1L8IA

Dna protection and binding by e. coli dps protein
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
156
structure length
156
Chain Sequence
TNLLYTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALICHLATMAERAVQLGGVALGTTQVINSKTPLKSYPLDIHNVQDHLKELADRYAIVANDVRKAIGEAKDDDTADILTAASRDLDKFLWFIESNIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords DNA PROTECTION DURING STARVATION PROTEIN
publication title DNA Protection and Binding by E. Coli Dps Protein
rcsb
source organism Escherichia coli
total genus 62
structure length 156
sequence length 156
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2002-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1l8iA00
3O7SA 3F36A 3RD0A 3BVEA 2BJYA 2Z5QA 2YJKA 1IESA 1UMNA 4LQHA 1HRSA 1TKPA 2V2SA 3F38A 3WVVA 4LPMA 2ZG7X 1SOFA 5JKLG 3NP0X 4IWKA 5J8WA 3PW8A 2C2UA 3ES3A 1O9IA 4ZKWA 2Z6MA 3E1QA 4ZKXA 1UVHA 2FFXJ 2XGWA 3U90A 3KX9A 2FJCA 1VLGA 1S2ZA 4YKHA 4CY9A 2C41A 1NF6A 2YW7A 3E6RA 1TKOA 4RC7A 4PG0A 2CN6A 5D8XA 2WTLA 3O7RA 4ZMCA 3AF8X 2FZFA 4LPJA 3VNXA 3RGDA 4DYYA 5GU3X 3E6SA 1TK6A 1YUZA 4TOFA 3TA8A 3F32A 1JKUA 1RCEA 3E1JA 5AXSA 5LBHA 3T9JA 2XKQA 2WLUA 4II4A 5D8RA 2C2JA 3QZ3A 4RC5A 2OH3A 5E2DA 1DPSA 4II4B 2CEIA 2UX1A 4ETRA 2HR5A 1GWGA 4RC5B 4CVTA 4EVDA 3E2CA 1JREA 4XKSA 1AEWA 4DASA 4ML5A 4MUDA 1XZ1A 2V2MA 2QF9A 3BVLA 4M33A 3GE4A 5JACA 2JD80 3RBCA 1JI5A 1MFRA 3AK9A 4M32A 1RCIA 5J8SA 2W0OA 4KVQA 2CN7A 3QD8A 2VXXA 4XKTA 5JKLA 3HIUA 5K53A 3UNOA 3R2KA 3FVBA 4CYAA 2IU2A 2ZG8X 5IX6A 1NFVA 2Y3QA 1RCGA 2ZURX 3WVUA 2WLAA 4DI0A 4DE6A 2IB0A 4TODA 2OC5A 1O9RA 3OJ5A 4TOBA 4DYUA 4MY7A 3R2SA 3PWFA 3SE1A 5C6FA 3KA9A 3R2LA 3Q4NA 1VJXA 1S30A 2CF7A 3WVWA 2FKZA 2V2OA 4ZJKA 4TOGA 4M35A 4LQNA 3GHQA 4LYUA 1LKMA 4DYZA 3F34A 4R42A 3E1OA 5D8SA 3BVFA 3EZ0A 5LG8A 1JGCA 5JKMA 2QQYA 3KA4A 2V2IA 3R2HA 4TW3A 1YV1A 2V2RA 1LB3A 1NNQA 1DVBA 5E1UA 3SH6A 3QHCA 3R2RA 2HTNA 3AF9X 4AM5A 3AF7X 3WNWA 1KRQA 2PYBA 4RC7B 3KA8A 1NF4A 2Z90A 1BFRA 3FI6A 4MKUA 5I4JA 2V2PA 4LQVA 3NP2X 4ZLWA 5GU2X 4ERUA 1RYTA 1L8IA 4XKUA 1JIGA 2Z5PA 3ERZA 3PW1A 3SIDA 1RCDA 3MPSA 4IXKA 1EUMA 1JTSA 5JKMG 5LS9A 3PW1B 1FHAA 1BG7A 2X170 1J30A 3PWQC 5J93A 3UOIA 3SHXA 4ITWA 2XJNA 3AJOA 5CMQA 1VEIA 1N1QA 1Z4AA 1ZS3A 4EVCA 3GVYA 3PW8C 4CVSA 4KVRA 4ISPA 4CYBA 4CMYV 2FHAA 2GYQA 1VEQA 5HJHA 3PVTA 1H96A 5FFCA 3AJQA 2YJJA 3PVTB 2ZA8A 1JYBA 4TOHA 1MOJA 4AM2A 2Z5RA 4E6KA 3BVKA 3ISFA 2IY4A 5FFEA 3KWOA 4PGIA 3AJPA 2ITBA 3KXUA 4IWJA 4A25A 3A9QA 3QVDA 3F35A 4DZ0A 4PGKA 4QUWA 3Q4QA 4U3GA 2ZA6A 5HJFA 2BK6A 3KA3A 3F39A 3BKNA 2CHIA 4TO9A 2JD70 5FFBA 3E1MA 4CMYA 3PVRA 1QGHA 2VXIA 4AM4A 3PVRB 2FL0A 1RCCA 4ZKHA 4TOAA 1ZUJA 2CLUA 4Z3BA 1YUXA 1LKOA 1S3QA 5J9VA 3OGHA 2C6RA 2GS4A 2CHPA 4Y08A 1LKPA 2V15A 3FSEA 3PWQA 3IQ1A 4CVRA 1B71A 5FFDA 1F33A 4ISMA 3PVYA 3Q4OA 5CZUA 3E1LA 1TJOA 5ERKA 2V2LA 3F37A 3PVYB 5LG2A 4TOCA 2G4HA 2FG8A 4XGSA 4MN9A 3UOFA 4Z5SA 1VELA 4LYXA 2V2JA 