q4N A;  1JTS A;  4IWK A;  4U3G A;  3R2S A;  4LQV A;  3U90 A;  4PGI A;  5JKL G;  5CMQ A;  2FG8 A;  4ETR A;  1YV1 A;  3KWO A;  4LPN A;  2WLU A;  2BK6 A;  2C6R A;  1JKV A;  3IS8 A;  5D8Y A;  1FHA A;  3T9J A;  3IS7 A;  4KVS A;  2C41 A;  3E6R A;  4AM4 A;  2ZA7 A;  3WVU A;  5D8P A;  2PYB A;  1LB3 A;  3E1L A;  2YJJ A;  3E1J A;  1O9R A;  1Z6O A;  1DVB A;  1LKO A;  2CN7 A;  4MKU A;  4DYY A;  2X17 0;  2V2I A;  4XKU A;  1TJO A;  2C2J A;  2V2S A;  5D8Q A;  3EGM A;  4CY9 A;  5K53 A;  2BKC A;  3AK8 A;  4ZKX A;  1J30 A;  2D5K A;  3WVV A;  2VZB A;  3GVY A;  3MPS A;  4ZLW A;  3GE4 A;  3AF9 X;  4MUD A;  2BW1 A;  3O7S A;  3PVY B;  2C2U A;  5E1U A;  1NF4 A;  2OC5 A;  1H96 A;  3F38 A;  2WTL A;  5HQO A;  1JIG A;  5FFB A;  3BT5 A; 
#chains in the Genus database with same CATH topology
 4YKH A;  5LBH A;  3PZA A;  3Q4O A;  1KRQ A;  4ITW A;  4W4K B;  4LPJ A;  2V2R A;  5JDO A;  3R2L A;  2Z6M A;  4RC7 B;  3PVY A;  4LYU A;  2V2P A;  1GWG A;  2F7N A;  3Q4R A;  5J8S A;  2FL0 A;  1IER A;  4ZKH A;  1AEW A;  3VV9 A;  3E6S A;  3KXU A;  1UVH A;  3E1O A;  4DI0 A;  1MFR A;  4PG1 A;  4DAS A;  3SH6 A;  3NOZ X;  1S3Q A;  3C1Y A;  1JYB A;  4EVB A;  1JGC A;  1VEI A;  4RC7 A;  3AJO A;  3ISE A;  3Q4Q A;  4TOC A;  5JAC A;  4YXJ A;  1QYB A;  2CHP A;  5J93 A;  3RD0 A;  2CWL A;  5JKL A;  2GS4 A;  1O9I A;  3ERZ A;  3F39 A;  4LQN A;  4M33 A;  3F33 A;  2CHI A;  5HJH A;  2QQY A;  4M35 A;  1R03 A;  3AF7 X;  2HTN A;  4X0J A;  5GOU A;  4AM2 A;  1RYT A;  3F36 A;  4PGK A;  5GU3 X;  3QB9 A;  3QD8 A;  3AK9 A;  4ZMC A;  2FFX J;  3FRR A;  1OTK A;  2ZA8 A;  3JZ9 A;  1TKP A;  3VNX A;  2GYQ A;  5LG2 A;  1S2Z A;  2BJY A;  2XJM A;  1LKP A;  2CLU A;  5JKM G;  1TK6 A;  1L8H A;  3QHC A;  3GHQ A;  5HJF A;  2Y3Q A;  4ZL5 A;  3SID A;  5IX6 A;  1ZS3 A;  3AJQ A;  4KXR B;  3ES3 A;  3EZ0 A;  2FJC A;  3PWF A;  4WJG 4;  2FG4 A;  3NP0 X;  2YW7 A;  2V2N A;  4LPM A;  3BVF A;  1Z4A A;  2CN6 A;  3F32 A;  2W0O A;  3QZ3 A;  3A9Q A;  3AJP A;  1VJX A;  2XKQ A;  4ZTT A;  5FFD A;  