5K53A

Crystal structures of aldehyde deformylating oxygenase from oscillatoria sp. knua011
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
217
structure length
217
Chain Sequence
IDFQTETYKDAYSRINAIVIEGEQEAHDNYLTLAELLADKKAELVGLSKMENRHMKGFQACGRNLKVTPDMAFAKQFFSELHKNFQTAAAQGQIVTCLLIQSLIIECFAIAAYNIYIPVADDFARKITEGVVKEEYSHLNFGEVWLQAHFEESKAELEAANRQNLPIIWKLLNAVADDARVLGMEKDALIEDFMIAYGEALGNIGFNNRDIMRMSAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords aldehyde deformylating oxygenase
publication title Crystal structures of aldehyde deformylating oxygenase from Limnothrix sp. KNUA012 and Oscillatoria sp. KNUA011.
pubmed doi rcsb
source organism Oscillatoria sp.
total genus 99
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 5k53A01
5J8WA 4Y08A 4PGIA 1RCCA 2BJYA 3UOFA 2ZG8X 1RCGA 4TODA 3F38A 1JIGA 4ZKXA 1VLGA 3E1QA 4PGKA 1VEQA 5FFDA 1JYBA 1XZ3A 2X170 3NP0X 1R03A 4ITTA 3GE4A 2CEIA 1SQ3A 2V15A 3UOIA 3E1NA 5E1UA 1JI4A 1AEWA 3UNOA 2ZA8A 2ZG7X 5GU3X 3BVKA 2FG4A 3E6SA 5FFAA 4MJYA 2FFXJ 3IS7A 2JD60 4II4A 4LYUA 1FHAA 4KVSA 3AK9A 2V2OA 3E2CA 4EVDA 4R42A 1TK6A 3ISEA 4ISPA 2V2LA 2IB0A 3E1LA 4MKUA 2WLAA 4DZ0A 4RC7A 3E1MA 3F34A 4ZL5A 2V2NA 1LKOA 4EVBA 3GVYA 5HQOA 4LPNA 1NF6A 2BW1A 5C6FA 3NP2X 4REUA 4EVCA 4TOFA 1UVHA 3QB9A 2Z5RA 4ZKWA 4M35A 5CMQA 5D8QA 4LQHA 3E1JA 1L8IA 3KA8A 3HIUA 3EZUA 2C6RA 2CIHA 2VXIA 3FI6A 1LKMA 3AJQA 4CY9A 3PW1B 2V2MA 4LYXA 2CN7A 5AXSA 3AF9X 4TOGA 3KA3A 5CZUA 3A68A 5D8OA 2IY4A 4ZKHA 2Y3QA 4TOEA 1MOJA 3A9QA 3RD0A 3AF8X 3WVUA 3PVTB 5CMRA 1QYBA 2ZG9X 2GS4A 1RCDA 5LS9A 1JGCA 3AJPA 5LG8A 2CF7A 4ERUA 4CVRA 2CLUA 3EZ0A 3OGHA 1B71A 3PVRA 2CHPA 3Q4NA 2V2SA 3IS8A 2ZURX 4RC6B 3RBCA 4M33A 1IESA 2D5KA 1TKPA 5ERKA 3BT5A 4DI0A 3Q4RA 4MUDA 3AJOA 4ZJKA 3PVYB 4TW3A 5GU2X 3F39A 3QHBA 3PWQC 5LBHA 3BVIA 3TA8A 1MFRA 4AM2A 1TKOA 4TOAA 4CVPA 3PWFA 3ISFA 2G4HA 5IX6A 1KRQA 2V2RA 4ISMA 1DPSA 4M32A 3BVLA 2JD80 2CN6A 2PYBA 4LQJA 4TOCA 2WLUA 4CYAA 3F32A 3IQ1A 4RC5B 2XJMA 3MPSA 2ITBA 3PW8C 5HJHA 4U3GA 3KA4A 4RC8A 3EGMA 4ZTTA 5GN8B 3BVEA 2Z90A 2BKCA 4XKUA 4DE6A 1YV1A 3T9JA 2YW6A 5E2DA 5K53A 3WVWA 2C2FA 2FZFA 5D8SA 4XKTA 3AK8A 3PW1A 5ERJA 2CLBA 5I4JA 5K52A 1L8HA 4IXKA 4TO9A 3R2OA 4KVQA 3QZ3A 1RCEA 4ITWA 1S30A 4ZL6A 4P18A 3O7RA 3SIDA 2VXXA 3ERZA 5D8YA 4DASA 1JREA 4DYZA 2VZBA 1IERA 2FG8A 3PVTA 4XGSA 3H7GA 1Z4AA 4IWKA 3PW8A 2YW7A 3Q4OA 3KA9A 1YUXA 4A25A 4RC7B 2ZA6A 1H96A 3RGDA 5JKLA 4ML5A 4RC6A 2WTLA 5GU0X 1N1QA 3RAVA 2XJNA 1DATA 5D8XA 2XGWA 3SE1A 1JI5A 1VJXA 2ZA7A 5FFEA 3F36A 2F7NA 3PVYA 3SHXA 2W0OA 2BK6A 5J9VA 4ZMCA 2YJJA 4CMYA 2GYDA 2QF9A 2YJKA 3R2MA 4YKHA 4EVEA 4TOBA 3F33A 4CMYV 4ZLWA 5D8PA 2HTNA 1ZUJA 5J8SA 1S3QA 3ES3A 4DYXA 3QHCA 4CVSA 3FVBA 3E6RA 2FJCA 4CYBA 1RYTA 4AM5A 4CVTA 1O9RA 4RC5A 2FKZA 1BFRA 5GU1X 4AM4A 1UMNA 2OC5A 4KVRA 5HJFA 5JKMA 5GN8A 2GYQA 5J93A 3F35A 1OTKA 4M34A 3RE7A 2IU2A 4DYUA 3U90A 4TOHA 5JKLG 3HL1A 1TJOA 3QD8A 1VELA 2V2JA 3QVDA 