5HQOA 4LQJA 1JKVA 3RAVA 2BW1A 1R03A 4PG1A 3Q4RA 4RC8A 1DATA 1BCFA 4M34A 3A68A 3AK8A 2VZBA 3E1PA 2C2FA 3BT5A 4KVSA 4EVEA 3RE7A 2F7NA 3QHBA 2D5KA 4ITTA 2BKCA 2XJMA 1Z6OM 2ZG9X 4MJYA 4P18A 3NOZX 5D8QA 3HL1A 2RBDA 3IS8A 4CVPA 1OTKA 3EGMA 5FEJA 5GN8A 4TOEA 1F30A 1JI4A 1XZ3A 3ISEA 3IS7A 2V2NA 4ZTTA 2CIHA 5GN8B 2JD60 1IERA 4OYNA 3QB9A 3F33A 2XJOA 3E1NA 3R2MA 5GU1X 1QYBA 4ZL6A 3KA6A 3PZAA 3R2OA 4ZL5A 5D8YA 1SQ3A 2ZA7A 1Z6OA 5K52A 5FFAA 4RC6A 5D8PA 4REUA 2FG4A 5GOUA 2YW6A 5ERJA 4RC6B 3EZUA 3H7GA 2GYDA 5D8OA 3BVIA 4DYXA 4EVBA 2CLBA 5CMRA 1L8HA 4LPNA 5GU0X
chains in the Genus database with same CATH superfamily
3O7SA 3F36A 3RD0A 3BVEA 2BJYA 2Z5QA 2YJKA 1IESA 1UMNA 4LQHA 1HRSA 2Y44A 1TKPA 2V2SA 3F38A 3WVVA 4LPMA 2ZG7X 1SOFA 2AR0A 5JKLG 4IWKA 3NP0X 5J8WA 3PW8A 2C2UA 3ES3A 1O9IA 4ZKWA 2Z6MA 3E1QA 4ZKXA 1UVHA 2FFXJ 2XGWA 3U90A 3JZAB 3KX9A 4W4LB 2FJCA 1VLGA 3W54A 1S2ZA 4YKHA 4CY9A 2C41A 1NF6A 2YW7A 3E6RA 4YXMA 1TKOA 4RC7A 4PG0A 2MGYA 2CN6A 5D8XA 2WTLA 3O7RA 4ZMCA 4WJG4 3AF8X 2FZFA 4LPJA 3VNXA 3RGDA 4DYYA 5GU3X 3E6SA 1TK6A 1YUZA 4TOFA 3TA8A 3F32A 1JKUA 1RCEA 3E1JA 5AXSA 5LBHA 3T9JA 2XKQA 2WLUA 3D19A 4II4A 5D8RA 2C2JA 3QZ3A 4RC5A 2OH3A 5E2DA 2CWLA 1DPSA 4II4B 2CEIA 2UX1A 4ETRA 2HR5A 1GWGA 4RC5B 4CVTA 4EVDA 3E2CA 1JREA 4XKSA 1AEWA 5HU6D 4DASA 4ML5A 4MUDA 1XZ1A 2V2MA 4KXRB 2QF9A 3BVLA 4M33A 3GE4A 5JACA 2JD80 3RBCA 1JI5A 1MFRA 3AK9A 4M32A 3VV9A 1RCIA 5J8SA 2W0OA 4KVQA 2CN7A 3QD8A 2VXXA 4XKTA 5JKLA 3HIUA 2N02A 3M6JA 5K53A 3UNOA 3R2KA 3FVBA 4CYAA 2IU2A 2ZG8X 2OKCA 5IX6A 1NFVA 2Y3QA 1RCGA 2ZURX 3WVUA 2WLAA 4DI0A 4DE6A 2IB0A 4TODA 2OC5A 1O9RA 3OJ5A 4TOBA 4DYUA 4MY7A 3R2SA 3PWFA 3SE1A 5C6FA 3KA9A 3R2LA 3Q4NA 1VJXA 1S30A 4MXPA 2CF7A 3WVWA 3DBYA 2FKZA 2V2OA 4ZJKA 4TOGA 4M35A 4LQNA 3GHQA 4LYUA 1LKMA 3C1ZA 4DYZA 3F34A 4R42A 3E1OA 5D8SA 3BVFA 3EZ0A 5LG8A 1JGCA 5JKMA 2QQYA 3KA4A 2V2IA 3R2HA 4TW3A 1YV1A 2V2RA 1LB3A 1NNQA 1DVBA 5E1UA 3SH6A 3QHCA 3R2RA 2HTNA 3AF9X 4AM5A 3AF7X 3FRSA 3WNWA 1KRQA 2PYBA 4RC7B 3KA8A 1NF4A 2Z90A 1BFRA 3FI6A 4MKUA 5I4JA 2V2PA 4LQVA 3NP2X 3GGZA 5GU2X 4ZLWA 4ERUA 1RYTA 1L8IA 4XKUA 1JIGA 2WWXB 2Z5PA 3ERZA 3PW1A 3SIDA 1RCDA 3MPSA 4IXKA 1EUMA 1JTSA 5JKMG 5LS9A 3PW1B 1FHAA 1BG7A 2X170 1J30A 3PWQC 5J93A 3UOIA 3SHXA 4ITWA 2XJNA 3AJOA 5CMQA 1VEIA 3V3KB 1N1QA 4E40A 1Z4AA 1ZS3A 3C1YA 4EVCA 3GVYA 3PW8C 4CVSA 4KVRA 4ISPA 4CYBA 4CMYV 2FHAA 2GYQA 1VEQA 5HJHA 3PVTA 3L0MA 1H96A 5FFCA 3UFBA 3AJQA 2YJJA 3PVTB 2ZA8A 1JYBA 4TOHA 4YXJA 1MOJA 4AM2A 2Z5RA 4E6KA 3BVKA 3ISFA 2IY4A 5FFEA 3KWOA 4PGIA 3AJPA 2ITBA 3KXUA 4IWJA 4A25A 3A9QA 3QVDA 3F35A 4DZ0A 4PGKA 4QUWA 3Q4QA 4U3GA 4X0JA 2ZA6A 5HJFA 3VVAA 2BK6A 3KA3A 3F39A 3BKNA 2CHIA 4TO9A 2JD70 5FFBA 3E1MA 4CMYA 3PVRA 1QGHA 2VXIA 2G38B 4AM4A 3PVRB 2FL0A 1RCCA 4ZKHA 4TOAA 1ZUJA 2CLUA 3N6OA 4Z3BA 1YUXA 1LKOA 1S3QA 5J9VA 3OGHA 2C6RA 2GS4A 2CHPA 4Y08A 1LKPA 4W4KB 2V15A 3FSEA 3PWQA 3IQ1A 4CVRA 1B71A 3GGYA 5FFDA 1F33A 