2D5KA

Crystal structure of dps from staphylococcus aureus
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
148
structure length
148
Chain Sequence
b'SNQQDVVKELNQQVANWTVAYTKLHNFHWYVKGPNFFSLHVKFEELYNEASQYVDELAERILAVGGNPVGTLTECLEQSIVKEAAKGYSAEQMVEELSQDFTNISKQLENAIEIAGNAGDDVSEDMFIGMQTSVDKHNWMFKSYLSLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dps family protein
publication title Nucleoid compaction by MrgA(Asp56Ala/Glu60Ala) does not contribute to staphylococcal cell survival against oxidative stress and phagocytic killing by macrophages
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Metal binding protein
total genus 66
structure length 148
sequence length 148
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.52: Transferred entry: 4.3.3.7.
pdb deposition date 2005-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2d5kA00
2Z5QA 4TOBA 2QF9A 4PG1A 5D8OA 5GU1X 3ISFA 2ZG7X 2CHPA 4M32A 4MKUA 3RGDA 3TA8A 4ZJKA 3AF9X 2V2NA 1JYBA 3E1MA 3UOFA 2XJMA 4M33A 3Q4NA 3AF8X 5K52A 3WVUA 3T9JA 5JKMA 5HJFA 4LQHA 1ZUJA 3EGMA 3HIUA 1RCEA 2IY4A 1DVBA 3KX9A 2JD60 1F33A 5D8RA 3ES3A 2V2JA 2FL0A 1JKVA 1JTSA 3R2RA 4RC5A 1S3QA 3BKNA 3PVYB 4MN9A 2XJOA 3KXUA 2CF7A 1EUMA 4TW3A 5GU0X 4CVTA 1SOFA 4LQNA 1XZ3A 2ZG8X 3R2KA 4TOGA 4TOEA 4PGIA 5LG8A 3QZ3A 4EVDA 4ZMCA 1DATA 5GN8A 5CZUA 3PWFA 2BW1A 4ML5A 4E6KA 1Z4AA 5FFAA 1IERA 3E6SA 3GE4A 3SHXA 4MUDA 3WNWA 2ZA6A 4TOHA 4ZKXA 4Y08A 5LBHA 3FI6A 4DYUA 4RC8A 3KA8A 1SQ3A 4MY7A 1JIGA 4LQJA 5J93A 3OJ5A 4DYXA 3AJQA 3H7GA 1TKPA 1YV1A 1N1QA 5CMRA 3ISEA 4A25A 1NFVA 1S30A 2C2FA 4Z5SA 1KRQA 2IB0A 4ZLWA 4PGKA 1MFRA 1NF4A 2YJKA 4DI0A 4TOAA 1RCDA 2FJCA 2ZURX 4LQVA 2QQYA 2V2IA 4ISPA 4M34A 2HR5A 3PVYA 1TJOA 3QVDA 2V2SA 4ERUA 4TOFA 5C6FA 1RYTA 5D8QA 5ERJA 3KA9A 2WLAA 3UNOA 3E1QA 1O9IA 2Z90A 2ZA7A 3ERZA 4TODA 2XGWA 2VZBA 3VNXA 3QD8A 2JD70 2CIHA 2V2PA 4EVEA 5D8YA 1Z6OA 5J8WA 3AJPA 1LKMA 5K53A 2Z5RA 4PG0A 5ERKA 5FFDA 1GWGA 5FFBA 2FFXJ 1VLGA 3GVYA 3R2HA 4XKTA 1ZS3A 3E1OA 1TKOA 3KA6A 4LPJA 5E1UA 3BT5A 3E1JA 1LKPA 3F32A 1H96A 3A68A 2UX1A 2WLUA 3BVLA 3U90A 2YJJA 3F33A 3SIDA 2C41A 2ITBA 1RCCA 3FSEA 1JI5A 4II4B 3O7SA 4IWJA 3RAVA 2C6RA 2OC5A 3WVVA 3KA3A 1LKOA 3RBCA 1R03A 5J9VA 3SE1A 4KVSA 3F39A 4CVSA 2C2UA 3QHCA 5D8SA 5I4JA 4P18A 5AXSA 4ZKWA 3BVKA 2FG4A 4QUWA 3PVTB 1OTKA 4CY9A 4AM5A 4RC7B 3E1PA 2FG8A 2V2OA 1YUZA 4EVBA 3PW1B 4IXKA 2CLBA 4M35A 2BK6A 3EZUA 1AEWA 3WVWA 3QHBA 1NF6A 1VJXA 4AM2A 2OH3A 2BJYA 1JKUA 1BCFA 3Q4OA 4KVRA 3OGHA 4U3GA 4DZ0A 4CYAA 4IWKA 1YUXA 1LB3A 2Y3QA 4DASA 4XKUA 2FHAA 3A9QA 1BFRA 3PWQC 1F30A 2CN6A 5JKLG 3IS8A 5FEJA 3RE7A 2V2RA 2D5KA 2XJNA 2YW7A 2V2LA 1RCIA 4ITWA 5GU2X 4CVRA 3F35A 2FKZA 1L8IA 2CN7A 2F7NA 3BVEA 3EZ0A 5CMQA 1DPSA 2Z6MA 3IS7A 1B71A 5GOUA 1O9RA 2V15A 4II4A 2HTNA 2ZG9X 3AF7X 5JKLA 2X170 4LPMA 1NNQA 2W0OA 3AK9A 3KA4A 2G4HA 1QGHA 4CVPA 3UOIA 3AK8A 3AJOA 3PW8C 2YW6A 4ZL5A 5J8SA 3F37A 2GYDA 3O7RA 3PVTA 2VXIA 1JGCA 