3KXUA 4QUWA 3WVVA 1JTSA 1NFVA 2FHAA 3WNWA 1GWGA 3R2RA 4OYNA 1LB3A 1HRSA 3PVRB 2FL0A 3R2HA 4PG0A 1NNQA 5JACA 3AF7X 3E1OA 4XKSA 2QQYA 2UX1A 4Z5SA 5FFCA 2V2PA 3PWQA 2CHIA 4MY7A 4Z3BA 1BG7A 4MN9A 1JKVA 1EUMA 1J30A 3R2LA 2Z5QA 1JKUA 1DVBA 1F30A 3Q4QA 4II4B 3NOZX 1VEIA 4IWJA 1F33A 3KX9A 4LPJA 5JKMG 2OH3A 3VNXA 2JD70 1LKPA 1Z6OA 1S2ZA 5D8RA 3R2KA 1Z6OM 3E1PA 1XZ1A 3FSEA 1QGHA 4DYYA 4PG1A 2XJOA 1SOFA 1O9IA 4ETRA 3GHQA 1ZS3A 4LQVA 2C41A 1RCIA 3SH6A 5FFBA 2Z6MA 3F37A 1YUZA 4LQNA 5FEJA 2C2JA 1NF4A 3OJ5A 3BKNA 2XKQA 3BVFA 4LPMA 3O7SA 2V2IA 5GOUA 3KWOA 2HR5A 2C2UA 3KA6A 3R2SA 5LG2A 2Z5PA 1BCFA 3PZAA 4E6KA 2RBDA
chains in the Genus database with same CATH superfamily
5J8WA 4Y08A 4PGIA 1RCCA 3DBYA 2BJYA 3UOFA 2ZG8X 1RCGA 4TODA 3F38A 1JIGA 3D19A 4ZKXA 1VLGA 3E1QA 4PGKA 1VEQA 5FFDA 1JYBA 1XZ3A 2X170 3NP0X 1R03A 5HU6D 4ITTA 3GE4A 2CEIA 1SQ3A 2V15A 3GGZA 3UOIA 3E1NA 5E1UA 1JI4A 1AEWA 3UNOA 2ZA8A 2ZG7X 5GU3X 3BVKA 3FRRA 2FG4A 3E6SA 5FFAA 2N02A 4MJYA 2FFXJ 3IS7A 2JD60 4II4A 2Y44A 4LYUA 1FHAA 4KVSA 3AK9A 2V2OA 3E2CA 4EVDA 4R42A 1TK6A 3ISEA 2V8UA 4WJG4 4ISPA 2V2LA 2IB0A 3E1LA 3LKDA 4MKUA 2WLAA 4DZ0A 4RC7A 3E1MA 3F34A 4ZL5A 2V2NA 1LKOA 4EVBA 3GVYA 5HQOA 4LPNA 1NF6A 2BW1A 5C6FA 3NP2X 4REUA 4EVCA 4TOFA 1UVHA 3VVAA 3QB9A 2Z5RA 4ZKWA 4M35A 5CMQA 4W4KB 5D8QA 4LQHA 3L0MA 3E1JA 1L8IA 3KA8A 3HIUA 3EZUA 2CWLA 5JDOA 2C6RA 2CIHA 2VXIA 3FI6A 1LKMA 2OKCA 3AJQA 4CY9A 3PW1B 3VV9A 2V2MA 4LYXA 2CN7A 5AXSA 2V8TA 3AF9X 4TOGA 3KA3A 5CZUA 3A68A 5D8OA 2IY4A 4ZKHA 2Y3QA 4TOEA 1MOJA 2WWXB 3A9QA 3RD0A 3AF8X 3WVUA 3PVTB 5CMRA 1QYBA 2ZG9X 2GS4A 1RCDA 5LS9A 1JGCA 3AJPA 5LG8A 2CF7A 4ERUA 4CVRA 2CLUA 3EZ0A 3OGHA 1B71A 3PVRA 2CHPA 4YVZA 3Q4NA 2V2SA 3IS8A 2ZURX 4RC6B 3RBCA 4M33A 1IESA 2D5KA 1TKPA 5ERKA 3BT5A 4DI0A 3Q4RA 4MUDA 3AJOA 3FRSA 4ZJKA 3PVYB 4TW3A 5GU2X 3F39A 3QHBA 3PWQC 5LBHA 3BVIA 3TA8A 1MFRA 4AM2A 1TKOA 4TOAA 4CVPA 3PWFA 3ISFA 3C21A 2G4HA 5IX6A 3C1ZA 1KRQA 2V2RA 4ISMA 1DPSA 4M32A 3BVLA 2JD80 3KHKA 2CN6A 2PYBA 4LQJA 4TOCA 3GGYA 2WLUA 4CYAA 3F32A 3IQ1A 4RC5B 2XJMA 3MPSA 2ITBA 3PW8C 5HJHA 4U3GA 3KA4A 4RC8A 3EGMA 4ZTTA 4KXRB 5GN8B 3BVEA 2Z90A 2BKCA 4XKUA 4DE6A 1YV1A 3T9JA 2YW6A 5E2DA 5K53A 3WVWA 2C2FA 2FZFA 5D8SA 4XKTA 3AK8A 3PW1A 5ERJA 2CLBA 5I4JA 5K52A 1L8HA 4IXKA 4TO9A 3R2OA 4KVQA 3QZ3A 1RCEA 4ITWA 1S30A 4ZL6A 3JZ9A 4P18A 3O7RA 3SIDA 2VXXA 3ERZA 5D8YA 4DASA 1JREA 4DYZA 2VZBA 1IERA 2FG8A 3PVTA 4XGSA 3H7GA 1Z4AA 4IWKA 3PW8A 2YW7A 3Q4OA 3KA9A 1YUXA 4A25A 4RC7B 2ZA6A 1H96A 3RGDA 5JKLA 3V3KB 4ML5A 4RC6A 2WTLA 5GU0X 1N1QA 3RAVA 2XJNA 1DATA 5D8XA 2XGWA 3SE1A 1JI5A 1VJXA 2ZA7A 5FFEA 3F36A 2F7NA 3PVYA 3SHXA 2W0OA 2BK6A 5J9VA 4ZMCA 2YJJA 4CMYA 2GYDA 2QF9A 2YJKA 3R2MA 4X0JA 4YKHA 4EVEA 4TOBA 3F33A 4CMYV 4ZLWA 5D8PA 2HTNA 1ZUJA 5J8SA 2G38B 2AR0A 1S3QA 3ES3A 4DYXA 3QHCA 4CVSA 3FVBA 3UFBA 3E6RA 2FJCA 4CYBA 1RYTA 4AM5A 4CVTA 1O9RA 4RC5A 2FKZA 1BFRA 5GU1X 4AM4A 1UMNA 2OC5A 4KVRA 5HJFA 5JKMA 