3KHKA 3JZ9A 4ISMA 3PVYA 3Q4OA 5CZUA 3E1LA 1TJOA 5ERKA 2V2LA 3F37A 3PVYB 5LG2A 4TOCA 2G4HA 2FG8A 4XGSA 4MN9A 3UOFA 4Z5SA 1VELA 4LYXA 2V2JA 5HQOA 4LQJA 1JKVA 3RAVA 2BW1A 1R03A 4PG1A 3Q4RA 4RC8A 1DATA 1BCFA 4M34A 3A68A 3AK8A 3LKDA 2VZBA 3E1PA 2C2FA 3BT5A 4KVSA 4EVEA 3RE7A 2F7NA 3QHBA 2D5KA 4ITTA 2BKCA 2XJMA 1Z6OM 2ZG9X 3KDQA 4MJYA 4P18A 3NOZX 5D8QA 3HL1A 2RBDA 2V8UA 3IS8A 3C23A 4CVPA 1OTKA 3EGMA 5FEJA 5GN8A 4TOEA 1F30A 1JI4A 1XZ3A 3ISEA 3IS7A 2V2NA 4ZTTA 2CIHA 5GN8B 2JD60 1IERA 4OYNA 3QB9A 3F33A 2XJOA 5JDOA 3E1NA 3R2MA 5GU1X 4YVZA 2V8TA 1QYBA 4ZL6A 3KA6A 3PZAA 5JDOB 3R2OA 3FRRA 5D8YA 1SQ3A 2ZA7A 4ZL5A 1Z6OA 5K52A 5FFAA 4RC6A 5D8PA 4REUA 2FG4A 5GOUA 2YW6A 5ERJA 4RC6B 3C21A 3EZUA 3H7GA 2GYDA 5D8OA 3BVIA 4DYXA 4EVBA 2CLBA 5CMRA 1L8HA 4LPNA 5GU0X
chains in the Genus database with same CATH topology
3O7SA 3F36A 3RD0A 3BVEA 2BJYA 2Z5QA 2YJKA 1IESA 1UMNA 4LQHA 1HRSA 2Y44A 1TKPA 2V2SA 3F38A 3WVVA 4LPMA 2ZG7X 1SOFA 2AR0A 5JKLG 4IWKA 3NP0X 5J8WA 3PW8A 2C2UA 3ES3A 1O9IA 4ZKWA 2Z6MA 3E1QA 4ZKXA 1UVHA 2FFXJ 2XGWA 3U90A 3JZAB 3KX9A 4W4LB 2FJCA 1VLGA 3W54A 1S2ZA 4YKHA 4CY9A 2C41A 1NF6A 2YW7A 3E6RA 4YXMA 1TKOA 4RC7A 4PG0A 2MGYA 2CN6A 5D8XA 2WTLA 3O7RA 4ZMCA 4WJG4 3AF8X 2FZFA 4LPJA 3VNXA 3RGDA 4DYYA 5GU3X 3E6SA 1TK6A 1YUZA 4TOFA 3TA8A 3F32A 1JKUA 1RCEA 3E1JA 5AXSA 5LBHA 3T9JA 2XKQA 2WLUA 3D19A 4II4A 5D8RA 2C2JA 3QZ3A 4RC5A 2OH3A 5E2DA 2CWLA 1DPSA 4II4B 2CEIA 2UX1A 4ETRA 2HR5A 1GWGA 4RC5B 4CVTA 4EVDA 3E2CA 1JREA 4XKSA 1AEWA 5HU6D 4DASA 4ML5A 4MUDA 1XZ1A 2V2MA 4KXRB 2QF9A 3BVLA 4M33A 3GE4A 5JACA 2JD80 3RBCA 1JI5A 1MFRA 3AK9A 4M32A 3VV9A 1RCIA 5J8SA 2W0OA 4KVQA 2CN7A 3QD8A 2VXXA 4XKTA 5JKLA 3HIUA 2N02A 3M6JA 5K53A 3UNOA 3R2KA 3FVBA 4CYAA 2IU2A 2ZG8X 2OKCA 5IX6A 1NFVA 2Y3QA 1RCGA 2ZURX 3WVUA 2WLAA 4DI0A 4DE6A 2IB0A 4TODA 2OC5A 1O9RA 3OJ5A 4TOBA 4DYUA 4MY7A 3R2SA 3PWFA 3SE1A 5C6FA 3KA9A 3R2LA 3Q4NA 1VJXA 1S30A 4MXPA 2CF7A 3WVWA 3DBYA 2FKZA 2V2OA 4ZJKA 4TOGA 4M35A 4LQNA 3GHQA 4LYUA 1LKMA 3C1ZA 4DYZA 3F34A 4R42A 3E1OA 5D8SA 3BVFA 3EZ0A 5LG8A 1JGCA 5JKMA 2QQYA 3KA4A 2V2IA 3R2HA 4TW3A 1YV1A 2V2RA 1LB3A 1NNQA 1DVBA 5E1UA 3SH6A 3QHCA 3R2RA 2HTNA 3AF9X 4AM5A 3AF7X 3FRSA 3WNWA 1KRQA 2PYBA 4RC7B 3KA8A 1NF4A 2Z90A 1BFRA 3FI6A 4MKUA 5I4JA 2V2PA 4LQVA 3NP2X 3GGZA 5GU2X 4ZLWA 4ERUA 1RYTA 1L8IA 4XKUA 1JIGA 2WWXB 2Z5PA 3ERZA 3PW1A 3SIDA 1RCDA 3MPSA 4IXKA 1EUMA 1JTSA 5JKMG 5LS9A 3PW1B 1FHAA 1BG7A 2X170 1J30A 3PWQC 5J93A 3UOIA 3SHXA 4ITWA 2XJNA 3AJOA 5CMQA 1VEIA 3V3KB 1N1QA 4E40A 1Z4AA 1ZS3A 3C1YA 4EVCA 3GVYA 3PW8C 4CVSA 4KVRA 4ISPA 4CYBA 4CMYV 2FHAA 2GYQA 1VEQA 5HJHA 3PVTA 3L0MA 1H96A 5FFCA 3UFBA 3AJQA 2YJJA 3PVTB 2ZA8A 1JYBA 4TOHA 4YXJA 1MOJA 4AM2A 2Z5RA 4E6KA 3BVKA 3ISFA 2IY4A 5FFEA 3KWOA 4PGIA 3AJPA 2ITBA 3KXUA 4IWJA 4A25A 3A9QA 3QVDA 3F35A 4DZ0A 4PGKA 4QUWA 3Q4QA 4U3GA 4X0JA 2ZA6A 5HJFA 3VVAA 2BK6A 3KA3A 3F39A 3BKNA 2CHIA 4TO9A 2JD70 5FFBA 3E1MA 4CMYA 3PVRA 