5K53A

Crystal structures of aldehyde deformylating oxygenase from oscillatoria sp. knua011
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
217
structure length
217
Chain Sequence
IDFQTETYKDAYSRINAIVIEGEQEAHDNYLTLAELLADKKAELVGLSKMENRHMKGFQACGRNLKVTPDMAFAKQFFSELHKNFQTAAAQGQIVTCLLIQSLIIECFAIAAYNIYIPVADDFARKITEGVVKEEYSHLNFGEVWLQAHFEESKAELEAANRQNLPIIWKLLNAVADDARVLGMEKDALIEDFMIAYGEALGNIGFNNRDIMRMSAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aldehyde deformylating oxygenase
publication title Crystal structures of aldehyde deformylating oxygenase from Limnothrix sp. KNUA012 and Oscillatoria sp. KNUA011.
pubmed doi rcsb
source organism Oscillatoria sp.
molecule tags Metal binding protein
total genus 99
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 5k53A01
1AEWA 3ISFA 4KVRA 2GYDA 5FFDA 1BFRA 5LG2A 2BW1A 4CYBA 3RE7A 1JI5A 1S2ZA 1IERA 2V2PA 3SIDA 4XKUA 2IY4A 1KRQA 2ZA7A 5LBHA 2CHIA 1UVHA 2FG8A 4TOFA 2FHAA 3PVRB 3F34A 3PWFA 3F33A 3WVUA 1JGCA 4ETRA 4DE6A 2QF9A 3AF9X 4CVPA 2QQYA 2FKZA 2C2JA 5JKLG 3KA4A 3HL1A 2CLUA 2FG4A 3ISEA 3UOFA 4LPJA 3QD8A 4ZKWA 4KVQA 3F36A 4IWJA 4Y08A 4ERUA 4XKTA 3E1QA 1LB3A 1JIGA 1Z4AA 5ERJA 3KXUA 4ISPA 3AJQA 3T9JA 3QVDA 1VEIA 3BVKA 5GU0X 4LQNA 5GOUA 1YUXA 1GWGA 4KVSA 3KWOA 2V2IA 4DI0A 3AK9A 4RC6B 3PWQC 5FFEA 4ZJKA 3NP0X 1DPSA 1VELA 3AF7X 2FFXJ 5E2DA 3EZ0A 1JTSA 5JKMA 4PG0A 3KA8A 2CF7A 1QYBA 3R2MA 5E1UA 2V2JA 3IS8A 2CN7A 4PG1A 2FJCA 5CZUA 4TW3A 3PVRA 4ZKXA 3VNXA 5FEJA 4ZL6A 3KA3A 2FL0A 3MPSA 2VZBA 3WNWA 3FVBA 3UOIA 2JD70 3HIUA 2ZG8X 2WLAA 3PVYA 5J9VA 4DZ0A 4ZTTA 1TKOA 1N1QA 4II4B 3R2SA 5FFBA 1F33A 3Q4QA 3KA6A 3BVEA 2HTNA 4RC5B 4MUDA 5LS9A 5IX6A 1RCDA 3FSEA 3R2LA 3R2KA 5K53A 1LKMA 2C2UA 4OYNA 3F35A 3EGMA 4ML5A 1J30A 3F37A 4XGSA 3AK8A 3BVIA 2OH3A 4RC6A 2IB0A 3GHQA 2HR5A 3R2OA 4ZKHA 1NNQA 4DYZA 1JKVA 4XKSA 1H96A 3BVFA 1RCGA 5K52A 1DVBA 1O9IA 5GU2X 2Z5PA 2YJKA 3Q4OA 4EVCA 2Y3QA 2C6RA 4U3GA 4A25A 5J8WA 3PVYB 2V2RA 1JKUA 4ITTA 1EUMA 4M34A 5J93A 4TOHA 3RD0A 2ZURX 3Q4NA 5HQOA 3A9QA 3AJOA 1R03A 3E1JA 5GN8A 1SQ3A 4IWKA 5JKMG 1XZ3A 3IS7A 4II4A 4TODA 3OGHA 2FZFA 2ZG9X 3ERZA 4RC5A 3E1MA 2CN6A 1YV1A 2CEIA 2CLBA 2CHPA 2ZA8A 1VLGA 5CMQA 4RC7A 2BKCA 4R42A 4DYYA 4TOAA 3FI6A 1L8HA 3KA9A 3E1PA 4TOBA 3RBCA 1UMNA 3BKNA 5LG8A 3BT5A 2JD60 4CVTA 1LKOA 2BK6A 2WTLA 3AF8X 5D8OA 4CYAA 4TOCA 3PWQA 4EVDA 1ZUJA 2C2FA 2F7NA 4E6KA 2GYQA 2ZA6A 3U90A 4QUWA 2D5KA 4CVRA 3PW8C 1JYBA 1QGHA 3AJPA 1S3QA 4ZMCA 5GN8B 1VJXA 5ERKA 4EVBA 4AM4A 4RC8A 3OJ5A 1IESA 1BG7A 4TO9A 4AM2A 2V2SA 3E1NA 3NOZX 4M35A 2RBDA 2VXIA 4LPNA 1S30A 2XKQA 2V2OA 3H7GA 2V2NA 4LPMA 1LKPA 5D8XA 4RC7B 2Z5RA 5JACA 4MY7A 1MOJA 3E1OA 4MN9A 2YW6A 3IQ1A 3SH6A 3F38A 4LYXA 5D8QA 3PZAA 4LQVA 4DYXA 5GU3X 3QB9A 2XJOA 2VXXA 5GU1X 4P18A 3E1LA 4PGIA 3F32A 3WVWA 3A68A 2XGWA 1ZS3A 2X170 3F39A 5HJHA 3NP2X 2Z90A 4TOEA 4AM5A 3TA8A 1Z6OA 1RCCA 3KX9A 3PVTB 5D8SA 4CMYV 4Z5SA 1OTKA 3R2RA 2V2MA 3QHCA 