5IX6A 4AM4A 4RC7A 1JREA 3BVFA 2IU2A 2RBDA 4ISMA 1XZ1A 2PYBA 1HRSA 1L8HA 1VELA 3PW1A 3GHQA 4REUA 4YKHA 5D8XA 4TO9A 1J30A 3NP2X 5HJHA 1IESA 4ETRA 4LPNA 4DYZA 4Z3BA 5JACA 2XKQA 3KWOA 3PW8A 4ZL6A 1RCGA 2V2MA 3BVIA 1S2ZA 3R2OA 4OYNA 3SH6A 4DYYA 1FHAA 3PVRB 4LYXA 2C2JA 4XKSA 1TK6A 2GYQA 4XGSA 2FZFA 1UMNA 2BKCA 2CLUA 4RC6B 4ZKHA 2JD80 2GS4A 2VXXA 4DE6A 3QB9A 1QYBA 3E2CA 5E2DA 1MOJA 3F36A 3PZAA 5HQOA 2CHIA 3R2LA 4TOCA 3R2SA 5LS9A 3E1NA 4CMYA 3RD0A 4MJYA 2Z5PA 4ITTA 4CYBA 3E1LA 4KVQA 3F38A 1BG7A 3NP0X 4RC5B 1VEIA 5LG2A 3NOZX 5FFEA 1UVHA 3MPSA 4LYUA 3FVBA 5FFCA 3IQ1A 5GU3X 1Z6OM 3R2MA 4EVCA 3HL1A 4R42A 5D8PA 1VEQA 1JI4A 5GN8B 2WTLA 2ZA8A 3PWQA 3PVRA 3Q4QA 3E6RA 3F34A 5JKMG 4RC6A 4CMYV 2CEIA 4ZTTA 3Q4RA
chains in the Genus database with same CATH superfamily
2Y44A 2Z5QA 4TOBA 2QF9A 4PG1A 5D8OA 5GU1X 3ISFA 2ZG7X 2CHPA 4M32A 4MKUA 3RGDA 3TA8A 4ZJKA 3AF9X 2V2NA 1JYBA 3E1MA 4YVZA 3UOFA 2XJMA 4M33A 3Q4NA 3AF8X 5K52A 3WVUA 3T9JA 5JKMA 5HJFA 4LQHA 1ZUJA 4W4KB 5HU6D 3EGMA 3HIUA 1RCEA 2IY4A 1DVBA 3KX9A 2JD60 1F33A 5D8RA 3ES3A 2V2JA 2FL0A 1JKVA 1JTSA 3R2RA 4RC5A 1S3QA 3BKNA 3PVYB 4MN9A 2XJOA 3KXUA 3N6OA 2CF7A 1EUMA 5JDOB 4TW3A 5GU0X 4CVTA 1SOFA 4LQNA 1XZ3A 2ZG8X 3R2KA 4TOGA 4TOEA 3FRSA 4PGIA 5LG8A 2G38B 3QZ3A 4EVDA 4ZMCA 1DATA 5GN8A 5CZUA 3PWFA 2BW1A 4ML5A 4E6KA 1Z4AA 5FFAA 1IERA 3E6SA 3GE4A 3SHXA 4MUDA 3WNWA 2ZA6A 4TOHA 4ZKXA 4KXRB 4Y08A 5LBHA 3FI6A 4DYUA 4RC8A 2MGYA 3KA8A 1SQ3A 4MY7A 1JIGA 4LQJA 5J93A 3OJ5A 4DYXA 3AJQA 3H7GA 1TKPA 1YV1A 1N1QA 5CMRA 3W54A 3ISEA 4A25A 1NFVA 1S30A 2C2FA 4Z5SA 1KRQA 2IB0A 4ZLWA 4PGKA 1MFRA 1NF4A 2YJKA 4DI0A 3L0MA 3KDQA 4TOAA 1RCDA 2FJCA 2ZURX 4LQVA 3GGYA 2CWLA 2QQYA 2V2IA 4ISPA 4M34A 2HR5A 3PVYA 1TJOA 3QVDA 2V2SA 4ERUA 4TOFA 5C6FA 1RYTA 5D8QA 5ERJA 5JDOA 3KA9A 4W4LB 2WLAA 3UNOA 3E1QA 1O9IA 2Z90A 2ZA7A 3ERZA 4TODA 2XGWA 2VZBA 3VNXA 3QD8A 2JD70 2CIHA 2V2PA 4EVEA 5D8YA 1Z6OA 5J8WA 3AJPA 3D19A 1LKMA 5K53A 2Z5RA 4PG0A 5ERKA 5FFDA 1GWGA 3LKDA 5FFBA 2FFXJ 1VLGA 3GVYA 3R2HA 3VVAA 4XKTA 1ZS3A 3E1OA 1TKOA 3KA6A 4LPJA 5E1UA 3BT5A 3E1JA 1LKPA 3F32A 4YXMA 1H96A 3A68A 2UX1A 2WLUA 3BVLA 3U90A 2YJJA 3F33A 3SIDA 2C41A 2ITBA 1RCCA 3FSEA 1JI5A 4II4B 3O7SA 4IWJA 3RAVA 2C6RA 2OC5A 3WVVA 3C1ZA 3KA3A 1LKOA 3RBCA 1R03A 5J9VA 3SE1A 4KVSA 3F39A 4CVSA 2C2UA 3QHCA 5D8SA 5I4JA 4P18A 5AXSA 4ZKWA 3BVKA 2FG4A 4QUWA 3PVTB 1OTKA 4CY9A 4AM5A 4RC7B 3E1PA 2OKCA 2FG8A 2V2OA 1YUZA 4EVBA 3PW1B 4IXKA 2CLBA 4M35A 2BK6A 3EZUA 1AEWA 3WVWA 3QHBA 1NF6A 1VJXA 4AM2A 2OH3A 2BJYA 1JKUA 1BCFA 3Q4OA 4KVRA 3OGHA 4U3GA 4DZ0A 4CYAA 4IWKA 1YUXA 4E40A 1LB3A 2Y3QA 4DASA 4XKUA 2FHAA 3A9QA 1BFRA 3PWQC 1F30A 2CN6A 5JKLG 3IS8A 5FEJA 3RE7A 2V2RA 2D5KA 2XJNA 2YW7A 2V2LA 1RCIA 3M6JA 4ITWA 5GU2X 3C1YA 4CVRA 2V8TA 3F35A 2FKZA 1L8IA 2CN7A 2F7NA 3BVEA 3EZ0A 5CMQA 1DPSA 2Z6MA 3IS7A 3V3KB 1B71A 5GOUA 1O9RA 2V15A 4II4A 2HTNA 2ZG9X 3AF7X 5JKLA 2X170 4LPMA 1NNQA 2W0OA 3AK9A 3KA4A 2G4HA 3GGZA 4YXJA 1QGHA 