1QGHA 2VXIA 2G38B 4AM4A 3PVRB 2FL0A 1RCCA 4ZKHA 4TOAA 1ZUJA 2CLUA 3N6OA 4Z3BA 1YUXA 1LKOA 1S3QA 5J9VA 3OGHA 2C6RA 2GS4A 2CHPA 4Y08A 1LKPA 4W4KB 2V15A 3FSEA 3PWQA 3IQ1A 4CVRA 1B71A 3GGYA 5FFDA 1F33A 3KHKA 3JZ9A 4ISMA 3PVYA 3Q4OA 5CZUA 3E1LA 1TJOA 5ERKA 2V2LA 3F37A 3PVYB 5LG2A 4TOCA 2G4HA 2FG8A 4XGSA 4MN9A 3UOFA 4Z5SA 1VELA 4LYXA 2V2JA 5HQOA 4LQJA 1JKVA 3RAVA 2BW1A 1R03A 4PG1A 3Q4RA 4RC8A 1DATA 1BCFA 4M34A 3A68A 3AK8A 3LKDA 2VZBA 3E1PA 2C2FA 3BT5A 4KVSA 4EVEA 3RE7A 2F7NA 3QHBA 2D5KA 4ITTA 2BKCA 2XJMA 1Z6OM 2ZG9X 3KDQA 4MJYA 4P18A 3NOZX 5D8QA 3HL1A 2RBDA 2V8UA 3IS8A 3C23A 4CVPA 1OTKA 3EGMA 5FEJA 5GN8A 4TOEA 1F30A 1JI4A 1XZ3A 3ISEA 3IS7A 2V2NA 4ZTTA 2CIHA 5GN8B 2JD60 1IERA 4OYNA 3QB9A 3F33A 2XJOA 5JDOA 3E1NA 3R2MA 5GU1X 4YVZA 2V8TA 1QYBA 4ZL6A 3KA6A 3PZAA 5JDOB 3R2OA 3FRRA 5D8YA 1SQ3A 2ZA7A 4ZL5A 1Z6OA 5K52A 5FFAA 4RC6A 5D8PA 4REUA 2FG4A 5GOUA 2YW6A 5ERJA 4RC6B 3C21A 3EZUA 3H7GA 2GYDA 5D8OA 3BVIA 4DYXA 4EVBA 2CLBA 5CMRA 1L8HA 4LPNA 5GU0X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O7S A;  3F36 A;  3RD0 A;  3BVE A;  2BJY A;  2Z5Q A;  2YJK A;  1IES A;  1UMN A;  4LQH A;  1HRS A;  1TKP A;  2V2S A;  3F38 A;  3WVV A;  4LPM A;  2ZG7 X;  1SOF A;  5JKL G;  3NP0 X;  4IWK A;  5J8W A;  3PW8 A;  2C2U A;  3ES3 A;  1O9I A;  4ZKW A;  2Z6M A;  3E1Q A;  4ZKX A;  1UVH A;  2FFX J;  2XGW A;  3U90 A;  3KX9 A;  2FJC A;  1VLG A;  1S2Z A;  4YKH A;  4CY9 A;  2C41 A;  1NF6 A;  2YW7 A;  3E6R A;  1TKO A;  4RC7 A;  4PG0 A;  2CN6 A;  5D8X A;  2WTL A;  3O7R A;  4ZMC A;  3AF8 X;  2FZF A;  4LPJ A;  3VNX A;  3RGD A;  4DYY A;  5GU3 X;  3E6S A;  1TK6 A;  1YUZ A;  4TOF A;  3TA8 A;  3F32 A;  1JKU A;  1RCE A;  3E1J A;  5AXS A;  5LBH A;  3T9J A;  2XKQ A;  2WLU A;  4II4 A;  5D8R A;  2C2J A;  3QZ3 A;  4RC5 A;  2OH3 A;  5E2D A;  1DPS A;  4II4 B;  2CEI A;  2UX1 A;  4ETR A;  2HR5 A;  1GWG A;  4RC5 B;  4CVT A;  4EVD A;  3E2C A;  1JRE A;  4XKS A;  1AEW A;  4DAS A;  4ML5 A;  4MUD A;  1XZ1 A;  2V2M A;  2QF9 A;  3BVL A;  4M33 A;  3GE4 A;  5JAC A;  2JD8 0;  3RBC A;  1JI5 A;  1MFR A;  3AK9 A;  4M32 A;  1RCI A;  5J8S A;  2W0O A;  4KVQ A;  2CN7 A;  3QD8 A;  2VXX A;  4XKT A;  5JKL A;  3HIU A;  5K53 A;  3UNO A;  3R2K A;  3FVB A;  4CYA A;  2IU2 A;  2ZG8 X;  5IX6 A;  1NFV A;  2Y3Q A;  1RCG A;  2ZUR X;  3WVU A;  2WLA A;  4DI0 A;  4DE6 A;  2IB0 A;  4TOD A;  2OC5 A;  1O9R A;  3OJ5 A;  4TOB A;  4DYU A;  4MY7 A;  3R2S A;  3PWF A;  3SE1 A;  5C6F A;  3KA9 A;  3R2L A;  3Q4N A;  1VJX A;  1S30 A;  2CF7 A;  3WVW A;  2FKZ A;  2V2O A;  4ZJK A;  4TOG A;  4M35 A;  4LQN A;  3GHQ A;  4LYU A;  1LKM A;  4DYZ A;  3F34 A;  4R42 A;  3E1O A;  5D8S A;  3BVF A;  3EZ0 A;  5LG8 A;  1JGC A;  5JKM A;  2QQY A;  3KA4 A;  2V2I A;  3R2H A;  4TW3 A;  1YV1 A;  2V2R A;  1LB3 A;  1NNQ A;  1DVB A;  5E1U A;  3SH6 A;  3QHC A;  3R2R A;  2HTN A;  3AF9 X;  4AM5 A;  3AF7 X;  3WNW A;  1KRQ A;  2PYB A;  4RC7 B;  3KA8 A;  1NF4 