4TOD A;  4MY7 A;  3PW8 A;  4TOH A;  4CMY A;  2Z5P A;  4LQJ A;  5CZU A;  3O7R A;  4TO9 A;  2WLA A;  3BVK A;  3C21 A;  3E1N A;  5GU0 X;  2JD8 0;  2V15 A;  2RBD A;  1RCE A;  5JDO B;  1EUM A;  1ZUJ A;  1QGH A;  2ZUR X;  1F30 A;  4ERU A;  4XKS A;  4DYZ A;  2Z5Q A;  3UOI A;  5GN8 B;  4RC5 A;  3SHX A;  2CLB A;  3E1Q A;  5J9V A;  1YUX A;  4EVD A;  3KA4 A;  2GYD A;  4TOB A;  5K52 A;  1JKU A;  4ISM A;  2V2O A;  4CYA A;  1BFR A;  1RCG A;  2IY4 A;  2C2F A;  1HRS A;  4MXP A;  5GU1 X;  5E2D A;  5GN8 A;  3QVD A;  1DAT A;  4TOG A;  3LKD A;  2JD7 0;  1F33 A;  4Z5S A;  3BKN A;  2ZG9 X;  4ZJK A;  2V8U A;  4PG0 A;  3HL1 A;  3H7G A;  4AM5 A;  3UOF A;  3PW1 A;  3NP2 X;  2AR0 A;  1B71 A;  3FSE A;  2JD6 0;  1NNQ A;  1S30 A;  2XGW A;  3RBC A;  5D8S A;  3UNO A;  2V2L A;  3KA6 A;  3BVI A;  2G38 B;  2OH3 A;  2FZF A;  3KX9 A;  5JKM A;  4CMY V;  3OJ5 A;  1NF6 A;  3F34 A;  4ZKW A;  2HR5 A;  3L0M A;  3PWQ A;  1SQ3 A;  2YW6 A;  3KA9 A;  3JZA B;  3PVT A;  3RGD A;  4RC6 B;  5FEJ A;  3QHB A;  4YVZ A;  3IQ1 A;  3KA8 A;  4LYX A;  5CMR A;  1XZ3 A;  1BCF A;  3PVR A;  3R2R A;  4Y08 A;  1DPS A;  5HU6 D;  4KVR A;  1Z6O M;  4II4 B;  2FHA A;  1VEL A;  3R2K A;  1VLG A;  2QF9 A;  4P18 A;  4M34 A;  1UMN A;  5D8O A;  5LG8 A;  2UX1 A;  3E1M A;  1YUZ A;  4ISP A;  5J8W A;  4RC6 A;  3BVE A;  2ZG7 X;  4DYX A;  2XJN A;  1LKM A;  4TOA A;  4TW3 A;  3WVW A;  3SE1 A;  4EVC A;  4CVT A;  5LS9 A;  4TOE A;  1IES A;  4MJY A;  2VXX A;  2CEI A;  4RC5 B;  4II4 A;  4CVR A;  3R2H A;  3UFB A;  5FFA A;  5C6F A;  2G4H A;  1VEQ A;  3F35 A;  5AXS A;  4YXM A;  5ERK A;  4W4L B;  3RAV A;  3KA3 A;  4EVE A;  4CVP A;  2IU2 A;  4XGS A;  1JI5 A;  2XJO A;  4CVS A;  4ITT A;  4ZL6 A;  3PWQ C;  1L8I A;  4QUW A;  1BG7 A;  5FFE A;  3VVA A;  4XKT A;  5GU2 X;  1JI4 A;  3A68 A;  3PW1 B;  4Z3B A;  2IB0 A;  3V3K B;  3E1P A;  3W54 A;  1NFV A;  5ERJ A;  3OGH A;  5D8X A;  3E2C A;  3ISF A;  4M32 A;  3D19 A;  4KVQ A;  4IWJ A;  2ZA6 A;  1XZ1 A;  4E40 A;  4A25 A;  2CIH A;  4CYB A;  2Z5R A;  