4CVPA 3UOIA 3AK8A 3AJOA 3PW8C 2YW6A 4X0JA 3KHKA 4ZL5A 5J8SA 3F37A 2GYDA 3O7RA 3PVTA 2VXIA 1JGCA 5IX6A 4MXPA 4AM4A 2V8UA 4RC7A 1JREA 3BVFA 2IU2A 2RBDA 4ISMA 1XZ1A 2PYBA 1HRSA 1L8HA 1VELA 3PW1A 3GHQA 4REUA 4YKHA 5D8XA 4TO9A 1J30A 3NP2X 5HJHA 1IESA 4ETRA 4LPNA 4DYZA 4Z3BA 5JACA 2XKQA 3KWOA 3JZAB 3PW8A 4ZL6A 1RCGA 2V2MA 3BVIA 1S2ZA 3R2OA 4OYNA 2N02A 3SH6A 4DYYA 1FHAA 3PVRB 4LYXA 2C2JA 4XKSA 1TK6A 2GYQA 4XGSA 2FZFA 1UMNA 2BKCA 3C23A 2CLUA 4RC6B 4ZKHA 2JD80 2GS4A 2VXXA 4DE6A 3QB9A 1QYBA 3E2CA 5E2DA 1MOJA 3F36A 3PZAA 5HQOA 2CHIA 3R2LA 4TOCA 3R2SA 5LS9A 2WWXB 3E1NA 4CMYA 3RD0A 4MJYA 2Z5PA 4ITTA 3UFBA 4CYBA 4WJG4 3E1LA 4KVQA 3F38A 1BG7A 3NP0X 4RC5B 3FRRA 1VEIA 5LG2A 3DBYA 3VV9A 3NOZX 5FFEA 1UVHA 3MPSA 4LYUA 3C21A 3FVBA 5FFCA 3IQ1A 5GU3X 1Z6OM 3R2MA 4EVCA 3HL1A 4R42A 5D8PA 1VEQA 1JI4A 5GN8B 2WTLA 2ZA8A 3JZ9A 3PWQA 3PVRA 3Q4QA 3E6RA 3F34A 5JKMG 4RC6A 4CMYV 2CEIA 4ZTTA 3Q4RA 2AR0A
chains in the Genus database with same CATH topology
2Y44A 2Z5QA 4TOBA 2QF9A 4PG1A 5D8OA 5GU1X 3ISFA 2ZG7X 2CHPA 4M32A 4MKUA 3RGDA 3TA8A 4ZJKA 3AF9X 2V2NA 1JYBA 3E1MA 4YVZA 3UOFA 2XJMA 4M33A 3Q4NA 3AF8X 5K52A 3WVUA 3T9JA 5JKMA 5HJFA 4LQHA 1ZUJA 4W4KB 5HU6D 3EGMA 3HIUA 1RCEA 2IY4A 1DVBA 3KX9A 2JD60 1F33A 5D8RA 3ES3A 2V2JA 2FL0A 1JKVA 1JTSA 3R2RA 4RC5A 1S3QA 3BKNA 3PVYB 4MN9A 2XJOA 3KXUA 3N6OA 2CF7A 1EUMA 5JDOB 4TW3A 5GU0X 4CVTA 1SOFA 4LQNA 1XZ3A 2ZG8X 3R2KA 4TOGA 4TOEA 3FRSA 4PGIA 5LG8A 2G38B 3QZ3A 4EVDA 4ZMCA 1DATA 5GN8A 5CZUA 3PWFA 2BW1A 4ML5A 4E6KA 1Z4AA 5FFAA 1IERA 3E6SA 3GE4A 3SHXA 4MUDA 3WNWA 2ZA6A 4TOHA 4ZKXA 4KXRB 4Y08A 5LBHA 3FI6A 4DYUA 4RC8A 2MGYA 3KA8A 1SQ3A 4MY7A 1JIGA 4LQJA 5J93A 3OJ5A 4DYXA 3AJQA 3H7GA 1TKPA 1YV1A 1N1QA 5CMRA 3W54A 3ISEA 4A25A 1NFVA 1S30A 2C2FA 4Z5SA 1KRQA 2IB0A 4ZLWA 4PGKA 1MFRA 1NF4A 2YJKA 4DI0A 3L0MA 3KDQA 4TOAA 1RCDA 2FJCA 2ZURX 4LQVA 3GGYA 2CWLA 2QQYA 2V2IA 4ISPA 4M34A 2HR5A 3PVYA 1TJOA 3QVDA 2V2SA 4ERUA 4TOFA 5C6FA 1RYTA 5D8QA 5ERJA 5JDOA 3KA9A 4W4LB 2WLAA 3UNOA 3E1QA 1O9IA 2Z90A 2ZA7A 3ERZA 4TODA 2XGWA 2VZBA 3VNXA 3QD8A 2JD70 2CIHA 2V2PA 4EVEA 5D8YA 1Z6OA 5J8WA 3AJPA 3D19A 1LKMA 5K53A 2Z5RA 4PG0A 5ERKA 5FFDA 1GWGA 3LKDA 5FFBA 2FFXJ 1VLGA 3GVYA 3R2HA 3VVAA 4XKTA 1ZS3A 3E1OA 1TKOA 3KA6A 4LPJA 5E1UA 3BT5A 3E1JA 1LKPA 3F32A 4YXMA 1H96A 3A68A 2UX1A 2WLUA 3BVLA 3U90A 2YJJA 3F33A 3SIDA 2C41A 2ITBA 1RCCA 3FSEA 1JI5A 4II4B 3O7SA 4IWJA 3RAVA 2C6RA 2OC5A 3WVVA 3C1ZA 3KA3A 1LKOA 3RBCA 1R03A 5J9VA 3SE1A 4KVSA 3F39A 4CVSA 2C2UA 3QHCA 5D8SA 5I4JA 4P18A 5AXSA 4ZKWA 3BVKA 2FG4A 4QUWA 3PVTB 1OTKA 4CY9A 4AM5A 4RC7B 3E1PA 2OKCA 2FG8A 2V2OA 1YUZA 4EVBA 3PW1B 4IXKA 2CLBA 4M35A 2BK6A 3EZUA 1AEWA 3WVWA 3QHBA 1NF6A 1VJXA 4AM2A 2OH3A 2BJYA 1JKUA 1BCFA 3Q4OA 4KVRA 3OGHA 4U3GA 4DZ0A 4CYAA 4IWKA 1YUXA 4E40A 1LB3A 2Y3QA 4DASA 4XKUA 2FHAA 3A9QA 1BFRA 3PWQC 1F30A 2CN6A 5JKLG 3IS8A 5FEJA 3RE7A 2V2RA 2D5KA 2XJNA 2YW7A 2V2LA 1RCIA 3M6JA 4ITWA 5GU2X 3C1YA 4CVRA 2V8TA 3F35A 2FKZA 