A;  2Z90 A;  1BFR A;  3FI6 A;  4MKU A;  5I4J A;  2V2P A;  4LQV A;  3NP2 X;  4ZLW A;  5GU2 X;  4ERU A;  1RYT A;  1L8I A;  4XKU A;  1JIG A;  2Z5P A;  3ERZ A;  3PW1 A;  3SID A;  1RCD A;  3MPS A;  4IXK A;  1EUM A;  1JTS A;  5JKM G;  5LS9 A;  3PW1 B;  1FHA A;  1BG7 A;  2X17 0;  1J30 A;  3PWQ C;  5J93 A;  3UOI A;  3SHX A;  4ITW A;  2XJN A;  3AJO A;  5CMQ A;  1VEI A;  1N1Q A;  1Z4A A;  1ZS3 A;  4EVC A;  3GVY A;  3PW8 C;  4CVS A;  4KVR A;  4ISP A;  4CYB A;  4CMY V;  2FHA A;  2GYQ A;  1VEQ A;  5HJH A;  3PVT A;  1H96 A;  5FFC A;  3AJQ A;  2YJJ A;  3PVT B;  2ZA8 A;  1JYB A;  4TOH A;  1MOJ A;  4AM2 A;  2Z5R A;  4E6K A;  3BVK A;  3ISF A;  2IY4 A;  5FFE A;  3KWO A;  4PGI A;  3AJP A;  2ITB A;  3KXU A;  4IWJ A;  4A25 A;  3A9Q A;  3QVD A;  3F35 A;  4DZ0 A;  4PGK A;  4QUW A;  3Q4Q A;  4U3G A;  2ZA6 A;  5HJF A;  2BK6 A;  3KA3 A;  3F39 A;  3BKN A;  2CHI A;  4TO9 A;  2JD7 0;  5FFB A;  3E1M A;  4CMY A;  3PVR A;  1QGH A;  2VXI A;  4AM4 A;  3PVR B;  2FL0 A;  1RCC A;  4ZKH A;  4TOA A;  1ZUJ A;  2CLU A;  4Z3B A;  1YUX A;  1LKO A;  1S3Q A;  5J9V A;  3OGH A;  2C6R A;  2GS4 A;  2CHP A;  4Y08 A;  1LKP A;  2V15 A;  3FSE A;  3PWQ A;  3IQ1 A;  4CVR A;  1B71 A;  5FFD A;  1F33 A;  4ISM A;  3PVY A;  3Q4O A;  5CZU A;  3E1L A;  1TJO A;  5ERK A;  2V2L A;  3F37 A;  3PVY B;  5LG2 A;  4TOC A;  2G4H A;  2FG8 A;  4XGS A;  4MN9 A;  3UOF A;  4Z5S A;  1VEL A;  4LYX A;  2V2J A;  5HQO A;  4LQJ A;  1JKV A;  3RAV A;  2BW1 A;  1R03 A;  4PG1 A;  3Q4R A;  4RC8 A;  1DAT A;  1BCF A;  4M34 A;  3A68 A;  3AK8 A;  2VZB A;  3E1P A;  2C2F A;  3BT5 A;  4KVS A;  4EVE A;  3RE7 A;  2F7N A;  3QHB A;  2D5K A;  4ITT A;  2BKC A;  2XJM A;  1Z6O M;  2ZG9 X;  4MJY A;  4P18 A;  3NOZ X;  5D8Q A;  3HL1 A;  2RBD A;  3IS8 A;  4CVP A;  1OTK A;  3EGM A;  5FEJ A;  5GN8 A;  4TOE A;  1F30 A;  1JI4 A;  1XZ3 A;  3ISE A;  3IS7 A;  2V2N A;  4ZTT A;  2CIH A;  5GN8 B;  2JD6 0;  1IER A;  4OYN A;  3QB9 A;  3F33 A;  2XJO A;  3E1N A;  3R2M A;  5GU1 X;  1QYB A;  4ZL6 A;  3KA6 A;  3PZA A;  3R2O A;  4ZL5 A;  5D8Y A;  1SQ3 A;  2ZA7 A;  1Z6O A;  5K52 A;  5FFA A;  4RC6 A;  5D8P A;  4REU A;  2FG4 A;  5GOU A;  2YW6 A;  5ERJ A;  4RC6 B;  3EZU A;  3H7G A;  2GYD A;  5D8O A;  3BVI A;  4DYX A;  4EVB A;  2CLB A;  5CMR A;  1L8H A;  4LPN A;  5GU0 X; 
#chains in the Genus database with same CATH topology
 3O7S A;  3F36 A;  3RD0 A;  3BVE A;  2BJY A;  2Z5Q A;  2YJK A;  1IES A;  1UMN A;  4LQH A;  1HRS A;  2Y44 A;  1TKP A;  2V2S A;  3F38 A;  3WVV A;  4LPM A;  2ZG7 X;  1SOF A;  2AR0 A;  5JKL G;  4IWK A;  3NP0 X;  5J8W A;  3PW8 A;  2C2U A;  3ES3 A;  1O9I A;  4ZKW A;  2Z6M A;  3E1Q A;  4ZKX A;  1UVH A;  2FFX J;  2XGW A;  3U90 A;  3JZA B;  3KX9 A;  4W4L B;  2FJC A;  1VLG A;  3W54 A;  1S2Z A;  4YKH A;  4CY9 A;  2C41 A;  1NF6 A;  2YW7 A;  3E6R A;  4YXM A;  1TKO A;  4RC7 A;  4PG0 A;  2MGY A;  2CN6 A;  5D8X A;  2WTL A;  3O7R A;  4ZMC A;  4WJG 