1RCD A;  2MGY A;  3F37 A;  3WNW A;  4LQH A;  4R42 A;  2V8T A;  1RCI A;  3BVL A;  2V2J A;  2CF7 A;  3TA8 A;  3FRS A;  3FVB A;  1N1Q A;  1TKO A;  3GGZ A;  3EZU A;  4RC8 A;  3PW8 C;  3FI6 A;  4ML5 A;  4DYU A;  2VXI A;  2ZG8 X;  4MN9 A;  4DE6 A;  5I4J A;  4IXK A;  5FFC A;  3PVT B;  4DZ0 A;  3AF8 X;  3R2O A;  5D8R A;  4E6K A;  4OYN A;  1RCC A;  3HIU A;  1MOJ A;  1JRE A;  3PVR B;  3RE7 A;  4TOF A;  2Z90 A;  2YJK A;  2V2M A;  3DBY A;  2ITB A;  4REU A;  3C1Z A;  2FKZ A;  1SOF A;  3R2M A;  3Q4N A;  1JTS A;  4IWK A;  4U3G A;  3R2S A;  2WWX B;  4LQV A;  3U90 A;  2N02 A;  4PGI A;  5JKL G;  3KDQ A;  5CMQ A;  2FG8 A;  4ETR A;  1YV1 A;  3KWO A;  3N6O A;  2OKC A;  4LPN A;  2WLU A;  2BK6 A;  2C6R A;  1JKV A;  3IS8 A;  5D8Y A;  1FHA A;  3T9J A;  3IS7 A;  4KVS A;  2C41 A;  3E6R A;  4AM4 A;  2ZA7 A;  3WVU A;  5D8P A;  2PYB A;  1LB3 A;  3E1L A;  2YJJ A;  3E1J A;  1O9R A;  1Z6O A;  1DVB A;  1LKO A;  3C23 A;  2CN7 A;  4MKU A;  4DYY A;  2X17 0;  3KHK A;  2V2I A;  4XKU A;  1TJO A;  2C2J A;  2V2S A;  5D8Q A;  3EGM A;  4CY9 A;  5K53 A;  2BKC A;  3AK8 A;  4ZKX A;  1J30 A;  2D5K A;  3WVV A;  2Y44 A;  2VZB A;  3M6J A;  3GVY A;  3MPS A;  4ZLW A;  3GE4 A;  3AF9 X;  3GGY A;  4MUD A;  2BW1 A;  3O7S A;  3PVY B;  2C2U A;  5E1U A;  1NF4 A;  2OC5 A;  1H96 A;  3F38 A;  2WTL A;  5HQO A;  1JIG A;  5FFB A;  3BT5 A; 
#chains in the Genus database with same CATH homology
 4YKH A;  5LBH A;  3PZA A;  3Q4O A;  1KRQ A;  4ITW A;  4W4K B;  4LPJ A;  2V2R A;  5JDO A;  3R2L A;  2Z6M A;  4RC7 B;  3PVY A;  4LYU A;  2V2P A;  1GWG A;  2F7N A;  3Q4R A;  5J8S A;  2FL0 A;  1IER A;  4ZKH A;  1AEW A;  3VV9 A;  3E6S A;  3KXU A;  1UVH A;  3E1O A;  4DI0 A;  1MFR A;  4PG1 A;  4DAS A;  3SH6 A;  3NOZ X;  1S3Q A;  3C1Y A;  1JYB A;  4EVB A;  1JGC A;  1VEI A;  4RC7 A;  3AJO A;  3ISE A;  3Q4Q A;  4TOC A;  5JAC A;  4YXJ A;  1QYB A;  2CHP A;  5J93 A;  3RD0 A;  2CWL A;  5JKL A;  2GS4 A;  1O9I A;  3ERZ A;  3F39 A;  4LQN A;  4M33 A;  3F33 A;  2CHI A;  5HJH A;  2QQY