1L8IA 2CN7A 2F7NA 3BVEA 3EZ0A 5CMQA 1DPSA 2Z6MA 3IS7A 3V3KB 1B71A 5GOUA 1O9RA 2V15A 4II4A 2HTNA 2ZG9X 3AF7X 5JKLA 2X170 4LPMA 1NNQA 2W0OA 3AK9A 3KA4A 2G4HA 3GGZA 4YXJA 1QGHA 4CVPA 3UOIA 3AK8A 3AJOA 3PW8C 2YW6A 4X0JA 3KHKA 4ZL5A 5J8SA 3F37A 2GYDA 3O7RA 3PVTA 2VXIA 1JGCA 5IX6A 4MXPA 4AM4A 2V8UA 4RC7A 1JREA 3BVFA 2IU2A 2RBDA 4ISMA 1XZ1A 2PYBA 1HRSA 1L8HA 1VELA 3PW1A 3GHQA 4REUA 4YKHA 5D8XA 4TO9A 1J30A 3NP2X 5HJHA 1IESA 4ETRA 4LPNA 4DYZA 4Z3BA 5JACA 2XKQA 3KWOA 3JZAB 3PW8A 4ZL6A 1RCGA 2V2MA 3BVIA 1S2ZA 3R2OA 4OYNA 2N02A 3SH6A 4DYYA 1FHAA 3PVRB 4LYXA 2C2JA 4XKSA 1TK6A 2GYQA 4XGSA 2FZFA 1UMNA 2BKCA 3C23A 2CLUA 4RC6B 4ZKHA 2JD80 2GS4A 2VXXA 4DE6A 3QB9A 1QYBA 3E2CA 5E2DA 1MOJA 3F36A 3PZAA 5HQOA 2CHIA 3R2LA 4TOCA 3R2SA 5LS9A 2WWXB 3E1NA 4CMYA 3RD0A 4MJYA 2Z5PA 4ITTA 3UFBA 4CYBA 4WJG4 3E1LA 4KVQA 3F38A 1BG7A 3NP0X 4RC5B 3FRRA 1VEIA 5LG2A 3DBYA 3VV9A 3NOZX 5FFEA 1UVHA 3MPSA 4LYUA 3C21A 3FVBA 5FFCA 3IQ1A 5GU3X 1Z6OM 3R2MA 4EVCA 3HL1A 4R42A 5D8PA 1VEQA 1JI4A 5GN8B 2WTLA 2ZA8A 3JZ9A 3PWQA 3PVRA 3Q4QA 3E6RA 3F34A 5JKMG 4RC6A 4CMYV 2CEIA 4ZTTA 3Q4RA 2AR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z5Q A;  4TOB A;  2QF9 A;  4PG1 A;  5D8O A;  5GU1 X;  3ISF A;  2ZG7 X;  2CHP A;  4M32 A;  4MKU A;  3RGD A;  3TA8 A;  4ZJK A;  3AF9 X;  2V2N A;  1JYB A;  3E1M A;  3UOF A;  2XJM A;  4M33 A;  3Q4N A;  3AF8 X;  5K52 A;  3WVU A;  3T9J A;  5JKM A;  5HJF A;  4LQH A;  1ZUJ A;  3EGM A;  3HIU A;  1RCE A;  2IY4 A;  1DVB A;  3KX9 A;  2JD6 0;  1F33 A;  5D8R A;  3ES3 A;  2V2J A;  2FL0 A;  1JKV A;  1JTS A;  3R2R A;  4RC5 A;  1S3Q A;  3BKN A;  3PVY B;  4MN9 A;  2XJO A;  3KXU A;  2CF7 A;  1EUM A;  4TW3 A;  5GU0 X;  4CVT A;  1SOF A;  4LQN A;  1XZ3 A;  2ZG8 X;  3R2K A;  4TOG A;  4TOE A;  4PGI A;  5LG8 A;  3QZ3 A;  4EVD A;  4ZMC A;  1DAT A;  5GN8 A;  5CZU A;  3PWF A;  2BW1 A;  4ML5 A;  4E6K A;  1Z4A A;  5FFA A;  1IER A;  3E6S A;  3GE4 A;  3SHX A;  4MUD A;  3WNW A;  2ZA6 A;  4TOH A;  4ZKX A;  4Y08 A;  5LBH A;  3FI6 A;  4DYU A;  4RC8 A;  3KA8 A;  1SQ3 A;  4MY7 A;  1JIG A;  4LQJ A;  5J93 A;  3OJ5 A;  4DYX A;  3AJQ A;  3H7G A;  1TKP A;  1YV1 A;  1N1Q A;  5CMR A;  3ISE A;  4A25 A;  1NFV A;  1S30 A;  2C2F A;  4Z5S A;  1KRQ A;  2IB0 A;  4ZLW A;  4PGK A;  1MFR A;  1NF4 A;  2YJK A;  4DI0 A;  4TOA A;  1RCD A;  2FJC A;  2ZUR X;  4LQV A;  2QQY A;  2V2I A;  4ISP A;  4M34 A;  2HR5 A;  3PVY A;  1TJO A;  3QVD A;  2V2S A;  4ERU A;  4TOF A;  5C6F A;  1RYT A;  5D8Q A;  5ERJ A;  3KA9 A;  2WLA A;  3UNO A;  3E1Q A;  1O9I A;  2Z90 A;  2ZA7 A;  3ERZ A;  4TOD A;  2XGW A;  2VZB A;  3VNX A;  3QD8 A;  2JD7 0;  2CIH A;  2V2P A;  4EVE A;  5D8Y A;  1Z6O A;  5J8W A;  3AJP A;  1LKM A;  5K53 A;  2Z5R A;  4PG0 A;  5ERK A;  5FFD A;  1GWG A;  5FFB A;  2FFX J;  1VLG A;  3GVY A;  3R2H A;  4XKT A;  1ZS3 A;  3E1O A;  1TKO A;  3KA6 A;  4LPJ A;  5E1U A;  3BT5 A;  3E1J A;  1LKP A;  3F32 A;  1H96 A;  3A68 A;  2UX1 A;  2WLU A;  