1SOFA 3E2CA 2V15A 2Z6MA 1JREA 2JD80 4CY9A 2G4HA 4ZLWA 1XZ1A 5I4JA 5D8RA 1RCEA 1O9RA 3R2HA 1NFVA 4CVSA 3QZ3A 2WLUA 4LYUA 4ITWA 2UX1A 3PW1A 3BVLA 3O7SA 4MKUA 2PYBA 4Z3BA 3ES3A 1NF4A 1B71A 3Q4RA 3SE1A 2YW7A 1Z6OM 2V2LA 1YUZA 3O7RA 4ISMA 1MFRA 2C41A 2W0OA 2Z5QA 2BJYA 1TKPA 4M32A 5CMRA 1FHAA 3E6SA 1VEQA 3QHBA 5JKLA 4LQJA 5J8SA 4DASA 2IU2A 4PGKA 1F30A 1JI4A 5D8YA 1RYTA 4LQHA 3EZUA 2OC5A 1TJOA 4TOGA 5C6FA 5FFCA 3PVTA 1DATA 3RAVA 4YKHA 3E6RA 2XJNA 2YJJA 4EVEA 2GS4A 1RCIA 3PW8A 1BCFA 2CIHA 4REUA 3PW1B 1NF6A 4IXKA 3UNOA 3WVVA 4CMYA 4DYUA 1TK6A 1HRSA 4ZL5A 2XJMA 2ZG7X 3GVYA 5HJFA 4M33A 3RGDA 2ITBA 5D8PA 4MJYA 5FFAA 3GE4A 3SHXA 5AXSA 1L8IA
chains in the Genus database with same CATH superfamily
1AEWA 3ISFA 4KVRA 2GYDA 5FFDA 2V8UA 1BFRA 5LG2A 4W4LB 2BW1A 4CYBA 3RE7A 1JI5A 1S2ZA 1IERA 2V2PA 3SIDA 3W54A 4XKUA 2IY4A 1KRQA 2ZA7A 5LBHA 2CHIA 1UVHA 2FG8A 2N02A 4TOFA 2FHAA 3PVRB 3F34A 3PWFA 3F33A 3WVUA 1JGCA 4ETRA 4DE6A 2QF9A 3AF9X 4CVPA 2QQYA 2FKZA 2C2JA 5JKLG 3KA4A 3HL1A 2CLUA 2FG4A 3ISEA 3UOFA 4LPJA 3QD8A 4ZKWA 4KVQA 3F36A 4IWJA 4Y08A 4ERUA 4XKTA 3E1QA 1LB3A 1JIGA 1Z4AA 5ERJA 3KXUA 4ISPA 3AJQA 3T9JA 3QVDA 1VEIA 3BVKA 5GU0X 4LQNA 5GOUA 1YUXA 1GWGA 4KVSA 3KWOA 4X0JA 2V2IA 4DI0A 3AK9A 4KXRB 4RC6B 3PWQC 5FFEA 4ZJKA 3NP0X 1DPSA 1VELA 3AF7X 2FFXJ 5E2DA 3EZ0A 1JTSA 5JKMA 4MXPA 4PG0A 3KA8A 2CF7A 1QYBA 3R2MA 5E1UA 2V2JA 3UFBA 3IS8A 2CN7A 4PG1A 2FJCA 5CZUA 4TW3A 3PVRA 4ZKXA 3VNXA 2G38B 5FEJA 4ZL6A 3KA3A 2FL0A 3MPSA 2VZBA 3WNWA 3FVBA 3UOIA 2JD70 3HIUA 2ZG8X 3KHKA 2WLAA 3VVAA 3PVYA 5J9VA 4DZ0A 4ZTTA 1TKOA 1N1QA 4II4B 3R2SA 5FFBA 1F33A 3Q4QA 3KA6A 3BVEA 2HTNA 4RC5B 4MUDA 4E40A 5LS9A 5IX6A 1RCDA 3FSEA 3R2LA 3R2KA 5K53A 1LKMA 3GGZA 2C2UA 4OYNA 3F35A 3EGMA 3JZAB 4ML5A 1J30A 3F37A 4XGSA 3AK8A 3BVIA 2OKCA 2OH3A 4RC6A 2IB0A 3GHQA 2HR5A 3R2OA 3JZ9A 4ZKHA 1NNQA 4DYZA 1JKVA 3L0MA 4XKSA 1H96A 3BVFA 5JDOB 1RCGA 5K52A 1DVBA 1O9IA 5GU2X 2Z5PA 2YJKA 3Q4OA 4EVCA 2Y3QA 2C6RA 4U3GA 4A25A 5J8WA 3PVYB 2V2RA 1JKUA 4ITTA 1EUMA 4M34A 5J93A 4TOHA 3RD0A 2ZURX 3Q4NA 5HQOA 3A9QA 3AJOA 1R03A 3E1JA 5GN8A 1SQ3A 3C1YA 4IWKA 5JKMG 1XZ3A 3IS7A 4II4A 4TODA 3OGHA 2FZFA 2ZG9X 3FRSA 3ERZA 4RC5A 3C23A 3E1MA 2V8TA 2CN6A 1YV1A 2CEIA 2CLBA 2CHPA 2ZA8A 1VLGA 5CMQA 4RC7A 2BKCA 4R42A 4DYYA 3VV9A 4TOAA 3FI6A 1L8HA 3KA9A 3E1PA 4TOBA 3D19A 3RBCA 1UMNA 3BKNA 5LG8A 3BT5A 2JD60 4CVTA 1LKOA 2BK6A 2WTLA 3AF8X 5D8OA 4CYAA 4TOCA 3C21A 3PWQA 4EVDA 5JDOA 1ZUJA 2C2FA 2F7NA 3DBYA 4E6KA 2GYQA 3N6OA 3GGYA 2ZA6A 3U90A 4QUWA 2D5KA 4CVRA 3PW8C 1JYBA 5HU6D 1QGHA 3AJPA 1S3QA 4ZMCA 5GN8B 1VJXA 5ERKA 4EVBA 4AM4A 4RC8A 3OJ5A 1IESA 1BG7A 4TO9A 4AM2A 2V2SA 3E1NA 3NOZX 4M35A 2RBDA 2VXIA 4LPNA 1S30A 4WJG4 2XKQA 2V2OA 2MGYA 3H7GA 2V2NA 4LPMA 1LKPA 5D8XA 4RC7B 3V3KB 2Z5RA 5JACA 4MY7A 1MOJA 3E1OA 4MN9A 2YW6A 3IQ1A 3SH6A 3F38A 4LYXA 5D8QA 3PZAA 4LQVA 2Y44A 4DYXA 5GU3X 3QB9A 2XJOA 2VXXA 5GU1X 4P18A 3E1LA 4YXMA 4PGIA 3F32A 3WVWA 3A68A 3LKDA 