5GN8A 2GYQA 5J93A 3F35A 1OTKA 4M34A 3RE7A 2IU2A 4DYUA 3U90A 4TOHA 5JKLG 3HL1A 1TJOA 3QD8A 1VELA 2V2JA 3QVDA 3KXUA 4QUWA 3WVVA 1JTSA 1NFVA 2FHAA 3WNWA 1GWGA 3R2RA 4OYNA 1LB3A 3C23A 1HRSA 3C1YA 3PVRB 2FL0A 3R2HA 3KDQA 4PG0A 1NNQA 5JACA 3AF7X 3E1OA 4XKSA 2QQYA 2UX1A 4Z5SA 5FFCA 2V2PA 3PWQA 2CHIA 4MY7A 4Z3BA 3JZAB 1BG7A 3N6OA 4MN9A 1JKVA 1EUMA 1J30A 4W4LB 3R2LA 2Z5QA 1JKUA 1DVBA 1F30A 3Q4QA 4II4B 3NOZX 1VEIA 4IWJA 1F33A 3KX9A 4LPJA 5JKMG 2OH3A 3M6JA 3VNXA 4YXJA 2JD70 1LKPA 1Z6OA 1S2ZA 5D8RA 3R2KA 1Z6OM 3E1PA 1XZ1A 3FSEA 1QGHA 4DYYA 4MXPA 4PG1A 2XJOA 1SOFA 1O9IA 4ETRA 3GHQA 1ZS3A 3W54A 4LQVA 4E40A 2C41A 1RCIA 3SH6A 5FFBA 2Z6MA 3F37A 1YUZA 4LQNA 5FEJA 2C2JA 1NF4A 3OJ5A 3BKNA 2XKQA 3BVFA 4LPMA 3O7SA 2V2IA 5GOUA 3KWOA 2HR5A 2C2UA 3R2SA 3KA6A 5LG2A 2Z5PA 1BCFA 4YXMA 3PZAA 2MGYA 5JDOB 4E6KA 2RBDA
chains in the Genus database with same CATH topology
5J8WA 4Y08A 4PGIA 1RCCA 3DBYA 2BJYA 3UOFA 2ZG8X 1RCGA 4TODA 3F38A 1JIGA 3D19A 4ZKXA 1VLGA 3E1QA 4PGKA 1VEQA 5FFDA 1JYBA 1XZ3A 2X170 3NP0X 1R03A 5HU6D 4ITTA 3GE4A 2CEIA 1SQ3A 2V15A 3GGZA 3UOIA 3E1NA 5E1UA 1JI4A 1AEWA 3UNOA 2ZA8A 2ZG7X 5GU3X 3BVKA 3FRRA 2FG4A 3E6SA 5FFAA 2N02A 4MJYA 2FFXJ 3IS7A 2JD60 4II4A 2Y44A 4LYUA 1FHAA 4KVSA 3AK9A 2V2OA 3E2CA 4EVDA 4R42A 1TK6A 3ISEA 2V8UA 4WJG4 4ISPA 2V2LA 2IB0A 3E1LA 3LKDA 4MKUA 2WLAA 4DZ0A 4RC7A 3E1MA 3F34A 4ZL5A 2V2NA 1LKOA 4EVBA 3GVYA 5HQOA 4LPNA 1NF6A 2BW1A 5C6FA 3NP2X 4REUA 4EVCA 4TOFA 1UVHA 3VVAA 3QB9A 2Z5RA 4ZKWA 4M35A 5CMQA 4W4KB 5D8QA 4LQHA 3L0MA 3E1JA 1L8IA 3KA8A 3HIUA 3EZUA 2CWLA 5JDOA 2C6RA 2CIHA 2VXIA 3FI6A 1LKMA 2OKCA 3AJQA 4CY9A 3PW1B 3VV9A 2V2MA 4LYXA 2CN7A 5AXSA 2V8TA 3AF9X 4TOGA 3KA3A 5CZUA 3A68A 5D8OA 2IY4A 4ZKHA 2Y3QA 4TOEA 1MOJA 2WWXB 3A9QA 3RD0A 3AF8X 3WVUA 3PVTB 5CMRA 1QYBA 2ZG9X 2GS4A 1RCDA 5LS9A 1JGCA 3AJPA 5LG8A 2CF7A 4ERUA 4CVRA 2CLUA 3EZ0A 3OGHA 1B71A 3PVRA 2CHPA 4YVZA 3Q4NA 2V2SA 3IS8A 2ZURX 4RC6B 3RBCA 4M33A 1IESA 2D5KA 1TKPA 5ERKA 3BT5A 4DI0A 3Q4RA 4MUDA 3AJOA 3FRSA 4ZJKA 3PVYB 4TW3A 5GU2X 3F39A 3QHBA 3PWQC 5LBHA 3BVIA 3TA8A 1MFRA 4AM2A 1TKOA 4TOAA 4CVPA 3PWFA 3ISFA 3C21A 2G4HA 5IX6A 3C1ZA 1KRQA 2V2RA 4ISMA 1DPSA 4M32A 3BVLA 2JD80 3KHKA 2CN6A 2PYBA 4LQJA 4TOCA 3GGYA 2WLUA 4CYAA 3F32A 3IQ1A 4RC5B 2XJMA 3MPSA 2ITBA 3PW8C 5HJHA 4U3GA 3KA4A 4RC8A 3EGMA 4ZTTA 4KXRB 5GN8B 3BVEA 2Z90A 2BKCA 4XKUA 4DE6A 1YV1A 3T9JA 2YW6A 5E2DA 5K53A 3WVWA 2C2FA 2FZFA 5D8SA 4XKTA 3AK8A 3PW1A 5ERJA 2CLBA 5I4JA 5K52A 1L8HA 4IXKA 4TO9A 3R2OA 4KVQA 3QZ3A 1RCEA 4ITWA 1S30A 4ZL6A 3JZ9A 4P18A 3O7RA 3SIDA 2VXXA 3ERZA 5D8YA 4DASA 1JREA 4DYZA 2VZBA 1IERA 2FG8A 3PVTA 4XGSA 3H7GA 1Z4AA 4IWKA 3PW8A 2YW7A 3Q4OA 3KA9A 1YUXA 4A25A 4RC7B 2ZA6A 1H96A 3RGDA 5JKLA 3V3KB 4ML5A 4RC6A 2WTLA 5GU0X 1N1QA 3RAVA 2XJNA 1DATA 5D8XA 2XGWA 3SE1A 1JI5A 1VJXA 2ZA7A 5FFEA 3F36A 2F7NA 3PVYA 3SHXA 2W0OA 2BK6A 5J9VA 4ZMCA 2YJJA 4CMYA 2GYDA 2QF9A 2YJKA 3R2MA 4X0JA 4YKHA 4EVEA 4TOBA 3F33A 4CMYV 4ZLWA 5D8PA 2HTNA 1ZUJA 5J8SA 2G38B 2AR0A 1S3QA 3ES3A 4DYXA 3QHCA 4CVSA 3FVBA 3UFBA 3E6RA 2FJCA 4CYBA 1RYTA 4AM5A 4CVTA 1O9RA 4RC5A 2FKZA 1BFRA 5GU1X 4AM4A 1UMNA 2OC5A 4KVRA 5HJFA 5JKMA 5GN8A 2GYQA 5J93A 3F35A 1OTKA 4M34A 3RE7A 2IU2A 4DYUA 3U90A 4TOHA 5JKLG 3HL1A 1TJOA 3QD8A 1VELA 2V2JA 3QVDA 3KXUA 4QUWA 3WVVA 1JTSA 1NFVA 2FHAA 3WNWA 1GWGA 3R2RA 4OYNA 1LB3A 3C23A 1HRSA 3C1YA 3PVRB 2FL0A 3R2HA 3KDQA 4PG0A 1NNQA 5JACA 3AF7X 3E1OA 4XKSA 2QQYA 2UX1A 4Z5SA 5FFCA 2V2PA 3PWQA 2CHIA 4MY7A 4Z3BA 3JZAB 1BG7A 3N6OA 4MN9A 1JKVA 1EUMA 1J30A 4W4LB 3R2LA 2Z5QA 1JKUA 1DVBA 1F30A 3Q4QA 4II4B 3NOZX 1VEIA 4IWJA 1F33A 3KX9A 4LPJA 5JKMG 2OH3A 3M6JA 3VNXA 4YXJA 2JD70 1LKPA 1Z6OA 1S2ZA 5D8RA 3R2KA 1Z6OM 3E1PA 1XZ1A 3FSEA 1QGHA 4DYYA 4MXPA 4PG1A 2XJOA 1SOFA 1O9IA 4ETRA 3GHQA 1ZS3A 3W54A 4LQVA 4E40A 2C41A 1RCIA 3SH6A 5FFBA 2Z6MA 3F37A 1YUZA 4LQNA 5FEJA 2C2JA 1NF4A 3OJ5A 3BKNA 2XKQA 3BVFA 4LPMA 3O7SA 2V2IA 5GOUA 3KWOA 2HR5A 2C2UA 3R2SA 3KA6A 5LG2A 2Z5PA 1BCFA 4YXMA 3PZAA 2MGYA 5JDOB 4E6KA 2RBDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J8W A;  4Y08 A;  4PGI A;  1RCC A;  2BJY A;  3UOF A;  2ZG8 X;  1RCG A;  4TOD A;  3F38 A;  1JIG A;  4ZKX A;  1VLG A;  3E1Q A;  4PGK A;  1VEQ A;  5FFD A;  1JYB A;  1XZ3 A;  2X17 0;  3NP0 X;  1R03 A;  4ITT A;  3GE4 A;  2CEI A;  1SQ3 A;  2V15 A;  3UOI A;  3E1N A;  5E1U A;  1JI4 A;  1AEW A;  3UNO A;  2ZA8 A;  2ZG7 X;  5GU3 X;  3BVK A;  2FG4 A;  3E6S A;  5FFA A;  4MJY A;  2FFX J;  3IS7 A;  2JD6 0;  4II4 A;  4LYU A;  1FHA A;  4KVS A;  3AK9 A;  2V2O A;  3E2C A;  4EVD A;  4R42 A;  1TK6 A;  3ISE A;  4ISP A;  2V2L A;  2IB0 A;  3E1L A;  4MKU A;  2WLA A;  4DZ0 A;  4RC7 A;  3E1M A;  3F34 A;  4ZL5 A;  2V2N A;  1LKO A;  4EVB A;  3GVY A;  5HQO A;  4LPN A;  1NF6 A;  2BW1 A;  5C6F A;  3NP2 X;  4REU A;  4EVC A;  4TOF A;  1UVH A;  3QB9 A;  2Z5R A;  4ZKW A;  4M35 A;  5CMQ A;  5D8Q A;  4LQH A;  3E1J A;  1L8I A;  3KA8 A;  3HIU A;  3EZU A;  2C6R A;  2CIH A;  2VXI A;  3FI6 A;  1LKM A;  3AJQ A;  4CY9 A;  3PW1 B;  2V2M A;  4LYX A;  2CN7 A;  5AXS A;  3AF9 X;  4TOG A;  3KA3 A;  5CZU A;  3A68 A;  5D8O A;  2IY4 A;  4ZKH A;  2Y3Q A;  4TOE A;  1MOJ A;  3A9Q A;  3RD0 A;  3AF8 X;  3WVU A;  3PVT B;  5CMR A;  1QYB A;  2ZG9 X;  2GS4 A;  1RCD A;  5LS9 A;  1JGC A;  3AJP A;  5LG8 A;  2CF7 A;  4ERU A;  4CVR A;  2CLU A;  3EZ0 A;  3OGH A;  1B71 A;  3PVR A;  2CHP A;  3Q4N A;  2V2S A;  3IS8 A;  2ZUR X;  4RC6 B;  3RBC A;  4M33 A;  1IES A;  2D5K A;  1TKP A;  5ERK A;  3BT5 A;  4DI0 A;  3Q4R A;  4MUD A;  3AJO A;  4ZJK A;  3PVY B;  4TW3 A;  5GU2 X;  3F39 A;  3QHB A;  3PWQ C;  5LBH A;  3BVI A;  3TA8 A;  1MFR A;  4AM2 A;  1TKO A;  4TOA A;  4CVP A;  3PWF A;  3ISF A;  2G4H A;  5IX6 A;  1KRQ A;  2V2R A;  4ISM A;  1DPS A;  4M32 A;  3BVL A;  2JD8 0;  2CN6 A;  2PYB A;  4LQJ A;  4TOC A;  2WLU A;  4CYA A;  3F32 A;  3IQ1 A;  4RC5 B;  2XJM A;  3MPS A;  2ITB A;  3PW8 C;  5HJH