2D5KA

Crystal structure of dps from staphylococcus aureus
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
148
structure length
148
Chain Sequence
SNQQDVVKELNQQVANWTVAYTKLHNFHWYVKGPNFFSLHVKFEELYNEASQYVDELAERILAVGGNPVGTLTECLEQSIVKEAAKGYSAEQMVEELSQDFTNISKQLENAIEIAGNAGDDVSEDMFIGMQTSVDKHNWMFKSYLSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dps family protein
publication title Nucleoid compaction by MrgA(Asp56Ala/Glu60Ala) does not contribute to staphylococcal cell survival against oxidative stress and phagocytic killing by macrophages
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Metal binding protein
total genus 66
structure length 148
sequence length 148
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.52: Transferred entry: 4.3.3.7.
pdb deposition date 2005-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2d5kA00
4II4A 1JKUA 4LPNA 1LKOA 2FKZA 1O9RA 4AM5A 4CYBA 4TOCA 3E6SA 2JD60 3ES3A 1LB3A 3AF9X 5HJHA 4MUDA 2YJJA 2V2SA 3PW1B 4ISMA 3EZUA 2CLBA 3E1JA 5D8XA 3R2SA 2V2MA 4AM4A 1FHAA 1S30A 3AJOA 5I4JA 5FFDA 3R2LA 4TOAA 1VEIA 1DATA 2PYBA 2C2JA 5IX6A 3E1OA 3AF8X 3F39A 1IERA 4ZLWA 3PZAA 4M32A 3IQ1A 2IU2A 4EVDA 2V2LA 4CVRA 4ML5A 5JKMG 3R2MA 2QF9A 1RCEA 3SIDA 3QHBA 2W0OA 4ZKWA 1NF4A 4TODA 5J8SA 3BKNA 2V2PA 4EVBA 2Z90A 1R03A 2FZFA 4KVRA 5D8RA 2F7NA 5AXSA 2CN7A 4CYAA 5CMRA 4Y08A 3RAVA 4M33A 2HR5A 2BK6A 1S3QA 4LQVA 4CVSA 1MOJA 4TOBA 3RD0A 4QUWA 4DASA 1F33A 1YUZA 4Z5SA 5FFCA 3O7RA 5LG8A 1GWGA 5FFBA 2IY4A 5JKLA 2CEIA 4A25A 5GU3X 5E2DA 3NOZX 3VNXA 2YW7A 3F38A 5LS9A 2WLUA 1JTSA 4KVSA 4CVPA 4ZJKA 3ERZA 2XJNA 1SOFA 3BVKA 2Y3QA 2ITBA 4ZMCA 1VELA 2JD80 3AK9A 3RBCA 2ZURX 3IS8A 3R2KA 3RE7A 3MPSA 5D8OA 4ERUA 5D8PA 4CMYV 4R42A 2YW6A 2WTLA 1H96A 5CZUA 3QZ3A 3F37A 4ZKXA 4PG1A 2VXIA 4ETRA 3E1QA 1O9IA 1JYBA 2XJOA 4TOEA 1DVBA 3E1LA 3KA6A 4XGSA 3FI6A 3PWFA 3O7SA 4RC6A 1TKOA 2V2IA 2FG8A 3NP2X 2ZA8A 4MKUA 4ISPA 3Q4OA 4LPMA 5LG2A 4AM2A 4CMYA 3AJPA 4ITWA 4IXKA 4XKUA 2FL0A 2CF7A 3UOIA 2Z6MA 3PWQA 1IESA 2ZG9X 2V2JA 3Q4QA 3WNWA 3E2CA 3FVBA 1JIGA 2JD70 1XZ3A 4DZ0A 2OH3A 4OYNA 4DYXA 2WLAA 3ISEA 4ZL6A 2XGWA 3SE1A 4U3GA 2OC5A 2X170 4CY9A 3KWOA 3R2OA 4RC6B 4LYUA 4TOGA 1YUXA 4LQNA 1VJXA 5CMQA 5J8WA 4DE6A 2CIHA 3UNOA 4PG0A 4LYXA 3EGMA 4DYUA 5HJFA 3PW8A 2BW1A 2IB0A 4TOHA 4ITTA 3AK8A 2Z5QA 3IS7A 4ZL5A 1BG7A 3H7GA 2CLUA 1XZ1A 1QGHA 2Z5RA 4RC8A 1JI4A 2FHAA 3GHQA 5JKMA 1Z6OM 4KVQA 4EVCA 3PVYA 1YV1A 3WVVA 3QVDA 3FSEA 1MFRA 3WVUA 5K53A 4MJYA 2V2RA 4PGKA 4RC5A 3KX9A 5D8YA 3HIUA 1RCCA 3PWQC 3R2HA 4TOFA 4DI0A 3SHXA 3BVLA 2GYDA 3KXUA 2YJKA 3Q4RA 2Z5PA 4DYZA 3NP0X 5ERJA 2V2OA 1JI5A 2CN6A 3F36A 3T9JA 3A9QA 1TJOA 1B71A 3PVYB 3KA9A 2CHPA 5FFEA 3F34A 2ZG7X 1JREA 1Z4AA 1UMNA 4RC5B 5GU2X 3U90A 4E6KA 3PVTA 4YKHA 4XKTA 1ZS3A 3A68A 3GE4A 3HL1A 2BJYA 4DYYA 4Z3BA 2BKCA 5GN8A 5GOUA 3PW8C 3EZ0A 2FFXJ 5C6FA 2G4HA 2GYQA 2D5KA 2RBDA 3QB9A 3WVWA 3OJ5A 4LQHA 4TO9A 5K52A 3BVEA 4IWJA 1LKPA 