2XGWA 1ZS3A 2X170 3F39A 5HJHA 3NP2X 2Z90A 4TOEA 4AM5A 3TA8A 1Z6OA 1RCCA 3KX9A 3PVTB 5D8SA 3KDQA 4CMYV 4Z5SA 1OTKA 3R2RA 2V2MA 3QHCA 1SOFA 3E2CA 3M6JA 2V15A 2Z6MA 1JREA 2JD80 4CY9A 2G4HA 4ZLWA 1XZ1A 5I4JA 5D8RA 1RCEA 1O9RA 3R2HA 1NFVA 4CVSA 3QZ3A 2WLUA 4LYUA 4ITWA 2UX1A 3PW1A 3BVLA 3O7SA 4MKUA 2PYBA 4Z3BA 3ES3A 1NF4A 1B71A 3Q4RA 3SE1A 2YW7A 1Z6OM 2V2LA 1YUZA 3O7RA 4ISMA 1MFRA 2C41A 2W0OA 2Z5QA 2BJYA 1TKPA 4M32A 5CMRA 1FHAA 3E6SA 1VEQA 3QHBA 5JKLA 2AR0A 4LQJA 5J8SA 4W4KB 4DASA 2IU2A 4PGKA 1F30A 1JI4A 5D8YA 1RYTA 4LQHA 3EZUA 2OC5A 1TJOA 4TOGA 5C6FA 5FFCA 3PVTA 1DATA 3RAVA 3FRRA 4YKHA 3E6RA 2XJNA 2YJJA 4EVEA 2GS4A 1RCIA 3PW8A 1BCFA 2CIHA 4REUA 3PW1B 1NF6A 4IXKA 4YVZA 3UNOA 3WVVA 4CMYA 4DYUA 1TK6A 1HRSA 4ZL5A 2XJMA 2ZG7X 3GVYA 5HJFA 4M33A 2CWLA 2WWXB 3C1ZA 4YXJA 3RGDA 2ITBA 5D8PA 4MJYA 5FFAA 3GE4A 3SHXA 5AXSA 1L8IA
chains in the Genus database with same CATH topology
1AEWA 3ISFA 4KVRA 2GYDA 5FFDA 2V8UA 1BFRA 5LG2A 4W4LB 2BW1A 4CYBA 3RE7A 1JI5A 1S2ZA 1IERA 2V2PA 3SIDA 3W54A 4XKUA 2IY4A 1KRQA 2ZA7A 5LBHA 2CHIA 1UVHA 2FG8A 2N02A 4TOFA 2FHAA 3PVRB 3F34A 3PWFA 3F33A 3WVUA 1JGCA 4ETRA 4DE6A 2QF9A 3AF9X 4CVPA 2QQYA 2FKZA 2C2JA 5JKLG 3KA4A 3HL1A 2CLUA 2FG4A 3ISEA 3UOFA 4LPJA 3QD8A 4ZKWA 4KVQA 3F36A 4IWJA 4Y08A 4ERUA 4XKTA 3E1QA 1LB3A 1JIGA 1Z4AA 5ERJA 3KXUA 4ISPA 3AJQA 3T9JA 3QVDA 1VEIA 3BVKA 5GU0X 4LQNA 5GOUA 1YUXA 1GWGA 4KVSA 3KWOA 4X0JA 2V2IA 4DI0A 3AK9A 4KXRB 4RC6B 3PWQC 5FFEA 4ZJKA 3NP0X 1DPSA 1VELA 3AF7X 2FFXJ 5E2DA 3EZ0A 1JTSA 5JKMA 4MXPA 4PG0A 3KA8A 2CF7A 1QYBA 3R2MA 5E1UA 2V2JA 3UFBA 3IS8A 2CN7A 4PG1A 2FJCA 5CZUA 4TW3A 3PVRA 4ZKXA 3VNXA 2G38B 5FEJA 4ZL6A 3KA3A 2FL0A 3MPSA 2VZBA 3WNWA 3FVBA 3UOIA 2JD70 3HIUA 2ZG8X 3KHKA 2WLAA 3VVAA 3PVYA 5J9VA 4DZ0A 4ZTTA 1TKOA 1N1QA 4II4B 3R2SA 5FFBA 1F33A 3Q4QA 3KA6A 3BVEA 2HTNA 4RC5B 4MUDA 4E40A 5LS9A 5IX6A 1RCDA 3FSEA 3R2LA 3R2KA 5K53A 1LKMA 3GGZA 2C2UA 4OYNA 3F35A 3EGMA 3JZAB 4ML5A 1J30A 3F37A 4XGSA 3AK8A 3BVIA 2OKCA 2OH3A 4RC6A 2IB0A 3GHQA 2HR5A 3R2OA 3JZ9A 4ZKHA 1NNQA 4DYZA 1JKVA 3L0MA 4XKSA 1H96A 3BVFA 5JDOB 1RCGA 5K52A 1DVBA 1O9IA 5GU2X 2Z5PA 2YJKA 3Q4OA 4EVCA 2Y3QA 2C6RA 4U3GA 4A25A 5J8WA 3PVYB 2V2RA 1JKUA 4ITTA 1EUMA 4M34A 5J93A 4TOHA 3RD0A 2ZURX 3Q4NA 5HQOA 3A9QA 3AJOA 1R03A 3E1JA 5GN8A 1SQ3A 3C1YA 4IWKA 5JKMG 1XZ3A 3IS7A 4II4A 4TODA 3OGHA 2FZFA 2ZG9X 3FRSA 3ERZA 4RC5A 3C23A 3E1MA 2V8TA 2CN6A 1YV1A 2CEIA 2CLBA 2CHPA 2ZA8A 1VLGA 5CMQA 4RC7A 2BKCA 4R42A 4DYYA 3VV9A 4TOAA 3FI6A 1L8HA 3KA9A 3E1PA 4TOBA 3D19A 3RBCA 1UMNA 3BKNA 5LG8A 3BT5A 2JD60 4CVTA 1LKOA 2BK6A 2WTLA 3AF8X 5D8OA 4CYAA 4TOCA 3C21A 3PWQA 4EVDA 5JDOA 1ZUJA 2C2FA 2F7NA 3DBYA 4E6KA 2GYQA 3N6OA 3GGYA 2ZA6A 3U90A 4QUWA 2D5KA 4CVRA 3PW8C 1JYBA 5HU6D 1QGHA 3AJPA 1S3QA 4ZMCA 5GN8B 1VJXA 5ERKA 4EVBA 4AM4A 4RC8A 3OJ5A 1IESA 1BG7A 4TO9A 4AM2A 2V2SA 3E1NA 3NOZX 4M35A 2RBDA 2VXIA 4LPNA 1S30A 4WJG4 2XKQA 2V2OA 2MGYA 3H7GA 2V2NA 4LPMA 1LKPA 5D8XA 