4;  3AF8 X;  2FZF A;  4LPJ A;  3VNX A;  3RGD A;  4DYY A;  5GU3 X;  3E6S A;  1TK6 A;  1YUZ A;  4TOF A;  3TA8 A;  3F32 A;  1JKU A;  1RCE A;  3E1J A;  5AXS A;  5LBH A;  3T9J A;  2XKQ A;  2WLU A;  3D19 A;  4II4 A;  5D8R A;  2C2J A;  3QZ3 A;  4RC5 A;  2OH3 A;  5E2D A;  2CWL A;  1DPS A;  4II4 B;  2CEI A;  2UX1 A;  4ETR A;  2HR5 A;  1GWG A;  4RC5 B;  4CVT A;  4EVD A;  3E2C A;  1JRE A;  4XKS A;  1AEW A;  5HU6 D;  4DAS A;  4ML5 A;  4MUD A;  1XZ1 A;  2V2M A;  4KXR B;  2QF9 A;  3BVL A;  4M33 A;  3GE4 A;  5JAC A;  2JD8 0;  3RBC A;  1JI5 A;  1MFR A;  3AK9 A;  4M32 A;  3VV9 A;  1RCI A;  5J8S A;  2W0O A;  4KVQ A;  2CN7 A;  3QD8 A;  2VXX A;  4XKT A;  5JKL A;  3HIU A;  2N02 A;  3M6J A;  5K53 A;  3UNO A;  3R2K A;  3FVB A;  4CYA A;  2IU2 A;  2ZG8 X;  2OKC A;  5IX6 A;  1NFV A;  2Y3Q A;  1RCG A;  2ZUR X;  3WVU A;  2WLA A;  4DI0 A;  4DE6 A;  2IB0 A;  4TOD A;  2OC5 A;  1O9R A;  3OJ5 A;  4TOB A;  4DYU A;  4MY7 A;  3R2S A;  3PWF A;  3SE1 A;  5C6F A;  3KA9 A;  3R2L A;  3Q4N A;  1VJX A;  1S30 A;  4MXP A;  2CF7 A;  3WVW A;  3DBY A;  2FKZ A;  2V2O A;  4ZJK A;  4TOG A;  4M35 A;  4LQN A;  3GHQ A;  4LYU A;  1LKM A;  3C1Z A;  4DYZ A;  3F34 A;  4R42 A;  3E1O A;  5D8S A;  3BVF A;  3EZ0 A;  5LG8 A;  1JGC A;  5JKM A;  2QQY A;  3KA4 A;  2V2I A;  3R2H A;  4TW3 A;  1YV1 A;  2V2R A;  1LB3 A;  1NNQ A;  1DVB A;  5E1U A;  3SH6 A;  3QHC A;  3R2R A;  2HTN A;  3AF9 X;  4AM5 A;  3AF7 X;  3FRS A;  3WNW A;  1KRQ A;  2PYB A;  4RC7 B;  3KA8 A;  1NF4 A;  2Z90 A;  1BFR A;  3FI6 A;  4MKU A;  5I4J A;  2V2P A;  4LQV A;  3NP2 X;  3GGZ A;  5GU2 X;  4ZLW A;  4ERU A;  1RYT A;  1L8I A;  4XKU A;  1JIG A;  2WWX B;  2Z5P A;  3ERZ A;  3PW1 A;  3SID A;  1RCD A;  3MPS A;  4IXK A;  1EUM A;  1JTS A;  5JKM G;  5LS9 A;  3PW1 B;  1FHA A;  1BG7 A;  2X17 0;  1J30 A;  3PWQ C;  5J93 A;  3UOI A;  3SHX A;  4ITW A;  2XJN A;  3AJO A;  5CMQ A;  1VEI A;  3V3K B;  1N1Q A;  4E40 A;  1Z4A A;  1ZS3 A;  3C1Y A;  4EVC A;  3GVY A;  3PW8 C;  4CVS A;  4KVR A;  4ISP A;  4CYB A;  4CMY V;  2FHA A;  2GYQ A;  1VEQ A;  5HJH A;  3PVT A;  3L0M A;  1H96 A;  5FFC A;  3UFB A;  3AJQ A;  2YJJ A;  3PVT B;  2ZA8 A;  1JYB A;  4TOH A;  4YXJ A;  1MOJ A;  4AM2 A;  2Z5R A;  4E6K A;  3BVK A;  3ISF A;  2IY4 A;  5FFE A;  3KWO A;  4PGI A;  3AJP A;  2ITB A;  3KXU A;  4IWJ A;  4A25 A;  3A9Q A;  3QVD A;  3F35 A;  4DZ0 A;  4PGK A;  4QUW A;  3Q4Q A;  4U3G A;  4X0J A;  2ZA6 A;  5HJF A;  3VVA A;  2BK6 A;  3KA3 A;  3F39 A;  3BKN A;  2CHI A;  4TO9 A;  2JD7 0;  5FFB A;  3E1M A;  4CMY A;  3PVR A;  1QGH A;  2VXI A;  2G38 B;  4AM4 A;  3PVR B;  2FL0 A;  1RCC A;  4ZKH A;  4TOA A;  1ZUJ A;  2CLU A;  3N6O A;  4Z3B A;  1YUX A;  1LKO A;  1S3Q A;  5J9V A;  3OGH A;  2C6R A;  2GS4 A;  2CHP A;  4Y08 A;  1LKP A;  4W4K B;  2V15 A;  3FSE A;  3PWQ A;  3IQ1 A;  4CVR A;  1B71 A;  3GGY A;  5FFD A;  1F33 A;  3KHK A;  3JZ9 A;  4ISM A;  3PVY A;  3Q4O A;  5CZU A;  3E1L