3E1PA 3KA4A 3AJQA 1RCDA 1S2ZA 5FEJA 1DPSA 5D8SA 2XJMA 3E1NA 4CVTA 3ISFA 4RC7A 2FJCA 5FFAA 1NFVA 4P18A 4II4B 3PVTB 1HRSA 3TA8A 2CHIA 2ZA7A 1RCGA 2C41A 2V15A 3PVRA 4REUA 1OTKA 5GU0X 1NF6A 3OGHA 5GN8B 1L8IA 1L8HA 2C6RA 1QYBA 5LBHA 3E1MA 4M34A 5J9VA 4LQJA 5JACA 3RGDA 4MY7A 2GS4A 1LKMA 4ZTTA 5JKLG 4TW3A 1NNQA 1SQ3A 4IWKA 3BVFA 3UOFA 1JKVA 2C2UA 3BT5A 2UX1A 4M35A 3KA8A 4MN9A 4RC7B 4ZKHA 3BVIA 1AEWA 3R2RA 2VZBA 4LPJA 3GVYA 3PVRB 1RCIA 1ZUJA 4XKSA 1RYTA 5E1UA 1N1QA 4EVEA 3F35A 1BCFA 1TK6A 5D8QA 1J30A 5J93A 2C2FA 3SH6A 1Z6OA 3PW1A 1KRQA 1BFRA 2VXXA 5ERKA 3F32A 3Q4NA 2FG4A 1F30A 3F33A 1TKPA 5HQOA 1VEQA 2ZG8X 1JGCA 3QHCA 2XKQA 2ZA6A 1UVHA 1VLGA 2V2NA 3KA3A 4PGIA 2HTNA 5GU1X 3QD8A 3AF7X 3E6RA 2QQYA 1EUMA
chains in the Genus database with same CATH superfamily
4II4A 1JKUA 4LPNA 1LKOA 3D19A 2FKZA 1O9RA 4AM5A 4CYBA 4TOCA 3E6SA 2JD60 3ES3A 1LB3A 3AF9X 2OKCA 5HJHA 4MUDA 2YJJA 2V2SA 3PW1B 3UFBA 4ISMA 3EZUA 2CLBA 3E1JA 5D8XA 3R2SA 2V2MA 4AM4A 1FHAA 1S30A 3AJOA 5I4JA 4YVZA 5FFDA 3R2LA 4TOAA 1VEIA 1DATA 2PYBA 2C2JA 5IX6A 3E1OA 3AF8X 3F39A 1IERA 4ZLWA 3PZAA 2Y44A 3C23A 3IQ1A 2IU2A 4M32A 4EVDA 2V2LA 4W4LB 4CVRA 4ML5A 5JKMG 3R2MA 2QF9A 1RCEA 3SIDA 3GGZA 3QHBA 2W0OA 4ZKWA 3N6OA 1NF4A 4TODA 5J8SA 3BKNA 2V2PA 4EVBA 2Z90A 1R03A 2FZFA 4KVRA 5D8RA 2F7NA 5AXSA 2CN7A 4CYAA 5CMRA 4Y08A 3KHKA 3RAVA 4M33A 2HR5A 2BK6A 1S3QA 4LQVA 4CVSA 1MOJA 4TOBA 3RD0A 4QUWA 4DASA 1F33A 1YUZA 4Z5SA 5FFCA 3O7RA 5LG8A 2V8UA 1GWGA 5FFBA 2IY4A 5JKLA 2CEIA 4A25A 5GU3X 5E2DA 3NOZX 3VNXA 2YW7A 3F38A 5LS9A 2WLUA 1JTSA 4KVSA 4CVPA 4ZJKA 3ERZA 2XJNA 1SOFA 3BVKA 2Y3QA 2ITBA 2N02A 3C1ZA 4ZMCA 1VELA 2JD80 3AK9A 3RBCA 2ZURX 3IS8A 3R2KA 3RE7A 3MPSA 5D8OA 4ERUA 5D8PA 4CMYV 4R42A 2YW6A 3KDQA 2WTLA 1H96A 3FRSA 5CZUA 3QZ3A 3F37A 4ZKXA 2VXIA 4PG1A 4ETRA 3E1QA 1O9IA 1JYBA 2XJOA 4TOEA 1DVBA 3E1LA 3KA6A 4XGSA 3FI6A 2MGYA 3JZAB 3O7SA 3PWFA 3C21A 4RC6A 3VVAA 1TKOA 2V2IA 2FG8A 3NP2X 2ZA8A 4MKUA 4ISPA 3Q4OA 4LPMA 5LG2A 4AM2A 4CMYA 3AJPA 4ITWA 4IXKA 4XKUA 2FL0A 2CF7A 3UOIA 2Z6MA 3PWQA 1IESA 2ZG9X 2V2JA 3Q4QA 3WNWA 3E2CA 3FVBA 1JIGA 4MXPA 2JD70 1XZ3A 4DZ0A 2OH3A 4OYNA 4DYXA 2WLAA 3ISEA 4ZL6A 2XGWA 3SE1A 4U3GA 4X0JA 2OC5A 2X170 4CY9A 3KWOA 3R2OA 4RC6B 4LYUA 4TOGA 1YUXA 4LQNA 1VJXA 5CMQA 5J8WA 4DE6A 2CIHA 3UNOA 4PG0A 4LYXA 3EGMA 4DYUA 5HJFA 3PW8A 2BW1A 2IB0A 4TOHA 4WJG4 4ITTA 3AK8A 2Z5QA 3IS7A 4ZL5A 1BG7A 3H7GA 2CLUA 1XZ1A 1QGHA 2Z5RA 4RC8A 4KXRB 1JI4A 2FHAA 3GHQA 5JKMA 1Z6OM 3JZ9A 5HU6D 2V8TA 4KVQA 3PVYA 4EVCA 1YV1A 3WVVA 3QVDA 3FSEA 1MFRA 3WVUA 4YXMA 5K53A 4MJYA 2V2RA 4PGKA 4RC5A 3KX9A 5D8YA 3HIUA 3V3KB 1RCCA 3PWQC 3R2HA 4TOFA 4DI0A 3SHXA 4W4KB 3BVLA 2GYDA 3KXUA 2YJKA 3Q4RA 2Z5PA 4DYZA 3NP0X 5ERJA 2V2OA 1JI5A 2CN6A 3F36A 3T9JA 3A9QA 4E40A 5JDOA 1TJOA 1B71A 3PVYB 3KA9A 3C1YA 2CHPA 3GGYA 4YXJA 5FFEA 3F34A 2ZG7X 1JREA 1Z4AA 1UMNA 3L0MA 4RC5B 5GU2X 3U90A 3VV9A 3W54A 4E6KA 3PVTA 3M6JA 4YKHA 4XKTA 1ZS3A 3A68A 3GE4A 3HL1A 2BJYA 4DYYA 