4RC7B 3V3KB 2Z5RA 5JACA 4MY7A 1MOJA 3E1OA 4MN9A 2YW6A 3IQ1A 3SH6A 3F38A 4LYXA 5D8QA 3PZAA 4LQVA 2Y44A 4DYXA 5GU3X 3QB9A 2XJOA 2VXXA 5GU1X 4P18A 3E1LA 4YXMA 4PGIA 3F32A 3WVWA 3A68A 3LKDA 2XGWA 1ZS3A 2X170 3F39A 5HJHA 3NP2X 2Z90A 4TOEA 4AM5A 3TA8A 1Z6OA 1RCCA 3KX9A 3PVTB 5D8SA 3KDQA 4CMYV 4Z5SA 1OTKA 3R2RA 2V2MA 3QHCA 1SOFA 3E2CA 3M6JA 2V15A 2Z6MA 1JREA 2JD80 4CY9A 2G4HA 4ZLWA 1XZ1A 5I4JA 5D8RA 1RCEA 1O9RA 3R2HA 1NFVA 4CVSA 3QZ3A 2WLUA 4LYUA 4ITWA 2UX1A 3PW1A 3BVLA 3O7SA 4MKUA 2PYBA 4Z3BA 3ES3A 1NF4A 1B71A 3Q4RA 3SE1A 2YW7A 1Z6OM 2V2LA 1YUZA 3O7RA 4ISMA 1MFRA 2C41A 2W0OA 2Z5QA 2BJYA 1TKPA 4M32A 5CMRA 1FHAA 3E6SA 1VEQA 3QHBA 5JKLA 2AR0A 4LQJA 5J8SA 4W4KB 4DASA 2IU2A 4PGKA 1F30A 1JI4A 5D8YA 1RYTA 4LQHA 3EZUA 2OC5A 1TJOA 4TOGA 5C6FA 5FFCA 3PVTA 1DATA 3RAVA 3FRRA 4YKHA 3E6RA 2XJNA 2YJJA 4EVEA 2GS4A 1RCIA 3PW8A 1BCFA 2CIHA 4REUA 3PW1B 1NF6A 4IXKA 4YVZA 3UNOA 3WVVA 4CMYA 4DYUA 1TK6A 1HRSA 4ZL5A 2XJMA 2ZG7X 3GVYA 5HJFA 4M33A 2CWLA 2WWXB 3C1ZA 4YXJA 3RGDA 2ITBA 5D8PA 4MJYA 5FFAA 3GE4A 3SHXA 5AXSA 1L8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AEW A;  3ISF A;  4KVR A;  2GYD A;  5FFD A;  1BFR A;  5LG2 A;  2BW1 A;  4CYB A;  3RE7 A;  1JI5 A;  1S2Z A;  1IER A;  2V2P A;  3SID A;  4XKU A;  2IY4 A;  1KRQ A;  2ZA7 A;  5LBH A;  2CHI A;  1UVH A;  2FG8 A;  4TOF A;  2FHA A;  3PVR B;  3F34 A;  3PWF A;  3F33 A;  3WVU A;  1JGC A;  4ETR A;  4DE6 A;  2QF9 A;  3AF9 X;  4CVP A;  2QQY A;  2FKZ A;  2C2J A;  5JKL G;  3KA4 A;  3HL1 A;  2CLU A;  2FG4 A;  3ISE A;  3UOF A;  4LPJ A;  3QD8 A;  4ZKW A;  4KVQ A;  3F36 A;  4IWJ A;  4Y08 A;  4ERU A;  4XKT A;  3E1Q A;  1LB3 A;  1JIG A;  1Z4A A;  5ERJ A;  3KXU A;  4ISP A;  3AJQ A;  3T9J A;  3QVD A;  1VEI A;  3BVK A;  5GU0 X;  4LQN A;  5GOU A;  1YUX A;  1GWG A;  4KVS A;  3KWO A;  2V2I A;  4DI0 A;  3AK9 A;  4RC6 B;  3PWQ C;  5FFE A;  4ZJK A;  3NP0 X;  1DPS A;  1VEL A;  3AF7 X;  2FFX J;  5E2D A;  3EZ0 A;  1JTS A;  5JKM A;  4PG0 A;  3KA8 A;  2CF7 A;  1QYB A;  3R2M A;  5E1U A;  2V2J A;  3IS8 A;  2CN7 A;  4PG1 A;  2FJC A;  5CZU A;  4TW3 A;  3PVR A;  4ZKX A;  3VNX A;  5FEJ A;  4ZL6 A;  3KA3 A;  2FL0 A;  3MPS A;  2VZB A;  3WNW A;  3FVB A;  3UOI A;  2JD7 0;  3HIU A;  2ZG8 X;  2WLA A;  3PVY A;  5J9V A;  4DZ0 A;  4ZTT A;  1TKO A;  1N1Q A;  4II4 B;  3R2S A;  5FFB A;  1F33 A;  3Q4Q A;  3KA6 A;  3BVE A;  2HTN A;  4RC5 B;  4MUD A;  5LS9 A;  5IX6 A;  1RCD A;  3FSE A;  3R2L A;  3R2K A;  5K53 A;  1LKM A;  2C2U A;  4OYN A;  3F35 A;  3EGM A;  4ML5 A;  1J30 A;  3F37 A;  4XGS A;  3AK8 A;  3BVI A;  2OH3 A;  4RC6 A;  2IB0 A;  3GHQ A;  2HR5 A;  3R2O A;  4ZKH A;  1NNQ A;  4DYZ A;  1JKV A;  4XKS A;  1H96 A;  3BVF A;  1RCG A;  5K52 A;  1DVB A;  1O9I A;  5GU2 X;  2Z5P A;  2YJK A;  3Q4O A;  4EVC A;  2Y3Q A;  2C6R A;  4U3G A;  4A25 A;  5J8W A;  3PVY B;  2V2R A;  1JKU A;  4ITT A;  1EUM A;  4M34 A;  5J93 A;  4TOH A;  3RD0 A;  2ZUR X;  3Q4N A;  5HQO A;  