A;  4U3G A;  3KA4 A;  4RC8 A;  3EGM A;  4ZTT A;  5GN8 B;  3BVE A;  2Z90 A;  2BKC A;  4XKU A;  4DE6 A;  1YV1 A;  3T9J A;  2YW6 A;  5E2D A;  5K53 A;  3WVW A;  2C2F A;  2FZF A;  5D8S A;  4XKT A;  3AK8 A;  3PW1 A;  5ERJ A;  2CLB A;  5I4J A;  5K52 A;  1L8H A;  4IXK A;  4TO9 A;  3R2O A;  4KVQ A;  3QZ3 A;  1RCE A;  4ITW A;  1S30 A;  4ZL6 A;  4P18 A;  3O7R A;  3SID A;  2VXX A;  3ERZ A;  5D8Y A;  4DAS A;  1JRE A;  4DYZ A;  2VZB A;  1IER A;  2FG8 A;  3PVT A;  4XGS A;  3H7G A;  1Z4A A;  4IWK A;  3PW8 A;  2YW7 A;  3Q4O A;  3KA9 A;  1YUX A;  4A25 A;  4RC7 B;  2ZA6 A;  1H96 A;  3RGD A;  5JKL A;  4ML5 A;  4RC6 A;  2WTL A;  5GU0 X;  1N1Q A;  3RAV A;  2XJN A;  1DAT A;  5D8X A;  2XGW A;  3SE1 A;  1JI5 A;  1VJX A;  2ZA7 A;  5FFE A;  3F36 A;  2F7N A;  3PVY A;  3SHX A;  2W0O A;  2BK6 A;  5J9V A;  4ZMC A;  2YJJ A;  4CMY A;  2GYD A;  2QF9 A;  2YJK A;  3R2M A;  4YKH A;  4EVE A;  4TOB A;  3F33 A;  4CMY V;  4ZLW A;  5D8P A;  2HTN A;  1ZUJ A;  5J8S A;  1S3Q A;  3ES3 A;  4DYX A;  3QHC A;  4CVS A;  3FVB A;  3E6R A;  2FJC A;  4CYB A;  1RYT A;  4AM5 A;  4CVT A;  1O9R A;  4RC5 A;  2FKZ A;  1BFR A;  5GU1 X;  4AM4 A;  1UMN A;  2OC5 A;  4KVR A;  5HJF A;  5JKM A;  5GN8 A;  2GYQ A;  5J93 A;  3F35 A;  1OTK A;  4M34 A;  3RE7 A;  2IU2 A;  4DYU A;  3U90 A;  4TOH A;  5JKL G;  3HL1 A;  1TJO A;  3QD8 A;  1VEL A;  2V2J A;  3QVD A;  3KXU A;  4QUW A;  3WVV A;  1JTS A;  1NFV A;  2FHA A;  3WNW A;  1GWG A;  3R2R A;  4OYN A;  1LB3 A;  1HRS A;  3PVR B;  2FL0 A;  3R2H A;  4PG0 A;  1NNQ A;  5JAC A;  3AF7 X;  3E1O A;  4XKS A;  2QQY A;  2UX1 A;  4Z5S A;  5FFC A;  2V2P A;  3PWQ A;  2CHI A;  4MY7 A;  4Z3B A;  1BG7 A;  4MN9 A;  1JKV A;  1EUM A;  1J30 A;  3R2L A;  2Z5Q A;  1JKU A;  1DVB A;  1F30 A;  3Q4Q A;  4II4 B;  3NOZ X;  1VEI A;  4IWJ A;  1F33 A;  3KX9 A;  4LPJ A;  5JKM G;  2OH3 A;  3VNX A;  2JD7 0;  1LKP A;  1Z6O A;  1S2Z A;  5D8R A;  3R2K A;  1Z6O M;  3E1P A;  1XZ1 A;  3FSE A;  1QGH A;  4DYY A;  4PG1 A;  2XJO A;  1SOF A;  1O9I A;  4ETR A;  3GHQ A;  1ZS3 A;  4LQV A;  2C41 A;  1RCI A;  3SH6 A;  5FFB A;  2Z6M A;  3F37 A;  1YUZ A;  4LQN A;  5FEJ A;  2C2J A;  1NF4 A;  3OJ5 A;  3BKN A;  2XKQ A;  3BVF A;  4LPM A;  3O7S A;  2V2I A;  5GOU A;  3KWO A;  2HR5 A;  2C2U A;  3KA6 A;  3R2S A;  5LG2 A;  2Z5P A;  1BCF A;  3PZA A;  4E6K A;  2RBD A; 
#chains in the Genus database with same CATH topology
 5J8W A;  4Y08 A;  4PGI A;  1RCC A;  3DBY A;  2BJY A;  3UOF A;  2ZG8 X;  1RCG A;  4TOD A;  3F38 A;  1JIG A;  3D19 A;  4ZKX A;  1VLG A;  3E1Q A;  4PGK A;  1VEQ A;  5FFD A;  1JYB A;  1XZ3 A;  2X17 0;  3NP0 X;  1R03 A;  5HU6 D;  4ITT A;  3GE4 A;  2CEI A;  1SQ3 A;  2V15 A;  3GGZ A;  3UOI A;  3E1N A;  5E1U A;  1JI4 A;  1AEW A;  3UNO A;  2ZA8 A;  2ZG7 X;  5GU3 X;  3BVK A;  3FRR A;  2FG4 A;  3E6S A;  5FFA A;  2N02 A;  4MJY A;  2FFX J;  3IS7 A;  2JD6 0;  4II4 A;  2Y44 A;  4LYU A;  1FHA A;  4KVS A;  3AK9 A;  2V2O