A;  4M35 A;  1R03 A;  3AF7 X;  2HTN A;  4X0J A;  5GOU A;  4AM2 A;  1RYT A;  3F36 A;  4PGK A;  5GU3 X;  3QB9 A;  3QD8 A;  3AK9 A;  4ZMC A;  2FFX J;  3FRR A;  1OTK A;  2ZA8 A;  3JZ9 A;  1TKP A;  3VNX A;  2GYQ A;  5LG2 A;  1S2Z A;  2BJY A;  2XJM A;  1LKP A;  2CLU A;  5JKM G;  1TK6 A;  1L8H A;  3QHC A;  3GHQ A;  5HJF A;  2Y3Q A;  4ZL5 A;  3SID A;  5IX6 A;  1ZS3 A;  3AJQ A;  4KXR B;  3ES3 A;  3EZ0 A;  2FJC A;  3PWF A;  4WJG 4;  2FG4 A;  3NP0 X;  2YW7 A;  2V2N A;  4LPM A;  3BVF A;  1Z4A A;  2CN6 A;  3F32 A;  2W0O A;  3QZ3 A;  3A9Q A;  3AJP A;  1VJX A;  2XKQ A;  4ZTT A;  5FFD A;  4TOD A;  4MY7 A;  3PW8 A;  4TOH A;  4CMY A;  2Z5P A;  4LQJ A;  5CZU A;  3O7R A;  4TO9 A;  2WLA A;  3BVK A;  3C21 A;  3E1N A;  5GU0 X;  2JD8 0;  2V15 A;  2RBD A;  1RCE A;  5JDO B;  1EUM A;  1ZUJ A;  1QGH A;  2ZUR X;  1F30 A;  4ERU A;  4XKS A;  4DYZ A;  2Z5Q A;  3UOI A;  5GN8 B;  4RC5 A;  3SHX A;  2CLB A;  3E1Q A;  5J9V A;  1YUX A;  4EVD A;  3KA4 A;  2GYD A;  4TOB A;  5K52 A;  1JKU A;  4ISM A;  2V2O A;  4CYA A;  1BFR A;  1RCG A;  2IY4 A;  2C2F A;  1HRS A;  4MXP A;  5GU1 X;  5E2D A;  5GN8 A;  3QVD A;  1DAT A;  4TOG A;  3LKD A;  2JD7 0;  1F33 A;  4Z5S A;  3BKN A;  2ZG9 X;  4ZJK A;  2V8U A;  4PG0 A;  3HL1 A;  3H7G A;  4AM5 A;  3UOF A;  3PW1 A;  3NP2 X;  2AR0 A;  1B71 A;  3FSE A;  2JD6 0;  1NNQ A;  1S30 A;  2XGW A;  3RBC A;  5D8S A;  3UNO A;  2V2L A;  3KA6 A;  3BVI A;  2G38 B;  2OH3 A;  2FZF A;  3KX9 A;  5JKM A;  4CMY V;  3OJ5 A;  1NF6 A;  3F34 A;  4ZKW A;  2HR5 A;  3L0M A;  3PWQ A;  1SQ3 A;  2YW6 A;  3KA9 A;  3JZA B;  3PVT A;  3RGD A;  4RC6 B;  5FEJ A;  3QHB A;  4YVZ A;  3IQ1 A;  3KA8 A;  4LYX A;  5CMR A;  1XZ3 A;  1BCF A;  3PVR A;  3R2R A;  4Y08 A;  1DPS A;  5HU6 D;  4KVR A;  1Z6O M;  4II4 B;  2FHA A;  1VEL A;  3R2K A;  1VLG A;  2QF9 A;  4P18 A;  4M34 A;  1UMN A;  5D8O A;  5LG8 A;  2UX1 A;  3E1M A;  1YUZ A;  4ISP A;  5J8W A;  4RC6 A;  3BVE A;  2ZG7 X;  4DYX A;  2XJN A;  1LKM A;  4TOA A;  4TW3 A;  3WVW A;  3SE1 A;  4EVC A;  4CVT