3A9Q A;  3AJO A;  1R03 A;  3E1J A;  5GN8 A;  1SQ3 A;  4IWK A;  5JKM G;  1XZ3 A;  3IS7 A;  4II4 A;  4TOD A;  3OGH A;  2FZF A;  2ZG9 X;  3ERZ A;  4RC5 A;  3E1M A;  2CN6 A;  1YV1 A;  2CEI A;  2CLB A;  2CHP A;  2ZA8 A;  1VLG A;  5CMQ A;  4RC7 A;  2BKC A;  4R42 A;  4DYY A;  4TOA A;  3FI6 A;  1L8H A;  3KA9 A;  3E1P A;  4TOB A;  3RBC A;  1UMN A;  3BKN A;  5LG8 A;  3BT5 A;  2JD6 0;  4CVT A;  1LKO A;  2BK6 A;  2WTL A;  3AF8 X;  5D8O A;  4CYA A;  4TOC A;  3PWQ A;  4EVD A;  1ZUJ A;  2C2F A;  2F7N A;  4E6K A;  2GYQ A;  2ZA6 A;  3U90 A;  4QUW A;  2D5K A;  4CVR A;  3PW8 C;  1JYB A;  1QGH A;  3AJP A;  1S3Q A;  4ZMC A;  5GN8 B;  1VJX A;  5ERK A;  4EVB A;  4AM4 A;  4RC8 A;  3OJ5 A;  1IES A;  1BG7 A;  4TO9 A;  4AM2 A;  2V2S A;  3E1N A;  3NOZ X;  4M35 A;  2RBD A;  2VXI A;  4LPN A;  1S30 A;  2XKQ A;  2V2O A;  3H7G A;  2V2N A;  4LPM A;  1LKP A;  5D8X A;  4RC7 B;  2Z5R A;  5JAC A;  4MY7 A;  1MOJ A;  3E1O A;  4MN9 A;  2YW6 A;  3IQ1 A;  3SH6 A;  3F38 A;  4LYX A;  5D8Q A;  3PZA A;  4LQV A;  4DYX A;  5GU3 X;  3QB9 A;  2XJO A;  2VXX A;  5GU1 X;  4P18 A;  3E1L A;  4PGI A;  3F32 A;  3WVW A;  3A68 A;  2XGW A;  1ZS3 A;  2X17 0;  3F39 A;  5HJH A;  3NP2 X;  2Z90 A;  4TOE A;  4AM5 A;  3TA8 A;  1Z6O A;  1RCC A;  3KX9 A;  3PVT B;  5D8S A;  4CMY V;  4Z5S A;  1OTK A;  3R2R A;  2V2M A;  3QHC A;  1SOF A;  3E2C A;  2V15 A;  2Z6M A;  1JRE A;  2JD8 0;  4CY9 A;  2G4H A;  4ZLW A;  1XZ1 A;  5I4J A;  5D8R A;  1RCE A;  1O9R A;  3R2H A;  1NFV A;  4CVS A;  3QZ3 A;  2WLU A;  4LYU A;  4ITW A;  2UX1 A;  3PW1 A;  3BVL A;  3O7S A;  4MKU A;  2PYB A;  4Z3B A;  3ES3 A;  1NF4 A;  1B71 A;  3Q4R A;  3SE1 A;  2YW7 A;  1Z6O M;  2V2L A;  1YUZ A;  3O7R A;  4ISM A;  1MFR A;  2C41 A;  2W0O A;  2Z5Q A;  2BJY A;  1TKP A;  4M32 A;  5CMR A;  1FHA A;  3E6S A;  1VEQ A;  3QHB A;  5JKL A;  4LQJ A;  5J8S A;  4DAS A;  2IU2 A;  4PGK A;  1F30 A;  1JI4 A;  5D8Y A;  1RYT A;  4LQH A;  3EZU A;  2OC5 A;  1TJO A;  4TOG A;  5C6F A;  5FFC A;  3PVT A;  1DAT A;  3RAV A;  4YKH A;  3E6R A;  2XJN A;  2YJJ A;  4EVE A;  2GS4 A;  1RCI A;  3PW8 A;  1BCF A;  2CIH A;  4REU A;  3PW1 B;  1NF6 A;  4IXK A;  3UNO A;  3WVV A;  4CMY A;  4DYU A;  1TK6 A;  1HRS A;  4ZL5 A;  2XJM A;  2ZG7 X;  3GVY A;  5HJF A;  4M33 A;  3RGD A;  2ITB A;  5D8P A;  4MJY A;  5FFA A;  3GE4 A;  3SHX A;  5AXS A;  1L8I A; 
#chains in the Genus database with same CATH topology
 1AEW A;  3ISF A;  4KVR A;  2GYD A;  5FFD A;  2V8U A;  1BFR A;  5LG2 A;  4W4L B;  2BW1 A;  4CYB A;  3RE7 A;  1JI5 A;  1S2Z A;  1IER A;  2V2P A;  3SID A;  3W54 A;  4XKU A;  2IY4 A;  1KRQ A;  2ZA7 A;  5LBH A;  2CHI A;  1UVH A;  2FG8 A;  2N02 A;  4TOF A;  2FHA A;  3PVR B;  3F34 A;  3PWF A;  3F33 A;  3WVU A;  1JGC A;  4ETR A;  4DE6 A;  2QF9 A;  3AF9 X;  4CVP A;  2QQY A;  2FKZ A;  2C2J A;  5JKL G;  3KA4 A;  3HL1 A;  2CLU A;  2FG4 A;  3ISE A;  3UOF A;  4LPJ A;  3QD8 A;  4ZKW A;  4KVQ A;  3F36 A;  4IWJ A;  4Y08 A;  4ERU A;  4XKT A;  3E1Q A;  1LB3 A;  1JIG A;  1Z4A A;  5ERJ A;  3KXU A;  4ISP A;  3AJQ A;  3T9J A;  3QVD A;  1VEI A;  3BVK A;  5GU0 X;  4LQN A;  5GOU A;  1YUX A;  1GWG A;  4KVS A;  3KWO A;  4X0J A;  2V2I A;  4DI0 A;  3AK9 A;  4KXR B;  4RC6 B;  3PWQ C;  5FFE A;  4ZJK A;  3NP0 X;  1DPS A;  1VEL A;  3AF7 X;  2FFX J;  5E2D A;  3EZ0 A;  1JTS A;  5JKM A;  4MXP A;  4PG0 A;  3KA8 A;  2CF7 A;  1QYB A;  3R2M A;  5E1U A;  2V2J A;  3UFB A;  3IS8 A;  2CN7 A;  4PG1 A;  2FJC A;  5CZU A;  4TW3 A;  3PVR A;  4ZKX A;  3VNX A;  2G38 B;  5FEJ A;  4ZL6 A;  3KA3 A;  2FL0 A;  3MPS A;  2VZB A;  3WNW A;  3FVB A;  3UOI A;  2JD7 0;  3HIU A;  2ZG8 X;  3KHK A;  2WLA A;  3VVA A;  3PVY A;  5J9V A;  4DZ0 A;  4ZTT A;  1TKO A;  1N1Q A;  4II4 B;  3R2S A;  5FFB A;  1F33 A;  3Q4Q A;  3KA6 A;  3BVE A;  2HTN A;  4RC5 B;  4MUD A;  4E40 A;  5LS9 A;  5IX6 A;  1RCD A;  3FSE A;  3R2L A;  3R2K A;  5K53 A;  1LKM A;  3GGZ A;  2C2U A;  4OYN A;  3F35 A;  3EGM A;  3JZA B;  4ML5 A;  1J30 A;  3F37 A;  4XGS A;  3AK8 A;  3BVI A;  2OKC A;  2OH3 A;  4RC6 A;  2IB0 A;  3GHQ A;  2HR5 A;  3R2O A;  3JZ9 A;  4ZKH A;  1NNQ A;  4DYZ A;  1JKV A;  3L0M A;  4XKS A;  1H96 A;  3BVF A;  5JDO B;  1RCG A;  5K52 A;  1DVB A;  1O9I A;  5GU2 X;  2Z5P A;  2YJK A;  3Q4O A;  4EVC A;  2Y3Q A;  2C6R A;  4U3G A;  4A25 A;  5J8W A;  3PVY B;  2V2R A;  1JKU A;  4ITT A;  1EUM A;  4M34 A;  5J93 A;  4TOH A;  3RD0 A;  2ZUR X;  3Q4N A;  5HQO A;  3A9Q A;  3AJO A;  1R03 A;  3E1J A;  5GN8 A;  1SQ3 A;  3C1Y A;  4IWK A;  5JKM G;  1XZ3 A;  3IS7 A;  4II4 A;  4TOD A;  3OGH A;  2FZF A;  2ZG9 X;  3FRS A;  3ERZ A;  4RC5 A;  3C23 A;  3E1M A;  2V8T A;  2CN6 A;  1YV1 A;  2CEI A;  2CLB A;  2CHP A;  2ZA8 A;  1VLG A;  5CMQ A;  4RC7 A;  2BKC A;  4R42 A;  4DYY A;  3VV9 A;  4TOA A;  3FI6 A;  1L8H A;  3KA9 A;  3E1P A;  4TOB A;  3D19 A;  3RBC A;  1UMN A;  3BKN A;  5LG8 A;  3BT5 A;  2JD6 0;  4CVT A;  1LKO A;  2BK6 A;  2WTL A;  3AF8 X;  5D8O A;  4CYA A;  4TOC A;  3C21 A;  3PWQ A;  4EVD A;  5JDO A;  1ZUJ A;  2C2F A;  2F7N A;  3DBY A;  4E6K A;  2GYQ A;  3N6O A;  3GGY A;  2ZA6 A;  3U90 A;  4QUW A;  2D5K A;  4CVR A;  3PW8 C;  1JYB A;  5HU6 D;  1QGH A;  3AJP A;  1S3Q A;  4ZMC A;  5GN8 B;  1VJX A;  5ERK A;  4EVB A;  4AM4 A;  4RC8 A;  3OJ5 A;  1IES A;  1BG7 A;  4TO9 A;  4AM2 A;  2V2S A;  3E1N A;  3NOZ X;  4M35 A;  2RBD A;  2VXI A;  4LPN A;  1S30 A;  4WJG 4;  2XKQ A;  2V2O A;  2MGY A;  3H7G A;  2V2N A;  4LPM A;  1LKP A;  5D8X A;  4RC7 B;  3V3K B;  2Z5R A;  5JAC A;  4MY7 A;  1MOJ A;  3E1O A;  4MN9 A;  2YW6 A;  3IQ1 A;  3SH6 A;  3F38 A;  4LYX A;  5D8Q A;  3PZA A;  4LQV A;  2Y44 A;  4DYX A;  5GU3 X;  3QB9 A;  2XJO A;  2VXX A;  5GU1 X;  4P18 A;  3E1L A;  4YXM A;  4PGI A;  3F32 A;  3WVW A;  3A68 A;  3LKD A;  2XGW A;  1ZS3 A;  2X17 0;  3F39 A;  5HJH A;  3NP2 X;  2Z90 A;  4TOE A;  4AM5 A;  3TA8 A;  1Z6O A;  1RCC A;  3KX9 A;  3PVT B;  5D8S A;  3KDQ A;  4CMY V;  4Z5S A;  1OTK A;  3R2R A;  2V2M A;  3QHC A;  1SOF A;  3E2C A;  3M6J A;  2V15 A;  2Z6M A;  1JRE A;  2JD8 0;  4CY9 A;  2G4H A;  4ZLW A;  1XZ1 A;  5I4J A;  5D8R A;  1RCE A;  1O9R A;  3R2H A;  1NFV A;  4CVS A;  3QZ3 A;  2WLU A;  4LYU A;  4ITW A;  2UX1 A;  3PW1 A;  3BVL A;  3O7S A;  4MKU A;  2PYB A;  4Z3B A;  3ES3 A;  1NF4 A;  1B71 A;  3Q4R A;  3SE1 A;  2YW7 A;  1Z6O M;  2V2L A;  1YUZ A;  3O7R A;  4ISM A;  1MFR A;  2C41 A;  2W0O A;  2Z5Q A;  2BJY A;  1TKP A;  4M32 A;  5CMR A;  1FHA A;  3E6S A;  1VEQ A;  3QHB A;  5JKL A;  2AR0 A;  4LQJ A;  5J8S A;  4W4K B;  4DAS A;  2IU2 A;  4PGK A;  1F30 A;  1JI4 A;  5D8Y A;  1RYT A;  4LQH A;  3EZU A;  2OC5 A;  1TJO A;  4TOG A;  5C6F A;  5FFC A;  3PVT A;  1DAT A;  3RAV A;  3FRR A;  4YKH A;  3E6R A;  2XJN A;  2YJJ A;  4EVE A;  2GS4 A;  1RCI A;  3PW8 A;  1BCF A;  2CIH A;  4REU A;  3PW1 B;  1NF6 A;  4IXK A;  4YVZ A;  3UNO A;  3WVV A;  4CMY A;  4DYU A;  1TK6 A;  1HRS A;  4ZL5 A;  2XJM A;  2ZG7 X;  3GVY A;  5HJF A;  4M33 A;  2CWL A;  2WWX B;  3C1Z A;  4YXJ A;  3RGD A;  2ITB A;  5D8P A;  4MJY A;  5FFA A;  3GE4 A;  3SHX A;  5AXS A;  1L8I A; 
#chains in the Genus database with same CATH homology
 1AEW A;  3ISF A;  4KVR A;  2GYD A;  5FFD A;  2V8U A;  1BFR A;  5LG2 A;  4W4L B;  2BW1 A;  4CYB A;  3RE7 A;  1JI5 A;  1S2Z A;  1IER A;  2V2P A;  3SID A;  3W54 A;  4XKU A;  2IY4 A;  1KRQ A;  2ZA7 A;  5LBH A;  2CHI A;  1UVH A;  2FG8 A;  2N02 A;  4TOF A;  2FHA A;  3PVR B;  3F34 A;  3PWF A;  3F33 A;  3WVU A;  1JGC A;  4ETR A;  4DE6 A;  2QF9 A;  3AF9 X;  4CVP A;  2QQY A;  2FKZ A;  2C2J A;  5JKL G;  3KA4 A;  3HL1 A;  2CLU A;  2FG4 A;  3ISE A;  3UOF A;  4LPJ A;  3QD8 A;  4ZKW A;  4KVQ A;  3F36 A;  4IWJ A;  4Y08 A;  4ERU A;  4XKT A;  3E1Q A;  1LB3 A;  1JIG A;  1Z4A A;  5ERJ A;  3KXU A;  4ISP A;  3AJQ A;  3T9J A;  3QVD A;  1VEI A;  3BVK A;  5GU0 X;  4LQN A;  5GOU A;  1YUX A;  1GWG A;  4KVS A;  3KWO A;  4X0J A;  2V2I A;  4DI0 A;  3AK9 A;  4KXR B;  4RC6 B;  3PWQ C;  5FFE A;  4ZJK A;  3NP0 X;  1DPS A;  1VEL A;  3AF7 X;  2FFX J;  5E2D A;  3EZ0 A;  1JTS A;  5JKM A;  4MXP A;  4PG0 A;  3KA8 A;  2CF7 A;  1QYB A;  3R2M A;  5E1U A;  2V2J A;  3UFB A;  3IS8 A;  2CN7 A;  4PG1 A;  2FJC A;  5CZU A;  4TW3 A;  3PVR A;  4ZKX A;  3VNX A;  2G38 B;  5FEJ A;  4ZL6 A;  3KA3 A;  2FL0 A;  3MPS A;  2VZB A;  3WNW A;  3FVB A;  3UOI A;  2JD7 0;  3HIU A;  2ZG8 X;  3KHK A;  2WLA A;  3VVA A;  3PVY A;  5J9V A;  4DZ0 A;  4ZTT A;  1TKO A;  1N1Q A;  4II4 B;  3R2S A;  5FFB A;  1F33 A;  3Q4Q A;  3KA6 A;  3BVE A;  2HTN A;  4RC5 B;  4MUD A;  4E40 A;  5LS9 A;  5IX6 A;  1RCD A;  3FSE A;  3R2L A;  3R2K A;  5K53 A;  1LKM A;  3GGZ A;  2C2U A;  4OYN A;  3F35 A;  3EGM A;  3JZA B;  4ML5 A;  1J30 A;  3F37 A;  4XGS A;  3AK8 A;  3BVI A;  2OKC A;  2OH3 A;  4RC6 A;  2IB0 A;  3GHQ A;  2HR5 A;  3R2O A;  3JZ9 A;  4ZKH A;  1NNQ A;  4DYZ A;  1JKV A;  3L0M A;  4XKS A;  1H96 A;  