3BVL A;  3U90 A;  2YJJ A;  3F33 A;  3SID A;  2C41 A;  2ITB A;  1RCC A;  3FSE A;  1JI5 A;  4II4 B;  3O7S A;  4IWJ A;  3RAV A;  2C6R A;  2OC5 A;  3WVV A;  3KA3 A;  1LKO A;  3RBC A;  1R03 A;  5J9V A;  3SE1 A;  4KVS A;  3F39 A;  4CVS A;  2C2U A;  3QHC A;  5D8S A;  5I4J A;  4P18 A;  5AXS A;  4ZKW A;  3BVK A;  2FG4 A;  4QUW A;  3PVT B;  1OTK A;  4CY9 A;  4AM5 A;  4RC7 B;  3E1P A;  2FG8 A;  2V2O A;  1YUZ A;  4EVB A;  3PW1 B;  4IXK A;  2CLB A;  4M35 A;  2BK6 A;  3EZU A;  1AEW A;  3WVW A;  3QHB A;  1NF6 A;  1VJX A;  4AM2 A;  2OH3 A;  2BJY A;  1JKU A;  1BCF A;  3Q4O A;  4KVR A;  3OGH A;  4U3G A;  4DZ0 A;  4CYA A;  4IWK A;  1YUX A;  1LB3 A;  2Y3Q A;  4DAS A;  4XKU A;  2FHA A;  3A9Q A;  1BFR A;  3PWQ C;  1F30 A;  2CN6 A;  5JKL G;  3IS8 A;  5FEJ A;  3RE7 A;  2V2R A;  2D5K A;  2XJN A;  2YW7 A;  2V2L A;  1RCI A;  4ITW A;  5GU2 X;  4CVR A;  3F35 A;  2FKZ A;  1L8I A;  2CN7 A;  2F7N A;  3BVE A;  3EZ0 A;  5CMQ A;  1DPS A;  2Z6M A;  3IS7 A;  1B71 A;  5GOU A;  1O9R A;  2V15 A;  4II4 A;  2HTN A;  2ZG9 X;  3AF7 X;  5JKL A;  2X17 0;  4LPM A;  1NNQ A;  2W0O A;  3AK9 A;  3KA4 A;  2G4H A;  1QGH A;  4CVP A;  3UOI A;  3AK8 A;  3AJO A;  3PW8 C;  2YW6 A;  4ZL5 A;  5J8S A;  3F37 A;  2GYD A;  3O7R A;  3PVT A;  2VXI A;  1JGC A;  5IX6 A;  4AM4 A;  4RC7 A;  1JRE A;  3BVF A;  2IU2 A;  2RBD A;  4ISM A;  1XZ1 A;  2PYB A;  1HRS A;  1L8H A;  1VEL A;  3PW1 A;  3GHQ A;  4REU A;  4YKH A;  5D8X A;  4TO9 A;  1J30 A;  3NP2 X;  5HJH A;  1IES A;  4ETR A;  4LPN A;  4DYZ A;  4Z3B A;  5JAC A;  2XKQ A;  3KWO A;  3PW8 A;  4ZL6 A;  1RCG A;  2V2M A;  3BVI A;  1S2Z A;  3R2O A;  4OYN A;  3SH6 A;  4DYY A;  1FHA A;  3PVR B;  4LYX A;  2C2J A;  4XKS A;  1TK6 A;  2GYQ A;  4XGS A;  2FZF A;  1UMN A;  2BKC A;  2CLU A;  4RC6 B;  4ZKH A;  2JD8 0;  2GS4 A;  2VXX A;  4DE6 A;  3QB9 A;  1QYB A;  3E2C A;  5E2D A;  1MOJ A;  3F36 A;  3PZA A;  5HQO A;  2CHI A;  3R2L A;  4TOC A;  3R2S A;  5LS9 A;  3E1N A;  4CMY A;  3RD0 A;  4MJY A;  2Z5P A;  4ITT A;  4CYB A;  3E1L A;  4KVQ A;  3F38 A;  1BG7 A;  3NP0 X;  4RC5 B;  1VEI A;  5LG2 A;  3NOZ X;  5FFE A;  1UVH A;  3MPS A;  4LYU A;  3FVB A;  5FFC A;  3IQ1 A;  5GU3 X;  1Z6O M;  3R2M A;  4EVC A;  3HL1 A;  4R42 A;  5D8P A;  1VEQ A;  1JI4 A;  5GN8 B;  2WTL A;  2ZA8 A;  3PWQ A;  3PVR A;  3Q4Q A;  3E6R A;  3F34 A;  5JKM G;  4RC6 A;  4CMY V;  2CEI A;  4ZTT A;  3Q4R A; 
#chains in the Genus database with same CATH topology
 2Y44 A;  2Z5Q A;  4TOB A;  2QF9 A;  4PG1 A;  5D8O A;  5GU1 X;  3ISF A;  2ZG7 X;  2CHP A;  4M32 A;  4MKU A;  3RGD A;  3TA8 A;  4ZJK A;  3AF9 X;  2V2N A;  1JYB A;  3E1M A;  4YVZ A;  3UOF A;  2XJM A;  4M33 A;  3Q4N A;  3AF8 X;  5K52 A;  3WVU A;  3T9J A;  5JKM A;  5HJF A;  4LQH A;  1ZUJ A;  4W4K B;  5HU6 D;  3EGM A;  3HIU A;  1RCE A;  2IY4 A;  1DVB A;  3KX9 A;  2JD6 0;  1F33 A;  5D8R A;  3ES3 A;  2V2J A;  2FL0 A;  1JKV A;  1JTS A;  3R2R A;  4RC5 A;  1S3Q A;  3BKN A;  3PVY B;  4MN9 A;  2XJO A;  3KXU A;  3N6O A;  2CF7 A;  1EUM A;  5JDO B;  4TW3 A;  5GU0 X;  4CVT A;  1SOF A;  4LQN A;  1XZ3 A;  2ZG8 X;  3R2K A;  4TOG A;  4TOE A;  3FRS A;  4PGI A;  5LG8 A;  2G38 B;  3QZ3 A;  4EVD A;  4ZMC A;  1DAT A;  5GN8 A;  5CZU A;  3PWF A;  2BW1 A;  4ML5 A;  4E6K A;  1Z4A A;  5FFA A;  1IER A;  3E6S A;  3GE4 A;  3SHX A;  4MUD A;  3WNW A;  2ZA6 A;  4TOH A;  4ZKX A;  4KXR B;  4Y08 A;  5LBH A;  3FI6 A;  4DYU A;  4RC8 A;  2MGY A;  3KA8 A;  1SQ3 A;  4MY7 A;  1JIG A;  4LQJ A;  5J93 A;  3OJ5 A;  4DYX A;  3AJQ A;  3H7G A;  1TKP A;  1YV1 A;  1N1Q A;  5CMR A;  3W54 A;  3ISE A;  4A25 A;  1NFV A;  1S30 A;  2C2F A;  4Z5S A;  1KRQ A;  2IB0 A;  4ZLW A;  4PGK A;  1MFR A;  1NF4 A;  2YJK A;  4DI0 A;  3L0M A;  3KDQ A;  4TOA A;  1RCD A;  2FJC A;  2ZUR X;  4LQV A;  3GGY A;  2CWL A;  2QQY A;  2V2I A;  4ISP A;  4M34 A;  2HR5 A;  3PVY A;  1TJO A;  3QVD A;  2V2S A;  4ERU A;  4TOF A;  5C6F A;  1RYT A;  5D8Q A;  5ERJ A;  5JDO A;  3KA9 A;  4W4L B;  2WLA A;  3UNO A;  3E1Q A;  1O9I A;  2Z90 A;  2ZA7 A;  3ERZ A;  4TOD A;  2XGW A;  2VZB A;  3VNX A;  3QD8 A;  2JD7 0;  2CIH A;  2V2P A;  4EVE A;  5D8Y A;  1Z6O A;  5J8W A;  3AJP A;  3D19 A;  1LKM A;  5K53 A;  2Z5R A;  4PG0 A;  5ERK A;  5FFD A;  1GWG A;  3LKD A;  5FFB A;  2FFX J;  1VLG A;  3GVY A;  3R2H A;  3VVA A;  4XKT A;  1ZS3 A;  3E1O A;  1TKO A;  3KA6 A;  4LPJ A;  5E1U A;  3BT5 A;  3E1J A;  1LKP A;  3F32 A;  4YXM A;  1H96 A;  3A68 A;  2UX1 A;  2WLU A;  3BVL A;  3U90 A;  2YJJ A;  3F33 A;  3SID A;  2C41 A;  2ITB A;  1RCC A;  3FSE A;  1JI5 A;  4II4 B;  3O7S A;  4IWJ A;  3RAV A;  2C6R A;  2OC5 A;  3WVV A;  3C1Z A;  3KA3 A;  1LKO A;  3RBC A;  1R03 A;  5J9V A;  3SE1 A;  4KVS A;  3F39 A;  4CVS A;  2C2U A;  3QHC A;  5D8S A;  5I4J A;  4P18 A;  5AXS A;  4ZKW A;  3BVK A;  2FG4 A;  4QUW A;  3PVT B;  1OTK A;  4CY9 A;  4AM5 A;  4RC7 B;  3E1P A;  2OKC A;  2FG8 A;  2V2O A;  1YUZ A;  4EVB A;  3PW1 B;  4IXK A;  2CLB A;  4M35 A;  2BK6 A;  3EZU A;  1AEW A;  3WVW A;  3QHB A;  1NF6 A;  1VJX A;  4AM2 A;  2OH3 A;  2BJY A;  1JKU A;  1BCF A;  3Q4O A;  4KVR A;  3OGH A;  4U3G A;  4DZ0 A;  4CYA A;  4IWK A;  1YUX A;  4E40 A;  1LB3 A;  2Y3Q A;  4DAS A;  4XKU A;  2FHA A;  3A9Q A;  1BFR A;  3PWQ C;  1F30 A;  2CN6 A;  5JKL G;  3IS8 A;  5FEJ A;  3RE7 A;  2V2R A;  2D5K A;  2XJN A;  2YW7 A;  2V2L A;  1RCI A;  3M6J A;  4ITW A;  5GU2 X;  3C1Y A;  4CVR A;  2V8T A;  3F35 A;  2FKZ A;  1L8I A;  2CN7 A;  2F7N A;  3BVE A;  3EZ0 A;  5CMQ A;  1DPS A;  2Z6M A;  3IS7 A;  3V3K B;  1B71 A;  5GOU A;  1O9R A;  2V15 A;  4II4 A;  2HTN A;  2ZG9 X;  3AF7 X;  5JKL A;  2X17 0;  4LPM A;  1NNQ A;  2W0O A;  3AK9 A;  3KA4 A;  2G4H A;  3GGZ A;  4YXJ A;  1QGH A;  4CVP A;  3UOI A;  3AK8 A;  3AJO A;  3PW8 C;  2YW6 A;  4X0J A;  3KHK A;  4ZL5 A;  5J8S A;  3F37 A;  2GYD A;  3O7R A;  3PVT A;  2VXI A;  1JGC A;  5IX6 A;  4MXP A;  4AM4 A;  2V8U A;  4RC7 A;  1JRE A;  3BVF A;  2IU2 