A;  3E2C A;  4EVD A;  4R42 A;  1TK6 A;  3ISE A;  2V8U A;  4WJG 4;  4ISP A;  2V2L A;  2IB0 A;  3E1L A;  3LKD A;  4MKU A;  2WLA A;  4DZ0 A;  4RC7 A;  3E1M A;  3F34 A;  4ZL5 A;  2V2N A;  1LKO A;  4EVB A;  3GVY A;  5HQO A;  4LPN A;  1NF6 A;  2BW1 A;  5C6F A;  3NP2 X;  4REU A;  4EVC A;  4TOF A;  1UVH A;  3VVA A;  3QB9 A;  2Z5R A;  4ZKW A;  4M35 A;  5CMQ A;  4W4K B;  5D8Q A;  4LQH A;  3L0M A;  3E1J A;  1L8I A;  3KA8 A;  3HIU A;  3EZU A;  2CWL A;  5JDO A;  2C6R A;  2CIH A;  2VXI A;  3FI6 A;  1LKM A;  2OKC A;  3AJQ A;  4CY9 A;  3PW1 B;  3VV9 A;  2V2M A;  4LYX A;  2CN7 A;  5AXS A;  2V8T A;  3AF9 X;  4TOG A;  3KA3 A;  5CZU A;  3A68 A;  5D8O A;  2IY4 A;  4ZKH A;  2Y3Q A;  4TOE A;  1MOJ A;  2WWX B;  3A9Q A;  3RD0 A;  3AF8 X;  3WVU A;  3PVT B;  5CMR A;  1QYB A;  2ZG9 X;  2GS4 A;  1RCD A;  5LS9 A;  1JGC A;  3AJP A;  5LG8 A;  2CF7 A;  4ERU A;  4CVR A;  2CLU A;  3EZ0 A;  3OGH A;  1B71 A;  3PVR A;  2CHP A;  4YVZ A;  3Q4N A;  2V2S A;  3IS8 A;  2ZUR X;  4RC6 B;  3RBC A;  4M33 A;  1IES A;  2D5K A;  1TKP A;  5ERK A;  3BT5 A;  4DI0 A;  3Q4R A;  4MUD A;  3AJO A;  3FRS A;  4ZJK A;  3PVY B;  4TW3 A;  5GU2 X;  3F39 A;  3QHB A;  3PWQ C;  5LBH A;  3BVI A;  3TA8 A;  1MFR A;  4AM2 A;  1TKO A;  4TOA A;  4CVP A;  3PWF A;  3ISF A;  3C21 A;  2G4H A;  5IX6 A;  3C1Z A;  1KRQ A;  2V2R A;  4ISM A;  1DPS A;  4M32 A;  3BVL A;  2JD8 0;  3KHK A;  2CN6 A;  2PYB A;  4LQJ A;  4TOC A;  3GGY A;  2WLU A;  4CYA A;  3F32 A;  3IQ1 A;  4RC5 B;  2XJM A;  3MPS A;  2ITB A;  3PW8 C;  5HJH A;  4U3G A;  3KA4 A;  4RC8 A;  3EGM A;  4ZTT A;  4KXR B;  5GN8 B;  3BVE A;  2Z90 A;  2BKC A;  4XKU A;  4DE6 A;  1YV1 A;  3T9J A;  2YW6 A;  5E2D A;  5K53 A;  3WVW A;  2C2F A;  2FZF A;  5D8S A;  4XKT A;  3AK8 A;  3PW1 A;  5ERJ A;  2CLB A;  5I4J A;  5K52 A;  1L8H A;  4IXK A;  4TO9 A;  3R2O A;  4KVQ A;  3QZ3 A;  1RCE A;  4ITW A;  1S30 A;  4ZL6 A;  3JZ9 A;  4P18 A;  3O7R A;  3SID A;  2VXX A;  3ERZ A;  5D8Y A;  4DAS A;  1JRE A;  4DYZ A;  2VZB A;  1IER A;  2FG8 A;  3PVT A;  4XGS A;  3H7G A;  1Z4A A;  4IWK A;  3PW8 A;  2YW7 A;  3Q4O A;  3KA9 A;  1YUX A;  4A25 A;  4RC7 B;  2ZA6 A;  1H96 A;  3RGD A;  5JKL A;  3V3K B;  4ML5 A;  4RC6 A;  2WTL A;  5GU0 X;  1N1Q A;  3RAV A;  2XJN A;  1DAT A;  5D8X A;  2XGW A;  3SE1 A;  1JI5 A;  1VJX A;  2ZA7 A;  5FFE A;  3F36 A;  2F7N A;  3PVY A;  3SHX A;  2W0O A;  2BK6 A;  5J9V A;  4ZMC A;  2YJJ A;  4CMY A;  2GYD A;  2QF9 A;  2YJK A;  3R2M A;  4X0J A;  4YKH A;  4EVE A;  4TOB A;  3F33 A;  4CMY V;  4ZLW A;  5D8P A;  2HTN A;  1ZUJ A;  5J8S A;  2G38 B;  2AR0 A;  1S3Q A;  3ES3 A;  4DYX A;  3QHC A;  4CVS A;  3FVB A;  3UFB A;  3E6R A;  2FJC A;  4CYB A;  1RYT A;  4AM5 A;  4CVT A;  1O9R A;  4RC5 A;  2FKZ A;  1BFR A;  5GU1 X;  4AM4 A;  1UMN A;  2OC5 A;  4KVR A;  5HJF A;  5JKM A;  5GN8 A;  2GYQ A;  5J93 A;  3F35 A;  1OTK A;  4M34 A;  3RE7 A;  2IU2 A;  4DYU A;  3U90 A;  4TOH A;  5JKL G;  3HL1 