A;  1TJO A;  5ERK A;  2V2L A;  3F37 A;  3PVY B;  5LG2 A;  4TOC A;  2G4H A;  2FG8 A;  4XGS A;  4MN9 A;  3UOF A;  4Z5S A;  1VEL A;  4LYX A;  2V2J A;  5HQO A;  4LQJ A;  1JKV A;  3RAV A;  2BW1 A;  1R03 A;  4PG1 A;  3Q4R A;  4RC8 A;  1DAT A;  1BCF A;  4M34 A;  3A68 A;  3AK8 A;  3LKD A;  2VZB A;  3E1P A;  2C2F A;  3BT5 A;  4KVS A;  4EVE A;  3RE7 A;  2F7N A;  3QHB A;  2D5K A;  4ITT A;  2BKC A;  2XJM A;  1Z6O M;  2ZG9 X;  3KDQ A;  4MJY A;  4P18 A;  3NOZ X;  5D8Q A;  3HL1 A;  2RBD A;  2V8U A;  3IS8 A;  3C23 A;  4CVP A;  1OTK A;  3EGM A;  5FEJ A;  5GN8 A;  4TOE A;  1F30 A;  1JI4 A;  1XZ3 A;  3ISE A;  3IS7 A;  2V2N A;  4ZTT A;  2CIH A;  5GN8 B;  2JD6 0;  1IER A;  4OYN A;  3QB9 A;  3F33 A;  2XJO A;  5JDO A;  3E1N A;  3R2M A;  5GU1 X;  4YVZ A;  2V8T A;  1QYB A;  4ZL6 A;  3KA6 A;  3PZA A;  5JDO B;  3R2O A;  3FRR A;  5D8Y A;  1SQ3 A;  2ZA7 A;  4ZL5 A;  1Z6O A;  5K52 A;  5FFA A;  4RC6 A;  5D8P A;  4REU A;  2FG4 A;  5GOU A;  2YW6 A;  5ERJ A;  4RC6 B;  3C21 A;  3EZU A;  3H7G A;  2GYD A;  5D8O A;  3BVI A;  4DYX A;  4EVB A;  2CLB A;  5CMR A;  1L8H A;  4LPN A;  5GU0 X; 
#chains in the Genus database with same CATH homology
 3O7S A;  3F36 A;  3RD0 A;  3BVE A;  2BJY A;  2Z5Q A;  2YJK A;  1IES A;  1UMN A;  4LQH A;  1HRS A;  2Y44 A;  1TKP A;  2V2S A;  3F38 A;  3WVV A;  4LPM A;  2ZG7 X;  1SOF A;  2AR0 A;  5JKL G;  4IWK A;  3NP0 X;  5J8W A;  3PW8 A;  2C2U A;  3ES3 A;  1O9I A;  4ZKW A;  2Z6M A;  3E1Q A;  4ZKX A;  1UVH A;  2FFX J;  2XGW A;  3U90 A;  3JZA B;  3KX9 A;  4W4L B;  2FJC A;  1VLG A;  3W54 A;  1S2Z A;  4YKH A;  4CY9 A;  2C41 A;  1NF6 A;  2YW7 A;  3E6R A;  4YXM A;  1TKO A;  4RC7 A;  4PG0 A;  2MGY A;  2CN6 A;  5D8X A;  2WTL A;  3O7R A;  4ZMC A;  4WJG 4;  3AF8 X;  2FZF A;  4LPJ A;  3VNX A;  3RGD A;  4DYY A;  5GU3 X;  3E6S A;  1TK6 A;  1YUZ A;  4TOF A;  3TA8 A;  3F32 A;  1JKU A;  1RCE A;  3E1J A;  5AXS A;  5LBH A;  3T9J A;  2XKQ A;  2WLU A;  3D19 A;  4II4 A;  5D8R A;  2C2J A;  3QZ3 A;  4RC5 A;  2OH3 A;  5E2D A;  2CWL A;  1DPS A;  4II4 B;  2CEI A;  2UX1 A;  4ETR A;  2HR5 A;  1GWG A;  4RC5 B;  4CVT A;  4EVD A;  3E2C A;  1JRE A;  4XKS A;  1AEW A;  5HU6 D;  4DAS A;  4ML5 A;  4MUD A;  1XZ1 A;  2V2M A;  4KXR B;  2QF9 A;  3BVL A;  4M33 A;  3GE4 A;  5JAC A;  2JD8 0;  3RBC A;  1JI5 A;  1MFR A;  3AK9 A;  4M32 A;  3VV9 A;  1RCI A;  5J8S A;  2W0O A;  4KVQ A;  2CN7 A;  3QD8 A;  2VXX A;  4XKT A;  5JKL A;  3HIU A;  2N02 A;  3M6J A;  5K53 A;  3UNO A;  3R2K A;  3FVB A;  4CYA A;  2IU2 A;  2ZG8 X;  2OKC A;  5IX6 A;  1NFV A;  2Y3Q A;  1RCG A;  2ZUR X;  3WVU A;  2WLA A;  4DI0 A;  4DE6 A;  2IB0 A;  4TOD A;  2OC5 A;  1O9R A;  3OJ5 A;  4TOB A;  4DYU A;  4MY7 A;  3R2S A;  3PWF A;  3SE1 A;  5C6F A;  3KA9 A;  3R2L A;  3Q4N A;  1VJX A;  1S30 A;  4MXP A;  2CF7 A;  3WVW A;  3DBY A;  2FKZ A;  2V2O A;  4ZJK A;  4TOG A;  4M35 A;  4LQN A;  3GHQ A;  4LYU A;  1LKM A;  3C1Z A;  4DYZ A;  3F34 A;  4R42 A;  3E1O A;  5D8S A;  3BVF A;  3EZ0 A;  5LG8 A;  1JGC A;  5JKM A;  2QQY A;  3KA4 A;  2V2I A;  3R2H A;  4TW3 A;  1YV1 A;  2V2R A;  1LB3 A;  1NNQ A;  1DVB A;  5E1U A;  3SH6 A;  3QHC A;  3R2R A;  2HTN A;  3AF9 X;  4AM5 A;  3AF7 X;  3FRS A;  3WNW A;  1KRQ A;  2PYB A;  4RC7 B;  3KA8 A;  1NF4 A;  2Z90 A;  1BFR A;  3FI6 A;  4MKU A;  5I4J A;  2V2P A;  4LQV A;  3NP2 X;  3GGZ A;  5GU2 X;  4ZLW A;  4ERU A;  1RYT A;  1L8I A;  4XKU A;  1JIG A;  2WWX B;  2Z5P A;  3ERZ A;  3PW1 A;  3SID A;  1RCD A;  3MPS A;  4IXK A;  1EUM A;  1JTS A;  5JKM G;  5LS9 A;  3PW1 B;  1FHA A;  1BG7 A;  2X17 0;  1J30 A;  3PWQ C;  5J93 A;  3UOI A;  3SHX A;  4ITW A;  2XJN A;  3AJO A;  5CMQ A;  1VEI A;  3V3K B;  1N1Q A;  4E40 A;  1Z4A A;  1ZS3 A;  3C1Y A;  4EVC A;  3GVY A;  3PW8 C;  4CVS A;  4KVR A;  4ISP A;  4CYB A;  4CMY V;  2FHA A;  2GYQ A;  1VEQ A;  5HJH A;  3PVT A;  3L0M A;  1H96 A;  5FFC A;  3UFB A;  3AJQ A;  2YJJ A;  3PVT B;  2ZA8 A;  1JYB A;  4TOH A;  4YXJ A;  1MOJ A;  4AM2 A;  2Z5R A;  4E6K A;  3BVK A;  3ISF A;  2IY4 A;  5FFE A;  3KWO A;  4PGI A;  3AJP A;  2ITB A;  3KXU A;  4IWJ A;  4A25 A;  3A9Q A;  3QVD A;  3F35 A;  4DZ0 A;  4PGK A;  4QUW A;  3Q4Q A;  4U3G A;  4X0J A;  2ZA6 A;  5HJF A;  3VVA A;  2BK6 A;  3KA3 A;  3F39 A;  3BKN A;  2CHI A;  4TO9 A;  2JD7 0;  5FFB A;  3E1M A;  4CMY A;  3PVR A;  1QGH A;  2VXI A;  2G38 B;  4AM4 A;  3PVR B;  2FL0 A;  1RCC A;  4ZKH A;  4TOA A;  1ZUJ A;  2CLU A;  3N6O A;  4Z3B A;  1YUX A;  1LKO A;  1S3Q A;  5J9V A;  3OGH A;  2C6R A;  2GS4 A;  2CHP A;  4Y08 A;  1LKP A;  4W4K B;  2V15 A;  3FSE A;  3PWQ A;  3IQ1 A;  4CVR A;  1B71 A;  3GGY A;  5FFD A;  1F33 A;  3KHK A;  3JZ9 A;  4ISM A;  3PVY A;  3Q4O A;  5CZU A;  3E1L A;  1TJO A;  5ERK A;  2V2L A;  3F37 A;  3PVY B;  5LG2 A;  4TOC A;  2G4H A;  2FG8 A;  4XGS A;  4MN9 A;  3UOF A;  4Z5S A;  1VEL A;  4LYX A;  2V2J A;  5HQO A;  4LQJ A;  1JKV A;  3RAV A;  2BW1 A;  1R03 A;  4PG1 A;  3Q4R A;  4RC8 A;  1DAT A;  1BCF A;  4M34 A;  3A68 A;  3AK8 A;  3LKD A;  2VZB A;  3E1P A;  2C2F A;  3BT5 A;  4KVS A;  4EVE A;  3RE7 A;  2F7N A;  3QHB A;  2D5K A;  4ITT A;  2BKC A;  2XJM A;  1Z6O M;  2ZG9 X;  3KDQ A;  4MJY A;  4P18 A;  3NOZ X;  5D8Q A;  3HL1 A;  2RBD A;  2V8U A;  3IS8 A;  3C23 A;  4CVP A;  1OTK A;  3EGM A;  5FEJ A;  5GN8 A;  4TOE A;  1F30 A;  1JI4 A;  1XZ3 A;  3ISE A;  3IS7 A;  2V2N A;  4ZTT A;  2CIH A;  5GN8 B;  2JD6 0;  1IER A;  4OYN A;  3QB9 A;  3F33 A;  2XJO A;  5JDO A;  3E1N A;  3R2M A;  5GU1 X;  4YVZ A;  2V8T A;  1QYB A;  4ZL6 A;  3KA6 A;  3PZA A;  5JDO B;  3R2O A;  3FRR A;  5D8Y A;  1SQ3 A;  2ZA7 A;  4ZL5 A;  1Z6O A;  5K52 A;  5FFA A;  4RC6 A;  5D8P A;  4REU A;  2FG4 A;  5GOU A;  2YW6 A;  5ERJ A;  4RC6 B;  3C21 A;  3EZU A;  3H7G A;  2GYD A;  5D8O A;  3BVI A;  4DYX A;  4EVB A;  2CLB A;  5CMR A;  1L8H A;  4LPN A;  5GU0 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...