4Z3BA 2BKCA 5GN8A 3LKDA 2G38B 5GOUA 3PW8C 2WWXB 3EZ0A 2FFXJ 5C6FA 2G4HA 2GYQA 2D5KA 2RBDA 3QB9A 3WVWA 3OJ5A 4LQHA 4TO9A 5K52A 3BVEA 4IWJA 1LKPA 5JDOB 3E1PA 3KA4A 3AJQA 1RCDA 1S2ZA 5FEJA 1DPSA 2CWLA 5D8SA 2XJMA 3E1NA 4CVTA 3ISFA 4RC7A 2FJCA 5FFAA 1NFVA 4P18A 4II4B 3PVTB 1HRSA 3TA8A 2CHIA 2ZA7A 1RCGA 2C41A 2V15A 3PVRA 4REUA 1OTKA 5GU0X 1NF6A 3OGHA 5GN8B 1L8IA 1L8HA 2C6RA 1QYBA 5LBHA 3E1MA 4M34A 5J9VA 4LQJA 5JACA 3RGDA 4MY7A 2GS4A 1LKMA 4ZTTA 5JKLG 4TW3A 1NNQA 2AR0A 1SQ3A 4IWKA 3BVFA 3UOFA 1JKVA 2C2UA 3BT5A 2UX1A 4M35A 3KA8A 4MN9A 4RC7B 4ZKHA 3BVIA 1AEWA 3R2RA 2VZBA 4LPJA 3GVYA 3PVRB 1RCIA 1ZUJA 3DBYA 4XKSA 1RYTA 5E1UA 1N1QA 4EVEA 3FRRA 3F35A 1BCFA 1TK6A 5D8QA 1J30A 5J93A 2C2FA 3SH6A 1Z6OA 3PW1A 1KRQA 1BFRA 2VXXA 5ERKA 3F32A 3Q4NA 2FG4A 1F30A 3F33A 1TKPA 5HQOA 1VEQA 2ZG8X 1JGCA 3QHCA 2XKQA 2ZA6A 1UVHA 1VLGA 2V2NA 3KA3A 4PGIA 2HTNA 5GU1X 3QD8A 3AF7X 3E6RA 2QQYA 1EUMA
chains in the Genus database with same CATH topology
4II4A 1JKUA 4LPNA 1LKOA 3D19A 2FKZA 1O9RA 4AM5A 4CYBA 4TOCA 3E6SA 2JD60 3ES3A 1LB3A 3AF9X 2OKCA 5HJHA 4MUDA 2YJJA 2V2SA 3PW1B 3UFBA 4ISMA 3EZUA 2CLBA 3E1JA 5D8XA 3R2SA 2V2MA 4AM4A 1FHAA 1S30A 3AJOA 5I4JA 4YVZA 5FFDA 3R2LA 4TOAA 1VEIA 1DATA 2PYBA 2C2JA 5IX6A 3E1OA 3AF8X 3F39A 1IERA 4ZLWA 3PZAA 2Y44A 3C23A 3IQ1A 2IU2A 4M32A 4EVDA 2V2LA 4W4LB 4CVRA 4ML5A 5JKMG 3R2MA 2QF9A 1RCEA 3SIDA 3GGZA 3QHBA 2W0OA 4ZKWA 3N6OA 1NF4A 4TODA 5J8SA 3BKNA 2V2PA 4EVBA 2Z90A 1R03A 2FZFA 4KVRA 5D8RA 2F7NA 5AXSA 2CN7A 4CYAA 5CMRA 4Y08A 3KHKA 3RAVA 4M33A 2HR5A 2BK6A 1S3QA 4LQVA 4CVSA 1MOJA 4TOBA 3RD0A 4QUWA 4DASA 1F33A 1YUZA 4Z5SA 5FFCA 3O7RA 5LG8A 2V8UA 1GWGA 5FFBA 2IY4A 5JKLA 2CEIA 4A25A 5GU3X 5E2DA 3NOZX 3VNXA 2YW7A 3F38A 5LS9A 2WLUA 1JTSA 4KVSA 4CVPA 4ZJKA 3ERZA 2XJNA 1SOFA 3BVKA 2Y3QA 2ITBA 2N02A 3C1ZA 4ZMCA 1VELA 2JD80 3AK9A 3RBCA 2ZURX 3IS8A 3R2KA 3RE7A 3MPSA 5D8OA 4ERUA 5D8PA 4CMYV 4R42A 2YW6A 3KDQA 2WTLA 1H96A 3FRSA 5CZUA 3QZ3A 3F37A 4ZKXA 2VXIA 4PG1A 4ETRA 3E1QA 1O9IA 1JYBA 2XJOA 4TOEA 1DVBA 3E1LA 3KA6A 4XGSA 3FI6A 2MGYA 3JZAB 3O7SA 3PWFA 3C21A 4RC6A 3VVAA 1TKOA 2V2IA 2FG8A 3NP2X 2ZA8A 4MKUA 4ISPA 3Q4OA 4LPMA 5LG2A 4AM2A 4CMYA 3AJPA 4ITWA 4IXKA 4XKUA 2FL0A 2CF7A 3UOIA 2Z6MA 3PWQA 1IESA 2ZG9X 2V2JA 3Q4QA 3WNWA 3E2CA 3FVBA 1JIGA 4MXPA 2JD70 1XZ3A 4DZ0A 2OH3A 4OYNA 4DYXA 2WLAA 3ISEA 4ZL6A 2XGWA 3SE1A 4U3GA 4X0JA 2OC5A 2X170 4CY9A 3KWOA 3R2OA 4RC6B 4LYUA 4TOGA 1YUXA 4LQNA 1VJXA 5CMQA 5J8WA 4DE6A 2CIHA 3UNOA 4PG0A 4LYXA 3EGMA 4DYUA 5HJFA 3PW8A 2BW1A 2IB0A 4TOHA 4WJG4 4ITTA 3AK8A 2Z5QA 3IS7A 4ZL5A 1BG7A 3H7GA 2CLUA 1XZ1A 1QGHA 2Z5RA 4RC8A 4KXRB 1JI4A 2FHAA 3GHQA 5JKMA 1Z6OM 3JZ9A 5HU6D 2V8TA 4KVQA 3PVYA 4EVCA 1YV1A 3WVVA 3QVDA 3FSEA 1MFRA 3WVUA 4YXMA 5K53A 4MJYA 2V2RA 4PGKA 4RC5A 3KX9A 5D8YA 3HIUA 3V3KB 1RCCA 3PWQC 3R2HA 4TOFA 4DI0A 3SHXA 4W4KB 3BVLA 2GYDA 3KXUA 2YJKA 3Q4RA 2Z5PA 4DYZA 3NP0X 5ERJA 2V2OA 1JI5A 2CN6A 3F36A 3T9JA 3A9QA 4E40A 5JDOA 1TJOA 1B71A 