A;  1TJO A;  3QD8 A;  1VEL A;  2V2J A;  3QVD A;  3KXU A;  4QUW A;  3WVV A;  1JTS A;  1NFV A;  2FHA A;  3WNW A;  1GWG A;  3R2R A;  4OYN A;  1LB3 A;  3C23 A;  1HRS A;  3C1Y A;  3PVR B;  2FL0 A;  3R2H A;  3KDQ A;  4PG0 A;  1NNQ A;  5JAC A;  3AF7 X;  3E1O A;  4XKS A;  2QQY A;  2UX1 A;  4Z5S A;  5FFC A;  2V2P A;  3PWQ A;  2CHI A;  4MY7 A;  4Z3B A;  3JZA B;  1BG7 A;  3N6O A;  4MN9 A;  1JKV A;  1EUM A;  1J30 A;  4W4L B;  3R2L A;  2Z5Q A;  1JKU A;  1DVB A;  1F30 A;  3Q4Q A;  4II4 B;  3NOZ X;  1VEI A;  4IWJ A;  1F33 A;  3KX9 A;  4LPJ A;  5JKM G;  2OH3 A;  3M6J A;  3VNX A;  4YXJ A;  2JD7 0;  1LKP A;  1Z6O A;  1S2Z A;  5D8R A;  3R2K A;  1Z6O M;  3E1P A;  1XZ1 A;  3FSE A;  1QGH A;  4DYY A;  4MXP A;  4PG1 A;  2XJO A;  1SOF A;  1O9I A;  4ETR A;  3GHQ A;  1ZS3 A;  3W54 A;  4LQV A;  4E40 A;  2C41 A;  1RCI A;  3SH6 A;  5FFB A;  2Z6M A;  3F37 A;  1YUZ A;  4LQN A;  5FEJ A;  2C2J A;  1NF4 A;  3OJ5 A;  3BKN A;  2XKQ A;  3BVF A;  4LPM A;  3O7S A;  2V2I A;  5GOU A;  3KWO A;  2HR5 A;  2C2U A;  3R2S A;  3KA6 A;  5LG2 A;  2Z5P A;  1BCF A;  4YXM A;  3PZA A;  2MGY A;  5JDO B;  4E6K A;  2RBD A; 
#chains in the Genus database with same CATH homology
 5J8W A;  4Y08 A;  4PGI A;  1RCC A;  3DBY A;  2BJY A;  3UOF A;  2ZG8 X;  1RCG A;  4TOD A;  3F38 A;  1JIG A;  3D19 A;  4ZKX A;  1VLG A;  3E1Q A;  4PGK A;  1VEQ A;  5FFD A;  1JYB A;  1XZ3 A;  2X17 0;  3NP0 X;  1R03 A;  5HU6 D;  4ITT A;  3GE4 A;  2CEI A;  1SQ3 A;  2V15 A;  3GGZ A;  3UOI A;  3E1N A;  5E1U A;  1JI4 A;  1AEW A;  3UNO A;  2ZA8 A;  2ZG7 X;  5GU3 X;  3BVK A;  3FRR A;  2FG4 A;  3E6S A;  5FFA A;  2N02 A;  4MJY A;  2FFX J;  3IS7 A;  2JD6 0;  4II4 A;  2Y44 A;  4LYU A;  1FHA A;  4KVS A;  3AK9 A;  2V2O A;  3E2C A;  4EVD A;  4R42 A;  1TK6 A;  3ISE A;  2V8U A;  4WJG 4;  4ISP A;  2V2L A;  2IB0 A;  3E1L A;  3LKD A;  4MKU A;  2WLA A;  4DZ0 A;  4RC7 A;  3E1M A;  3F34 A;  4ZL5 A;  2V2N A;  1LKO A;  4EVB A;  3GVY A;  5HQO A;  4LPN A;  1NF6 A;  2BW1 A;  5C6F A;  3NP2 X;  4REU A;  4EVC A;  4TOF A;  1UVH A;  3VVA A;  3QB9 A;  2Z5R A;  4ZKW A;  4M35 A;  5CMQ A;  4W4K B;  5D8Q A;  4LQH A;  3L0M A;  3E1J A;  1L8I A;  3KA8 A;  3HIU A;  3EZU A;  2CWL A;  5JDO A;  2C6R A;  2CIH A;  2VXI A;  3FI6 A;  1LKM A;  2OKC A;  3AJQ A;  4CY9 A;  3PW1 B;  3VV9 A;  2V2M A;  4LYX A;  2CN7 A;  5AXS A;  2V8T A;  3AF9 X;  4TOG A;  3KA3 A;  5CZU A;  3A68 A;  5D8O A;  2IY4 A;  4ZKH A;  2Y3Q A;  4TOE A;  1MOJ A;  2WWX B;  3A9Q A;  3RD0 A;  3AF8 X;  3WVU A;  3PVT B;  5CMR A;  1QYB A;  2ZG9 X;  2GS4 A;  1RCD A;  5LS9 A;  1JGC A;  3AJP A;  5LG8 A;  2CF7 A;  4ERU A;  4CVR A;  2CLU A;  3EZ0 A;  3OGH A;  1B71 A;  3PVR A;  2CHP A;  4YVZ A;  3Q4N A;  2V2S A;  3IS8 A;  2ZUR X;  4RC6 B;  3RBC A;  4M33 A;  1IES A;  2D5K A;  1TKP A;  5ERK A;  3BT5 A;  4DI0 A;  3Q4R A;  4MUD A;  3AJO A;  3FRS A;  4ZJK A;  3PVY B;  4TW3 A;  5GU2 X;  3F39 A;  3QHB A;  3PWQ C;  5LBH