A;  2RBD A;  4ISM A;  1XZ1 A;  2PYB A;  1HRS A;  1L8H A;  1VEL A;  3PW1 A;  3GHQ A;  4REU A;  4YKH A;  5D8X A;  4TO9 A;  1J30 A;  3NP2 X;  5HJH A;  1IES A;  4ETR A;  4LPN A;  4DYZ A;  4Z3B A;  5JAC A;  2XKQ A;  3KWO A;  3JZA B;  3PW8 A;  4ZL6 A;  1RCG A;  2V2M A;  3BVI A;  1S2Z A;  3R2O A;  4OYN A;  2N02 A;  3SH6 A;  4DYY A;  1FHA A;  3PVR B;  4LYX A;  2C2J A;  4XKS A;  1TK6 A;  2GYQ A;  4XGS A;  2FZF A;  1UMN A;  2BKC A;  3C23 A;  2CLU A;  4RC6 B;  4ZKH A;  2JD8 0;  2GS4 A;  2VXX A;  4DE6 A;  3QB9 A;  1QYB A;  3E2C A;  5E2D A;  1MOJ A;  3F36 A;  3PZA A;  5HQO A;  2CHI A;  3R2L A;  4TOC A;  3R2S A;  5LS9 A;  2WWX B;  3E1N A;  4CMY A;  3RD0 A;  4MJY A;  2Z5P A;  4ITT A;  3UFB A;  4CYB A;  4WJG 4;  3E1L A;  4KVQ A;  3F38 A;  1BG7 A;  3NP0 X;  4RC5 B;  3FRR A;  1VEI A;  5LG2 A;  3DBY A;  3VV9 A;  3NOZ X;  5FFE A;  1UVH A;  3MPS A;  4LYU A;  3C21 A;  3FVB A;  5FFC A;  3IQ1 A;  5GU3 X;  1Z6O M;  3R2M A;  4EVC A;  3HL1 A;  4R42 A;  5D8P A;  1VEQ A;  1JI4 A;  5GN8 B;  2WTL A;  2ZA8 A;  3JZ9 A;  3PWQ A;  3PVR A;  3Q4Q A;  3E6R A;  3F34 A;  5JKM G;  4RC6 A;  4CMY V;  2CEI A;  4ZTT A;  3Q4R A;  2AR0 A; 
#chains in the Genus database with same CATH homology
 2Y44 A;  2Z5Q A;  4TOB A;  2QF9 A;  4PG1 A;  5D8O A;  5GU1 X;  3ISF A;  2ZG7 X;  2CHP A;  4M32 A;  4MKU A;  3RGD A;  3TA8 A;  4ZJK A;  3AF9 X;  2V2N A;  1JYB A;  3E1M A;  4YVZ A;  3UOF A;  2XJM A;  4M33 A;  3Q4N A;  3AF8 X;  5K52 A;  3WVU A;  3T9J A;  5JKM A;  5HJF A;  4LQH A;  1ZUJ A;  4W4K B;  5HU6 D;  3EGM A;  3HIU A;  1RCE A;  2IY4 A;  1DVB A;  3KX9 A;  2JD6 0;  1F33 A;  5D8R A;  3ES3 A;  2V2J A;  2FL0 A;  1JKV A;  1JTS A;  3R2R A;  4RC5 A;  1S3Q A;  3BKN A;  3PVY B;  4MN9 A;  2XJO A;  3KXU A;  3N6O A;  2CF7 A;  1EUM A;  5JDO B;  4TW3 A;  5GU0 X;  4CVT A;  1SOF A;  4LQN A;  1XZ3 A;  2ZG8 X;  3R2K A;  4TOG A;  4TOE A;  3FRS A;  4PGI A;  5LG8 A;  2G38 B;  3QZ3 A;  4EVD A;  4ZMC A;  1DAT A;  5GN8 A;  5CZU A;  3PWF A;  2BW1 A;  4ML5 A;  4E6K A;  1Z4A A;  5FFA A;  1IER A;  3E6S A;  3GE4 A;  3SHX A;  4MUD A;  3WNW A;  2ZA6 A;  4TOH A;  4ZKX A;  4KXR B;  4Y08 A;  5LBH A;  3FI6 A;  4DYU A;  4RC8 A;  2MGY A;  3KA8 A;  1SQ3 A;  4MY7 A;  1JIG A;  4LQJ A;  5J93 A;  3OJ5 A;  4DYX A;  3AJQ A;  3H7G A;  1TKP A;  1YV1 A;  1N1Q A;  5CMR A;  3W54 A;  3ISE A;  4A25 A;  1NFV A;  1S30 A;  2C2F A;  4Z5S A;  1KRQ A;  2IB0 A;  4ZLW A;  4PGK A;  1MFR A;  1NF4 A;  2YJK A;  4DI0 A;  3L0M A;  3KDQ A;  4TOA A;  1RCD A;  2FJC A;  2ZUR X;  4LQV A;  3GGY A;  2CWL A;  2QQY A;  2V2I A;  4ISP A;  4M34 A;  2HR5 A;  3PVY A;  1TJO A;  3QVD A;  2V2S A;  4ERU A;  4TOF A;  5C6F A;  1RYT A;  5D8Q A;  5ERJ A;  5JDO A;  3KA9 A;  4W4L B;  2WLA A;  3UNO A;  3E1Q A;  1O9I A;  2Z90 A;  2ZA7 A;  3ERZ A;  4TOD A;  2XGW A;  2VZB A;  3VNX A;  3QD8 A;  2JD7 0;  2CIH A;  2V2P A;  4EVE A;  5D8Y A;  1Z6O A;  5J8W A;  3AJP A;  3D19 A;  1LKM A;  5K53 A;  