3PVYB 3KA9A 3C1YA 2CHPA 3GGYA 4YXJA 5FFEA 3F34A 2ZG7X 1JREA 1Z4AA 1UMNA 3L0MA 4RC5B 5GU2X 3U90A 3VV9A 3W54A 4E6KA 3PVTA 3M6JA 4YKHA 4XKTA 1ZS3A 3A68A 3GE4A 3HL1A 2BJYA 4DYYA 4Z3BA 2BKCA 5GN8A 3LKDA 2G38B 5GOUA 3PW8C 2WWXB 3EZ0A 2FFXJ 5C6FA 2G4HA 2GYQA 2D5KA 2RBDA 3QB9A 3WVWA 3OJ5A 4LQHA 4TO9A 5K52A 3BVEA 4IWJA 1LKPA 5JDOB 3E1PA 3KA4A 3AJQA 1RCDA 1S2ZA 5FEJA 1DPSA 2CWLA 5D8SA 2XJMA 3E1NA 4CVTA 3ISFA 4RC7A 2FJCA 5FFAA 1NFVA 4P18A 4II4B 3PVTB 1HRSA 3TA8A 2CHIA 2ZA7A 1RCGA 2C41A 2V15A 3PVRA 4REUA 1OTKA 5GU0X 1NF6A 3OGHA 5GN8B 1L8IA 1L8HA 2C6RA 1QYBA 5LBHA 3E1MA 4M34A 5J9VA 4LQJA 5JACA 3RGDA 4MY7A 2GS4A 1LKMA 4ZTTA 5JKLG 4TW3A 1NNQA 2AR0A 1SQ3A 4IWKA 3BVFA 3UOFA 1JKVA 2C2UA 3BT5A 2UX1A 4M35A 3KA8A 4MN9A 4RC7B 4ZKHA 3BVIA 1AEWA 3R2RA 2VZBA 4LPJA 3GVYA 3PVRB 1RCIA 1ZUJA 3DBYA 4XKSA 1RYTA 5E1UA 1N1QA 4EVEA 3FRRA 3F35A 1BCFA 1TK6A 5D8QA 1J30A 5J93A 2C2FA 3SH6A 1Z6OA 3PW1A 1KRQA 1BFRA 2VXXA 5ERKA 3F32A 3Q4NA 2FG4A 1F30A 3F33A 1TKPA 5HQOA 1VEQA 2ZG8X 1JGCA 3QHCA 2XKQA 2ZA6A 1UVHA 1VLGA 2V2NA 3KA3A 4PGIA 2HTNA 5GU1X 3QD8A 3AF7X 3E6RA 2QQYA 1EUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4II4 A;  1JKU A;  4LPN A;  1LKO A;  2FKZ A;  1O9R A;  4AM5 A;  4CYB A;  4TOC A;  3E6S A;  2JD6 0;  3ES3 A;  1LB3 A;  3AF9 X;  5HJH A;  4MUD A;  2YJJ A;  2V2S A;  3PW1 B;  4ISM A;  3EZU A;  2CLB A;  3E1J A;  5D8X A;  3R2S A;  2V2M A;  4AM4 A;  1FHA A;  1S30 A;  3AJO A;  5I4J A;  5FFD A;  3R2L A;  4TOA A;  1VEI A;  1DAT A;  2PYB A;  2C2J A;  5IX6 A;  3E1O A;  3AF8 X;  3F39 A;  1IER A;  4ZLW A;  3PZA A;  4M32 A;  3IQ1 A;  2IU2 A;  4EVD A;  2V2L A;  4CVR A;  4ML5 A;  5JKM G;  3R2M A;  2QF9 A;  1RCE A;  3SID A;  3QHB A;  2W0O A;  4ZKW A;  1NF4 A;  4TOD A;  5J8S A;  3BKN A;  2V2P A;  4EVB A;  2Z90 A;  1R03 A;  2FZF A;  4KVR A;  5D8R A;  2F7N A;  5AXS A;  2CN7 A;  4CYA A;  5CMR A;  4Y08 A;  3RAV A;  4M33 A;  2HR5 A;  2BK6 A;  1S3Q A;  4LQV A;  4CVS A;  1MOJ A;  4TOB A;  3RD0 A;  4QUW A;  4DAS A;  1F33 A;  1YUZ A;  4Z5S A;  5FFC A;  3O7R A;  5LG8 A;  1GWG A;  5FFB A;  2IY4 A;  5JKL A;  2CEI A;  4A25 A;  5GU3 X;  5E2D A;  3NOZ X;  3VNX A;  2YW7 A;  3F38 A;  5LS9 A;  2WLU A;  1JTS A;  4KVS A;  4CVP A;  4ZJK A;  3ERZ A;  2XJN A;  1SOF A;  3BVK A;  2Y3Q A;  2ITB A;  4ZMC A;  1VEL A;  2JD8 0;  3AK9 A;  3RBC A;  2ZUR X;  3IS8 A;  3R2K A;  3RE7 A;  3MPS A;  5D8O A;  4ERU A;  5D8P A;  4CMY V;  4R42 A;  2YW6 A;  2WTL A;  1H96 A;  5CZU A;  3QZ3 A;  3F37 A;  4ZKX A;  4PG1 A;  2VXI A;  4ETR A;  3E1Q A;  1O9I A;  1JYB A;  2XJO A;  4TOE A;  1DVB A;  3E1L A;  3KA6 A;  4XGS A;  3FI6 A;  3PWF A;  3O7S A;  4RC6 A;  1TKO A;  2V2I A;  2FG8 A;  3NP2 X;  2ZA8 A;  4MKU A;  4ISP A;  3Q4O A;  4LPM A;  5LG2 A;  4AM2 A;  4CMY A;  3AJP A;  4ITW A;  4IXK A;  4XKU A;  2FL0 A;  2CF7 A;  3UOI A;  2Z6M A;  3PWQ A;  1IES A;  2ZG9 X;  2V2J A;  3Q4Q A;  3WNW A;  3E2C A;  3FVB A;  1JIG A;  2JD7 0;  1XZ3 A;  