A;  3BVI A;  3TA8 A;  1MFR A;  4AM2 A;  1TKO A;  4TOA A;  4CVP A;  3PWF A;  3ISF A;  3C21 A;  2G4H A;  5IX6 A;  3C1Z A;  1KRQ A;  2V2R A;  4ISM A;  1DPS A;  4M32 A;  3BVL A;  2JD8 0;  3KHK A;  2CN6 A;  2PYB A;  4LQJ A;  4TOC A;  3GGY A;  2WLU A;  4CYA A;  3F32 A;  3IQ1 A;  4RC5 B;  2XJM A;  3MPS A;  2ITB A;  3PW8 C;  5HJH A;  4U3G A;  3KA4 A;  4RC8 A;  3EGM A;  4ZTT A;  4KXR B;  5GN8 B;  3BVE A;  2Z90 A;  2BKC A;  4XKU A;  4DE6 A;  1YV1 A;  3T9J A;  2YW6 A;  5E2D A;  5K53 A;  3WVW A;  2C2F A;  2FZF A;  5D8S A;  4XKT A;  3AK8 A;  3PW1 A;  5ERJ A;  2CLB A;  5I4J A;  5K52 A;  1L8H A;  4IXK A;  4TO9 A;  3R2O A;  4KVQ A;  3QZ3 A;  1RCE A;  4ITW A;  1S30 A;  4ZL6 A;  3JZ9 A;  4P18 A;  3O7R A;  3SID A;  2VXX A;  3ERZ A;  5D8Y A;  4DAS A;  1JRE A;  4DYZ A;  2VZB A;  1IER A;  2FG8 A;  3PVT A;  4XGS A;  3H7G A;  1Z4A A;  4IWK A;  3PW8 A;  2YW7 A;  3Q4O A;  3KA9 A;  1YUX A;  4A25 A;  4RC7 B;  2ZA6 A;  1H96 A;  3RGD A;  5JKL A;  3V3K B;  4ML5 A;  4RC6 A;  2WTL A;  5GU0 X;  1N1Q A;  3RAV A;  2XJN A;  1DAT A;  5D8X A;  2XGW A;  3SE1 A;  1JI5 A;  1VJX A;  2ZA7 A;  5FFE A;  3F36 A;  2F7N A;  3PVY A;  3SHX A;  2W0O A;  2BK6 A;  5J9V A;  4ZMC A;  2YJJ A;  4CMY A;  2GYD A;  2QF9 A;  2YJK A;  3R2M A;  4X0J A;  4YKH A;  4EVE A;  4TOB A;  3F33 A;  4CMY V;  4ZLW A;  5D8P A;  2HTN A;  1ZUJ A;  5J8S A;  2G38 B;  2AR0 A;  1S3Q A;  3ES3 A;  4DYX A;  3QHC A;  4CVS A;  3FVB A;  3UFB A;  3E6R A;  2FJC A;  4CYB A;  1RYT A;  4AM5 A;  4CVT A;  1O9R A;  4RC5 A;  2FKZ A;  1BFR A;  5GU1 X;  4AM4 A;  1UMN A;  2OC5 A;  4KVR A;  5HJF A;  5JKM A;  5GN8 A;  2GYQ A;  5J93 A;  3F35 A;  1OTK A;  4M34 A;  3RE7 A;  2IU2 A;  4DYU A;  3U90 A;  4TOH A;  5JKL G;  3HL1 A;  1TJO A;  3QD8 A;  1VEL A;  2V2J A;  3QVD A;  3KXU A;  4QUW A;  3WVV A;  1JTS A;  1NFV A;  2FHA A;  3WNW A;  1GWG A;  3R2R A;  4OYN A;  1LB3 A;  3C23 A;  1HRS A;  3C1Y A;  3PVR B;  2FL0 A;  3R2H A;  3KDQ A;  4PG0 A;  1NNQ A;  5JAC A;  3AF7 X;  3E1O A;  4XKS A;  2QQY A;  2UX1 A;  4Z5S A;  5FFC A;  2V2P A;  3PWQ A;  2CHI A;  4MY7 A;  4Z3B A;  3JZA B;  1BG7 A;  3N6O A;  4MN9 A;  1JKV A;  1EUM A;  1J30 A;  4W4L B;  3R2L A;  2Z5Q A;  1JKU A;  1DVB A;  1F30 A;  3Q4Q A;  4II4 B;  3NOZ X;  1VEI A;  4IWJ A;  1F33 A;  3KX9 A;  4LPJ A;  5JKM G;  2OH3 A;  3M6J A;  3VNX A;  4YXJ A;  2JD7 0;  1LKP A;  1Z6O A;  1S2Z A;  5D8R A;  3R2K A;  1Z6O M;  3E1P A;  1XZ1 A;  3FSE A;  1QGH A;  4DYY A;  4MXP A;  4PG1 A;  2XJO A;  1SOF A;  1O9I A;  4ETR A;  3GHQ A;  1ZS3 A;  3W54 A;  4LQV A;  4E40 A;  2C41 A;  1RCI A;  3SH6 A;  5FFB A;  2Z6M A;  3F37 A;  1YUZ A;  4LQN A;  5FEJ A;  2C2J A;  1NF4 A;  3OJ5 A;  3BKN A;  2XKQ A;  3BVF A;  4LPM A;  3O7S A;  2V2I A;  5GOU A;  3KWO A;  2HR5 A;  2C2U A;  3R2S A;  3KA6 A;  5LG2 A;  2Z5P A;  1BCF A;  4YXM A;  3PZA A;  2MGY A;  5JDO B;  4E6K A;  2RBD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...