2Z5R A;  4PG0 A;  5ERK A;  5FFD A;  1GWG A;  3LKD A;  5FFB A;  2FFX J;  1VLG A;  3GVY A;  3R2H A;  3VVA A;  4XKT A;  1ZS3 A;  3E1O A;  1TKO A;  3KA6 A;  4LPJ A;  5E1U A;  3BT5 A;  3E1J A;  1LKP A;  3F32 A;  4YXM A;  1H96 A;  3A68 A;  2UX1 A;  2WLU A;  3BVL A;  3U90 A;  2YJJ A;  3F33 A;  3SID A;  2C41 A;  2ITB A;  1RCC A;  3FSE A;  1JI5 A;  4II4 B;  3O7S A;  4IWJ A;  3RAV A;  2C6R A;  2OC5 A;  3WVV A;  3C1Z A;  3KA3 A;  1LKO A;  3RBC A;  1R03 A;  5J9V A;  3SE1 A;  4KVS A;  3F39 A;  4CVS A;  2C2U A;  3QHC A;  5D8S A;  5I4J A;  4P18 A;  5AXS A;  4ZKW A;  3BVK A;  2FG4 A;  4QUW A;  3PVT B;  1OTK A;  4CY9 A;  4AM5 A;  4RC7 B;  3E1P A;  2OKC A;  2FG8 A;  2V2O A;  1YUZ A;  4EVB A;  3PW1 B;  4IXK A;  2CLB A;  4M35 A;  2BK6 A;  3EZU A;  1AEW A;  3WVW A;  3QHB A;  1NF6 A;  1VJX A;  4AM2 A;  2OH3 A;  2BJY A;  1JKU A;  1BCF A;  3Q4O A;  4KVR A;  3OGH A;  4U3G A;  4DZ0 A;  4CYA A;  4IWK A;  1YUX A;  4E40 A;  1LB3 A;  2Y3Q A;  4DAS A;  4XKU A;  2FHA A;  3A9Q A;  1BFR A;  3PWQ C;  1F30 A;  2CN6 A;  5JKL G;  3IS8 A;  5FEJ A;  3RE7 A;  2V2R A;  2D5K A;  2XJN A;  2YW7 A;  2V2L A;  1RCI A;  3M6J A;  4ITW A;  5GU2 X;  3C1Y A;  4CVR A;  2V8T A;  3F35 A;  2FKZ A;  1L8I A;  2CN7 A;  2F7N A;  3BVE A;  3EZ0 A;  5CMQ A;  1DPS A;  2Z6M A;  3IS7 A;  3V3K B;  1B71 A;  5GOU A;  1O9R A;  2V15 A;  4II4 A;  2HTN A;  2ZG9 X;  3AF7 X;  5JKL A;  2X17 0;  4LPM A;  1NNQ A;  2W0O A;  3AK9 A;  3KA4 A;  2G4H A;  3GGZ A;  4YXJ A;  1QGH A;  4CVP A;  3UOI A;  3AK8 A;  3AJO A;  3PW8 C;  2YW6 A;  4X0J A;  3KHK A;  4ZL5 A;  5J8S A;  3F37 A;  2GYD A;  3O7R A;  3PVT A;  2VXI A;  1JGC A;  5IX6 A;  4MXP A;  4AM4 A;  2V8U A;  4RC7 A;  1JRE A;  3BVF A;  2IU2 A;  2RBD A;  4ISM A;  1XZ1 A;  2PYB A;  1HRS A;  1L8H A;  1VEL A;  3PW1 A;  3GHQ A;  4REU A;  4YKH A;  5D8X A;  4TO9 A;  1J30 A;  3NP2 X;  5HJH A;  1IES A;  4ETR A;  4LPN A;  4DYZ A;  4Z3B A;  5JAC A;  2XKQ A;  3KWO A;  3JZA B;  3PW8 A;  4ZL6 A;  1RCG A;  2V2M A;  3BVI A;  1S2Z A;  3R2O A;  4OYN A;  2N02 A;  3SH6 A;  4DYY A;  1FHA A;  3PVR B;  4LYX A;  2C2J A;  4XKS A;  1TK6 A;  2GYQ A;  4XGS A;  2FZF A;  1UMN A;  2BKC A;  3C23 A;  2CLU A;  4RC6 B;  4ZKH A;  2JD8 0;  2GS4 A;  2VXX A;  4DE6 A;  3QB9 A;  1QYB A;  3E2C A;  5E2D A;  1MOJ A;  3F36 A;  3PZA A;  5HQO A;  2CHI A;  3R2L A;  4TOC A;  3R2S A;  5LS9 A;  2WWX B;  3E1N A;  4CMY A;  3RD0 A;  4MJY A;  2Z5P A;  4ITT A;  3UFB A;  4CYB A;  4WJG 4;  3E1L A;  4KVQ A;  3F38 A;  1BG7 A;  3NP0 X;  4RC5 B;  3FRR A;  1VEI A;  5LG2 A;  3DBY A;  3VV9 A;  3NOZ X;  5FFE A;  1UVH A;  3MPS A;  4LYU A;  3C21 A;  3FVB A;  5FFC A;  3IQ1 A;  5GU3 X;  1Z6O M;  3R2M A;  4EVC A;  3HL1 A;  4R42 A;  5D8P A;  1VEQ A;  1JI4 A;  5GN8 B;  2WTL A;  2ZA8 A;  3JZ9 A;  3PWQ A;  3PVR A;  3Q4Q A;  3E6R A;  3F34 A;  5JKM G;  4RC6 A;  4CMY V;  2CEI A;  4ZTT A;  3Q4R A;  2AR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...