4DZ0 A;  2OH3 A;  4OYN A;  4DYX A;  2WLA A;  3ISE A;  4ZL6 A;  2XGW A;  3SE1 A;  4U3G A;  2OC5 A;  2X17 0;  4CY9 A;  3KWO A;  3R2O A;  4RC6 B;  4LYU A;  4TOG A;  1YUX A;  4LQN A;  1VJX A;  5CMQ A;  5J8W A;  4DE6 A;  2CIH A;  3UNO A;  4PG0 A;  4LYX A;  3EGM A;  4DYU A;  5HJF A;  3PW8 A;  2BW1 A;  2IB0 A;  4TOH A;  4ITT A;  3AK8 A;  2Z5Q A;  3IS7 A;  4ZL5 A;  1BG7 A;  3H7G A;  2CLU A;  1XZ1 A;  1QGH A;  2Z5R A;  4RC8 A;  1JI4 A;  2FHA A;  3GHQ A;  5JKM A;  1Z6O M;  4KVQ A;  4EVC A;  3PVY A;  1YV1 A;  3WVV A;  3QVD A;  3FSE A;  1MFR A;  3WVU A;  5K53 A;  4MJY A;  2V2R A;  4PGK A;  4RC5 A;  3KX9 A;  5D8Y A;  3HIU A;  1RCC A;  3PWQ C;  3R2H A;  4TOF A;  4DI0 A;  3SHX A;  3BVL A;  2GYD A;  3KXU A;  2YJK A;  3Q4R A;  2Z5P A;  4DYZ A;  3NP0 X;  5ERJ A;  2V2O A;  1JI5 A;  2CN6 A;  3F36 A;  3T9J A;  3A9Q A;  1TJO A;  1B71 A;  3PVY B;  3KA9 A;  2CHP A;  5FFE A;  3F34 A;  2ZG7 X;  1JRE A;  1Z4A A;  1UMN A;  4RC5 B;  5GU2 X;  3U90 A;  4E6K A;  3PVT A;  4YKH A;  4XKT A;  1ZS3 A;  3A68 A;  3GE4 A;  3HL1 A;  2BJY A;  4DYY A;  4Z3B A;  2BKC A;  5GN8 A;  5GOU A;  3PW8 C;  3EZ0 A;  2FFX J;  5C6F A;  2G4H A;  2GYQ A;  2D5K A;  2RBD A;  3QB9 A;  3WVW A;  3OJ5 A;  4LQH A;  4TO9 A;  5K52 A;  3BVE A;  4IWJ A;  1LKP A;  3E1P A;  3KA4 A;  3AJQ A;  1RCD A;  1S2Z A;  5FEJ A;  1DPS A;  5D8S A;  2XJM A;  3E1N A;  4CVT A;  3ISF A;  4RC7 A;  2FJC A;  5FFA A;  1NFV A;  4P18 A;  4II4 B;  3PVT B;  1HRS A;  3TA8 A;  2CHI A;  2ZA7 A;  1RCG A;  2C41 A;  2V15 A;  3PVR A;  4REU A;  1OTK A;  5GU0 X;  1NF6 A;  3OGH A;  5GN8 B;  1L8I A;  1L8H A;  2C6R A;  1QYB A;  5LBH A;  3E1M A;  4M34 A;  5J9V A;  4LQJ A;  5JAC A;  3RGD A;  4MY7 A;  2GS4 A;  1LKM A;  4ZTT A;  5JKL G;  4TW3 A;  1NNQ A;  1SQ3 A;  4IWK A;  3BVF A;  3UOF A;  1JKV A;  2C2U A;  3BT5 A;  2UX1 A;  4M35 A;  3KA8 A;  4MN9 A;  4RC7 B;  4ZKH A;  3BVI A;  1AEW A;  3R2R A;  2VZB A;  4LPJ A;  3GVY A;  3PVR B;  1RCI A;  1ZUJ A;  4XKS A;  1RYT A;  5E1U A;  1N1Q A;  4EVE A;  3F35 A;  1BCF A;  1TK6 A;  5D8Q A;  1J30 A;  5J93 A;  2C2F A;  3SH6 A;  1Z6O A;  3PW1 A;  1KRQ A;  1BFR A;  2VXX A;  5ERK A;  3F32 A;  3Q4N A;  2FG4 A;  1F30 A;  3F33 A;  1TKP A;  5HQO A;  1VEQ A;  2ZG8 X;  1JGC A;  3QHC A;  2XKQ A;  2ZA6 A;  1UVH A;  1VLG A;  2V2N A;  3KA3 A;  4PGI A;  2HTN A;  5GU1 X;  3QD8 A;  3AF7 X;  3E6R A;  2QQY A;  1EUM A; 
#chains in the Genus database with same CATH topology
 4II4 A;  1JKU A;  4LPN A;  1LKO A;  3D19 A;  2FKZ A;  1O9R A;  4AM5 A;  4CYB A;  4TOC A;  3E6S A;  2JD6 0;  3ES3 A;  1LB3 A;  3AF9 X;  2OKC A;  5HJH A;  4MUD A;  2YJJ A;  2V2S A;  3PW1 B;  3UFB A;  4ISM A;  3EZU A;  2CLB A;  3E1J A;  5D8X A;  3R2S A;  2V2M A;  4AM4 A;  1FHA A;  1S30 A;  3AJO A;  5I4J A;  4YVZ A;  5FFD A;  3R2L A;  4TOA A;  1VEI A;  1DAT A;  2PYB A;  2C2J A;  5IX6 A;  3E1O A;  3AF8 X;  3F39 A;  1IER A;  4ZLW A;  3PZA A;  2Y44 A;  3C23 A;  3IQ1 A;  2IU2 