3BVF A;  5JDO B;  1RCG A;  5K52 A;  1DVB A;  1O9I A;  5GU2 X;  2Z5P A;  2YJK A;  3Q4O A;  4EVC A;  2Y3Q A;  2C6R A;  4U3G A;  4A25 A;  5J8W A;  3PVY B;  2V2R A;  1JKU A;  4ITT A;  1EUM A;  4M34 A;  5J93 A;  4TOH A;  3RD0 A;  2ZUR X;  3Q4N A;  5HQO A;  3A9Q A;  3AJO A;  1R03 A;  3E1J A;  5GN8 A;  1SQ3 A;  3C1Y A;  4IWK A;  5JKM G;  1XZ3 A;  3IS7 A;  4II4 A;  4TOD A;  3OGH A;  2FZF A;  2ZG9 X;  3FRS A;  3ERZ A;  4RC5 A;  3C23 A;  3E1M A;  2V8T A;  2CN6 A;  1YV1 A;  2CEI A;  2CLB A;  2CHP A;  2ZA8 A;  1VLG A;  5CMQ A;  4RC7 A;  2BKC A;  4R42 A;  4DYY A;  3VV9 A;  4TOA A;  3FI6 A;  1L8H A;  3KA9 A;  3E1P A;  4TOB A;  3D19 A;  3RBC A;  1UMN A;  3BKN A;  5LG8 A;  3BT5 A;  2JD6 0;  4CVT A;  1LKO A;  2BK6 A;  2WTL A;  3AF8 X;  5D8O A;  4CYA A;  4TOC A;  3C21 A;  3PWQ A;  4EVD A;  5JDO A;  1ZUJ A;  2C2F A;  2F7N A;  3DBY A;  4E6K A;  2GYQ A;  3N6O A;  3GGY A;  2ZA6 A;  3U90 A;  4QUW A;  2D5K A;  4CVR A;  3PW8 C;  1JYB A;  5HU6 D;  1QGH A;  3AJP A;  1S3Q A;  4ZMC A;  5GN8 B;  1VJX A;  5ERK A;  4EVB A;  4AM4 A;  4RC8 A;  3OJ5 A;  1IES A;  1BG7 A;  4TO9 A;  4AM2 A;  2V2S A;  3E1N A;  3NOZ X;  4M35 A;  2RBD A;  2VXI A;  4LPN A;  1S30 A;  4WJG 4;  2XKQ A;  2V2O A;  2MGY A;  3H7G A;  2V2N A;  4LPM A;  1LKP A;  5D8X A;  4RC7 B;  3V3K B;  2Z5R A;  5JAC A;  4MY7 A;  1MOJ A;  3E1O A;  4MN9 A;  2YW6 A;  3IQ1 A;  3SH6 A;  3F38 A;  4LYX A;  5D8Q A;  3PZA A;  4LQV A;  2Y44 A;  4DYX A;  5GU3 X;  3QB9 A;  2XJO A;  2VXX A;  5GU1 X;  4P18 A;  3E1L A;  4YXM A;  4PGI A;  3F32 A;  3WVW A;  3A68 A;  3LKD A;  2XGW A;  1ZS3 A;  2X17 0;  3F39 A;  5HJH A;  3NP2 X;  2Z90 A;  4TOE A;  4AM5 A;  3TA8 A;  1Z6O A;  1RCC A;  3KX9 A;  3PVT B;  5D8S A;  3KDQ A;  4CMY V;  4Z5S A;  1OTK A;  3R2R A;  2V2M A;  3QHC A;  1SOF A;  3E2C A;  3M6J A;  2V15 A;  2Z6M A;  1JRE A;  2JD8 0;  4CY9 A;  2G4H A;  4ZLW A;  1XZ1 A;  5I4J A;  5D8R A;  1RCE A;  1O9R A;  3R2H A;  1NFV A;  4CVS A;  3QZ3 A;  2WLU A;  4LYU A;  4ITW A;  2UX1 A;  3PW1 A;  3BVL A;  3O7S A;  4MKU A;  2PYB A;  4Z3B A;  3ES3 A;  1NF4 A;  1B71 A;  3Q4R A;  3SE1 A;  2YW7 A;  1Z6O M;  2V2L A;  1YUZ A;  3O7R A;  4ISM A;  1MFR A;  2C41 A;  2W0O A;  2Z5Q A;  2BJY A;  1TKP A;  4M32 A;  5CMR A;  1FHA A;  3E6S A;  1VEQ A;  3QHB A;  5JKL A;  2AR0 A;  4LQJ A;  5J8S A;  4W4K B;  4DAS A;  2IU2 A;  4PGK A;  1F30 A;  1JI4 A;  5D8Y A;  1RYT A;  4LQH A;  3EZU A;  2OC5 A;  1TJO A;  4TOG A;  5C6F A;  5FFC A;  3PVT A;  1DAT A;  3RAV A;  3FRR A;  4YKH A;  3E6R A;  2XJN A;  2YJJ A;  4EVE A;  2GS4 A;  1RCI A;  3PW8 A;  1BCF A;  2CIH A;  4REU A;  3PW1 B;  1NF6 A;  4IXK A;  4YVZ A;  3UNO A;  3WVV A;  4CMY A;  4DYU A;  1TK6 A;  1HRS A;  4ZL5 A;  2XJM A;  2ZG7 X;  3GVY A;  5HJF A;  4M33 A;  2CWL A;  2WWX B;  3C1Z A;  4YXJ A;  3RGD A;  2ITB A;  5D8P A;  4MJY A;  5FFA A;  3GE4 A;  3SHX A;  5AXS A;  1L8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...