A;  5LS9 A;  4TOE A;  1IES A;  4MJY A;  2VXX A;  2CEI A;  4RC5 B;  4II4 A;  4CVR A;  3R2H A;  3UFB A;  5FFA A;  5C6F A;  2G4H A;  1VEQ A;  3F35 A;  5AXS A;  4YXM A;  5ERK A;  4W4L B;  3RAV A;  3KA3 A;  4EVE A;  4CVP A;  2IU2 A;  4XGS A;  1JI5 A;  2XJO A;  4CVS A;  4ITT A;  4ZL6 A;  3PWQ C;  1L8I A;  4QUW A;  1BG7 A;  5FFE A;  3VVA A;  4XKT A;  5GU2 X;  1JI4 A;  3A68 A;  3PW1 B;  4Z3B A;  2IB0 A;  3V3K B;  3E1P A;  3W54 A;  1NFV A;  5ERJ A;  3OGH A;  5D8X A;  3E2C A;  3ISF A;  4M32 A;  3D19 A;  4KVQ A;  4IWJ A;  2ZA6 A;  1XZ1 A;  4E40 A;  4A25 A;  2CIH A;  4CYB A;  2Z5R A;  1RCD A;  2MGY A;  3F37 A;  3WNW A;  4LQH A;  4R42 A;  2V8T A;  1RCI A;  3BVL A;  2V2J A;  2CF7 A;  3TA8 A;  3FRS A;  3FVB A;  1N1Q A;  1TKO A;  3GGZ A;  3EZU A;  4RC8 A;  3PW8 C;  3FI6 A;  4ML5 A;  4DYU A;  2VXI A;  2ZG8 X;  4MN9 A;  4DE6 A;  5I4J A;  4IXK A;  5FFC A;  3PVT B;  4DZ0 A;  3AF8 X;  3R2O A;  5D8R A;  4E6K A;  4OYN A;  1RCC A;  3HIU A;  1MOJ A;  1JRE A;  3PVR B;  3RE7 A;  4TOF A;  2Z90 A;  2YJK A;  2V2M A;  3DBY A;  2ITB A;  4REU A;  3C1Z A;  2FKZ A;  1SOF A;  3R2M A;  3Q4N A;  1JTS A;  4IWK A;  4U3G A;  3R2S A;  2WWX B;  4LQV A;  3U90 A;  2N02 A;  4PGI A;  5JKL G;  3KDQ A;  5CMQ A;  2FG8 A;  4ETR A;  1YV1 A;  3KWO A;  3N6O A;  2OKC A;  4LPN A;  2WLU A;  2BK6 A;  2C6R A;  1JKV A;  3IS8 A;  5D8Y A;  1FHA A;  3T9J A;  3IS7 A;  4KVS A;  2C41 A;  3E6R A;  4AM4 A;  2ZA7 A;  3WVU A;  5D8P A;  2PYB A;  1LB3 A;  3E1L A;  2YJJ A;  3E1J A;  1O9R A;  1Z6O A;  1DVB A;  1LKO A;  3C23 A;  2CN7 A;  4MKU A;  4DYY A;  2X17 0;  3KHK A;  2V2I A;  4XKU A;  1TJO A;  2C2J A;  2V2S A;  5D8Q A;  3EGM A;  4CY9 A;  5K53 A;  2BKC A;  3AK8 A;  4ZKX A;  1J30 A;  2D5K A;  3WVV A;  2Y44 A;  2VZB A;  3M6J A;  3GVY A;  3MPS A;  4ZLW A;  3GE4 A;  3AF9 X;  3GGY A;  4MUD A;  2BW1 A;  3O7S A;  3PVY B;  2C2U A;  5E1U A;  1NF4 A;  2OC5 A;  1H96 A;  3F38 A;  2WTL A;  5HQO A;  1JIG A;  5FFB A;  3BT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...