A;  4M32 A;  4EVD A;  2V2L A;  4W4L B;  4CVR A;  4ML5 A;  5JKM G;  3R2M A;  2QF9 A;  1RCE A;  3SID A;  3GGZ A;  3QHB A;  2W0O A;  4ZKW A;  3N6O A;  1NF4 A;  4TOD A;  5J8S A;  3BKN A;  2V2P A;  4EVB A;  2Z90 A;  1R03 A;  2FZF A;  4KVR A;  5D8R A;  2F7N A;  5AXS A;  2CN7 A;  4CYA A;  5CMR A;  4Y08 A;  3KHK A;  3RAV A;  4M33 A;  2HR5 A;  2BK6 A;  1S3Q A;  4LQV A;  4CVS A;  1MOJ A;  4TOB A;  3RD0 A;  4QUW A;  4DAS A;  1F33 A;  1YUZ A;  4Z5S A;  5FFC A;  3O7R A;  5LG8 A;  2V8U A;  1GWG A;  5FFB A;  2IY4 A;  5JKL A;  2CEI A;  4A25 A;  5GU3 X;  5E2D A;  3NOZ X;  3VNX A;  2YW7 A;  3F38 A;  5LS9 A;  2WLU A;  1JTS A;  4KVS A;  4CVP A;  4ZJK A;  3ERZ A;  2XJN A;  1SOF A;  3BVK A;  2Y3Q A;  2ITB A;  2N02 A;  3C1Z A;  4ZMC A;  1VEL A;  2JD8 0;  3AK9 A;  3RBC A;  2ZUR X;  3IS8 A;  3R2K A;  3RE7 A;  3MPS A;  5D8O A;  4ERU A;  5D8P A;  4CMY V;  4R42 A;  2YW6 A;  3KDQ A;  2WTL A;  1H96 A;  3FRS A;  5CZU A;  3QZ3 A;  3F37 A;  4ZKX A;  2VXI A;  4PG1 A;  4ETR A;  3E1Q A;  1O9I A;  1JYB A;  2XJO A;  4TOE A;  1DVB A;  3E1L A;  3KA6 A;  4XGS A;  3FI6 A;  2MGY A;  3JZA B;  3O7S A;  3PWF A;  3C21 A;  4RC6 A;  3VVA A;  1TKO A;  2V2I A;  2FG8 A;  3NP2 X;  2ZA8 A;  4MKU A;  4ISP A;  3Q4O A;  4LPM A;  5LG2 A;  4AM2 A;  4CMY A;  3AJP A;  4ITW A;  4IXK A;  4XKU A;  2FL0 A;  2CF7 A;  3UOI A;  2Z6M A;  3PWQ A;  1IES A;  2ZG9 X;  2V2J A;  3Q4Q A;  3WNW A;  3E2C A;  3FVB A;  1JIG A;  4MXP A;  2JD7 0;  1XZ3 A;  4DZ0 A;  2OH3 A;  4OYN A;  4DYX A;  2WLA A;  3ISE A;  4ZL6 A;  2XGW A;  3SE1 A;  4U3G A;  4X0J A;  2OC5 A;  2X17 0;  4CY9 A;  3KWO A;  3R2O A;  4RC6 B;  4LYU A;  4TOG A;  1YUX A;  4LQN A;  1VJX A;  5CMQ A;  5J8W A;  4DE6 A;  2CIH A;  3UNO A;  4PG0 A;  4LYX A;  3EGM A;  4DYU A;  5HJF A;  3PW8 A;  2BW1 A;  2IB0 A;  4TOH A;  4WJG 4;  4ITT A;  3AK8 A;  2Z5Q A;  3IS7 A;  4ZL5 A;  1BG7 A;  3H7G A;  2CLU A;  1XZ1 A;  1QGH A;  2Z5R A;  4RC8 A;  4KXR B;  1JI4 A;  2FHA A;  3GHQ A;  5JKM A;  1Z6O M;  3JZ9 A;  5HU6 D;  2V8T A;  4KVQ A;  3PVY A;  4EVC A;  1YV1 A;  3WVV A;  3QVD A;  3FSE A;  1MFR A;  3WVU A;  4YXM A;  5K53 A;  4MJY A;  2V2R A;  4PGK A;  4RC5 A;  3KX9 A;  5D8Y A;  3HIU A;  3V3K B;  1RCC A;  3PWQ C;  3R2H A;  4TOF A;  4DI0 A;  3SHX A;  4W4K B;  3BVL A;  2GYD A;  3KXU A;  2YJK A;  3Q4R A;  2Z5P A;  4DYZ A;  3NP0 X;  5ERJ A;  2V2O A;  1JI5 A;  2CN6 A;  3F36 A;  3T9J A;  3A9Q A;  4E40 A;  5JDO A;  1TJO A;  1B71 A;  3PVY B;  3KA9 A;  3C1Y A;  2CHP A;  3GGY A;  4YXJ A;  5FFE A;  3F34 A;  2ZG7 X;  1JRE A;  1Z4A A;  1UMN A;  3L0M A;  4RC5 B;  5GU2 X;  3U90 A;  3VV9 A;  3W54 A;  4E6K A;  3PVT A;  3M6J A;  4YKH A;  4XKT A;  1ZS3 A;  3A68 A;  3GE4 A;  3HL1 A;  2BJY A;  4DYY A;  4Z3B A;  2BKC A;  5GN8 A;  3LKD A;  2G38 B;  5GOU A;  3PW8 C;  2WWX B;  3EZ0 A;  2FFX J;  5C6F A;  2G4H A;  2GYQ A;  2D5K A;  2RBD A;  3QB9 A;  3WVW A;  3OJ5 A;  4LQH A;  4TO9 A;  5K52 A;  3BVE A;  4IWJ A;  1LKP A;  5JDO B;  3E1P A;  3KA4 A;  3AJQ A;  1RCD A;  1S2Z A;  5FEJ A;  1DPS A;  2CWL A;  5D8S A;  2XJM A;  3E1N A;  4CVT A;  3ISF A;  4RC7 A;  2FJC A;  5FFA A;  1NFV A;  4P18 A;  4II4 B;  3PVT B;  1HRS A;  3TA8 A;  2CHI A;  2ZA7 A;  1RCG A;  2C41 A;  2V15 A;  3PVR A;  4REU A;  1OTK A;  5GU0 X;  1NF6 A;  3OGH A;  5GN8 B;  1L8I A;  1L8H A;  2C6R A;  1QYB A;  5LBH A;  3E1M A;  4M34 A;  5J9V A;  4LQJ A;  5JAC A;  3RGD A;  4MY7 A;  2GS4 A;  1LKM A;  4ZTT A;  5JKL G;  4TW3 A;  1NNQ A;  2AR0 A;  1SQ3 A;  4IWK A;  3BVF A;  3UOF A;  1JKV A;  2C2U A;  3BT5 A;  2UX1 A;  4M35 A;  3KA8 A;  4MN9 A;  4RC7 B;  4ZKH A;  3BVI A;  1AEW A;  3R2R A;  2VZB A;  4LPJ A;  3GVY A;  3PVR B;  1RCI A;  1ZUJ A;  3DBY A;  4XKS A;  1RYT A;  5E1U A;  1N1Q A;  4EVE A;  3FRR A;  3F35 A;  1BCF A;  1TK6 A;  5D8Q A;  1J30 A;  5J93 A;  2C2F A;  3SH6 A;  1Z6O A;  3PW1 A;  1KRQ A;  1BFR A;  2VXX A;  5ERK A;  3F32 A;  3Q4N A;  2FG4 A;  1F30 A;  3F33 A;  1TKP A;  5HQO A;  1VEQ A;  2ZG8 X;  1JGC A;  3QHC A;  2XKQ A;  2ZA6 A;  1UVH A;  1VLG A;  2V2N A;  3KA3 A;  4PGI A;  2HTN A;  5GU1 X;  3QD8 A;  3AF7 X;  3E6R A;  2QQY A;  1EUM A; 
#chains in the Genus database with same CATH homology
 4II4 A;  1JKU A;  4LPN A;  1LKO A;  3D19 A;  2FKZ A;  1O9R A;  4AM5 A;  4CYB A;  4TOC A;  3E6S A;  2JD6 0;  3ES3 A;  1LB3 A;  3AF9 X;  2OKC A;  5HJH A;  4MUD A;  2YJJ A;  2V2S A;  3PW1 B;  3UFB A;  4ISM A;  3EZU A;  2CLB A;  3E1J A;  5D8X A;  3R2S A;  2V2M A;  4AM4 A;  1FHA A;  1S30 A;  3AJO A;  5I4J A;  4YVZ A;  5FFD A;  3R2L A;  4TOA A;  1VEI A;  1DAT A;  2PYB A;  2C2J A;  5IX6 A;  3E1O A;  3AF8 X;  3F39 A;  1IER A;  4ZLW A;  3PZA A;  2Y44 A;  3C23 A;  3IQ1 A;  2IU2 A;  4M32 A;  4EVD A;  2V2L A;  4W4L B;  4CVR A;  4ML5 A;  5JKM G;  3R2M A;  2QF9 A;  1RCE A;  3SID A;  3GGZ A;  3QHB A;  2W0O A;  4ZKW A;  3N6O A;  1NF4 A;  4TOD A;  5J8S A;  3BKN A;  2V2P A;  4EVB A;  2Z90 A;  1R03 A;  2FZF A;  4KVR A;  5D8R A;  2F7N A;  5AXS A;  2CN7 A;  4CYA A;  5CMR A;  4Y08 A;  3KHK A;  3RAV A;  4M33 A;  2HR5 A;  2BK6 A;  1S3Q A;  4LQV A;  4CVS A;  1MOJ A;  4TOB A;  3RD0 A;  4QUW A;  4DAS A;  1F33 A;  1YUZ A;  4Z5S A;  5FFC A;  3O7R A;  5LG8 A;  2V8U A;  1GWG A;  5FFB A;  2IY4 A;  5JKL A;  2CEI A;  4A25 A;  5GU3 X;  5E2D A;  3NOZ X;  3VNX A;  2YW7 A;  3F38 A;  5LS9 A;  2WLU A;  1JTS A;  4KVS A;  4CVP A;  4ZJK A;  3ERZ A;  2XJN A;  1SOF A;  3BVK A;  2Y3Q A;  2ITB A;  2N02 A;  3C1Z A;  4ZMC A;  1VEL A;  2JD8 0;  3AK9 A;  3RBC A;  2ZUR X;  3IS8 A;  3R2K A;  3RE7 A;  3MPS A;  5D8O A;  4ERU A;  5D8P A;  4CMY V;  4R42 A;  2YW6 A;  3KDQ A;  2WTL A;  1H96 A;  3FRS A;  5CZU A;  3QZ3 A;  3F37 A;  4ZKX A;  2VXI A;  4PG1 A;  4ETR A;  3E1Q A;  1O9I A;  1JYB A;  2XJO A;  4TOE A;  1DVB A;  3E1L A;  3KA6 A;  4XGS A;  3FI6 A;  2MGY A;  3JZA B;  3O7S A;  3PWF A;  3C21 A;  4RC6 A;  3VVA A;  1TKO A;  2V2I A;  2FG8 A;  3NP2 X;  2ZA8 A;  4MKU A;  4ISP A;  3Q4O A;  4LPM A;  5LG2 A;  4AM2 A;  4CMY A;  3AJP A;  4ITW A;  4IXK A;  4XKU A;  2FL0 A;  2CF7 A;  3UOI A;  2Z6M A;  3PWQ A;  1IES A;  2ZG9 X;  2V2J A;  3Q4Q A;  3WNW A;  3E2C A;  3FVB A;  1JIG A;  4MXP A;  2JD7 0;  1XZ3 A;  4DZ0 A;  2OH3 A;  4OYN A;  4DYX A;  2WLA A;  3ISE A;  4ZL6 A;  2XGW A;  3SE1 A;  4U3G A;  4X0J A;  2OC5 A;  2X17 0;  4CY9 A;  3KWO A;  3R2O A;  4RC6 B;  4LYU A;  4TOG A;  1YUX A;  4LQN A;  1VJX A;  5CMQ A;  5J8W A;  4DE6 A;  2CIH A;  3UNO A;  4PG0 A;  4LYX A;  3EGM A;  4DYU A;  5HJF A;  3PW8 A;  2BW1 A;  2IB0 A;  4TOH A;  4WJG 4;  4ITT A;  3AK8 A;  2Z5Q A;  3IS7 A;  4ZL5 A;  1BG7 A;  3H7G A;  2CLU A;  1XZ1 A;  1QGH A;  2Z5R A;  4RC8 A;  4KXR B;  1JI4 A;  2FHA A;  3GHQ A;  5JKM A;  1Z6O M;  3JZ9 A;  5HU6 D;  2V8T A;  4KVQ A;  3PVY A;  4EVC A;  1YV1 A;  3WVV A;  3QVD A;  3FSE A;  1MFR A;  3WVU A;  4YXM A;  5K53 A;  4MJY A;  2V2R A;  4PGK A;  4RC5 A;  3KX9 A;  5D8Y A;  3HIU A;  3V3K B;  1RCC A;  3PWQ C;  3R2H A;  4TOF A;  4DI0 A;  3SHX A;  4W4K B;  3BVL A;  2GYD A;  3KXU A;  2YJK A;  3Q4R A;  2Z5P A;  4DYZ A;  3NP0 X;  5ERJ A;  2V2O A;  1JI5 A;  2CN6 A;  3F36 A;  3T9J A;  3A9Q A;  4E40 A;  5JDO A;  1TJO A;  1B71 A;  3PVY B;  3KA9 A;  3C1Y A;  2CHP A;  3GGY A;  4YXJ A;  5FFE A;  3F34 A;  2ZG7 X;  1JRE A;  1Z4A A;  1UMN A;  3L0M A;  4RC5 B;  5GU2 X;  3U90 A;  3VV9 A;  3W54 A;  4E6K A;  3PVT A;  3M6J A;  4YKH A;  4XKT A;  1ZS3 A;  3A68 A;  3GE4 A;  3HL1 A;  2BJY A;  4DYY A;  4Z3B A;  2BKC A;  5GN8 A;  3LKD A;  2G38 B;  5GOU A;  3PW8 C;  2WWX B;  3EZ0 A;  2FFX J;  5C6F A;  2G4H A;  2GYQ A;  2D5K A;  2RBD A;  3QB9 A;  3WVW A;  3OJ5 A;  4LQH A;  4TO9 A;  5K52 A;  3BVE A;  4IWJ A;  1LKP A;  5JDO B;  3E1P A;  3KA4 A;  3AJQ A;  1RCD A;  1S2Z A;  5FEJ A;  1DPS A;  2CWL A;  5D8S A;  2XJM A;  3E1N A;  4CVT A;  3ISF A;  4RC7 A;  2FJC A;  5FFA A;  1NFV A;  4P18 A;  4II4 B;  3PVT B;  1HRS A;  3TA8 A;  2CHI A;  2ZA7 A;  1RCG A;  2C41 A;  2V15 A;  3PVR A;  4REU A;  1OTK A;  5GU0 X;  1NF6 A;  3OGH A;  5GN8 B;  1L8I A;  1L8H A;  2C6R A;  1QYB A;  5LBH A;  3E1M A;  4M34 A;  5J9V A;  4LQJ A;  5JAC A;  3RGD A;  4MY7 A;  2GS4 A;  1LKM A;  4ZTT A;  5JKL G;  4TW3 A;  1NNQ A;  2AR0 A;  1SQ3 A;  4IWK A;  3BVF A;  3UOF A;  1JKV A;  2C2U A;  3BT5 A;  2UX1 A;  4M35 A;  3KA8 A;  4MN9 A;  4RC7 B;  4ZKH A;  3BVI A;  1AEW A;  3R2R A;  2VZB A;  4LPJ A;  3GVY A;  3PVR B;  1RCI A;  1ZUJ A;  3DBY A;  4XKS A;  1RYT A;  5E1U A;  1N1Q A;  4EVE A;  3FRR A;  3F35 A;  1BCF A;  1TK6 A;  5D8Q A;  1J30 A;  5J93 A;  2C2F A;  3SH6 A;  1Z6O A;  3PW1 A;  1KRQ A;  1BFR A;  2VXX A;  5ERK A;  3F32 A;  3Q4N A;  2FG4 A;  1F30 A;  3F33 A;  1TKP A;  5HQO A;  1VEQ A;  2ZG8 X;  1JGC A;  3QHC A;  2XKQ A;  2ZA6 A;  1UVH A;  1VLG A;  2V2N A;  3KA3 A;  4PGI A;  2HTN A;  5GU1 X;  3QD8 A;  3AF7 X;  3E6R A;  2QQY A;  1EUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...