2D5KA

Crystal structure of dps from staphylococcus aureus
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
148
structure length
148
Chain Sequence
SNQQDVVKELNQQVANWTVAYTKLHNFHWYVKGPNFFSLHVKFEELYNEASQYVDELAERILAVGGNPVGTLTECLEQSIVKEAAKGYSAEQMVEELSQDFTNISKQLENAIEIAGNAGDDVSEDMFIGMQTSVDKHNWMFKSYLSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Dps family protein
publication title Nucleoid compaction by MrgA(Asp56Ala/Glu60Ala) does not contribute to staphylococcal cell survival against oxidative stress and phagocytic killing by macrophages
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 66
structure length 148
sequence length 148
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.52: Transferred entry: 4.3.3.7.
pdb deposition date 2005-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2d5kA00
1J30A 4RC7B 2CN7A 4RC6A 4AM4A 2WTLA 3E1LA 1NFVA 4LPNA 5ERJA 1VEIA 4M33A 2XJMA 4DYZA 5JKLA 1LKPA 1JI5A 2CHIA 2Y3QA 1RCGA 2PYBA 1O9RA 4RC8A 3PWFA 2VXIA 3ISFA 5C6FA 1NNQA 3PVTA 2V15A 2FG8A 4MN9A 3PW8A 2FJCA 3F39A 1LB3A 1FHAA 2HTNA 3OJ5A 2V2PA 4P18A 3EGMA 3KWOA 2IU2A 3F35A 2ZA8A 4A25A 4XKUA 4IXKA 1JYBA 3IS7A 3O7SA 3E1NA 1TJOA 5GU1X 1TK6A 1JREA 3OGHA 3UOIA 3F34A 5IX6A 5FFAA 4DASA 3Q4OA 5FFEA 5CMQA 4EVEA 3QVDA 2Z5QA 3SE1A 1RCCA 4XKSA 2W0OA 3R2SA 1EUMA 4LYXA 1UVHA 2ZURX 2FL0A 3SH6A 1JTSA 1NF6A 3R2KA 2D5KA 2FZFA 4CVRA 2CEIA 3R2RA 4ISMA 4DE6A 2C41A 4LQVA 3F33A 3NP0X 2C2FA 4TW3A 5HJFA 4DYXA 4RC5A 2Z5PA 2FKZA 1F33A 1IERA 2UX1A 2Z6MA 3BVLA 1JIGA 3QD8A 4DYUA 3HL1A 1JGCA 1BFRA 4LQNA 3NOZX 4PGIA 4LQJA 1N1QA 2ZG9X 5J93A 5LBHA 3BVFA 1R03A 2BK6A 2FG4A 4R42A 3BVKA 2CN6A 3RGDA 2V2RA 2XGWA 5GN8B 3SIDA 2CLBA 3KX9A 1BG7A 3O7RA 3PVRA 4XGSA 1MFRA 2ZA7A 2VXXA 2XJOA 4QUWA 5FFBA 1NF4A 4XKTA 4II4B 2G4HA 3E1PA 2ZA6A 3HIUA 3Q4RA 4ITTA 4TODA 4ZTTA 4DZ0A 5CMRA 2ZG8X 1YUZA 3IS8A 3QHBA 1HRSA 3PW1A 1L8IA 3PVYB 4CMYA 1JKUA 3AJOA 4REUA 4ML5A 1VJXA 5D8QA 4CYAA 4KVSA 4PG0A 5JKMA 2X170 5GU2X 4PG1A 4TOFA 2BJYA 3FI6A 5J8SA 1XZ1A 2QF9A 2C6RA 4ZMCA 1SQ3A 1RYTA 2V2JA 3KXUA 4LPJA 2YW6A 3E1MA 3T9JA 3IQ1A 3E6SA 1B71A 1IESA 3PWQC 4TOCA 5JKLG 3AJQA 1MOJA 4RC6B 2JD80 2QQYA 4CY9A 1Z6OA 3KA3A 4TOEA 4IWJA 2V2LA 3WVWA 4CVSA 1XZ3A 2CF7A 4LYUA 4M35A 4ZJKA 2VZBA 2IB0A 5ERKA 2JD70 2C2JA 3KA4A 3RBCA 4TOGA 2GYQA 3PVTB 4RC7A 5FEJA 3KA6A 1KRQA 3VNXA 4MKUA 4PGKA 4MUDA 4ZLWA 5LG8A 1YUXA 4KVRA 5GU3X 5LS9A 1ZS3A 2V2MA 5J9VA 3ISEA 1F30A 5HJHA 2RBDA 2YW7A 2F7NA 3AF9X 4LPMA 2FFXJ 5K52A 4AM5A 1GWGA 3F37A 1YV1A 4M34A 3E1QA 5JACA 1LKMA 3WNWA 1OTKA 5FFDA 1L8HA 3RE7A 1DPSA 4ITWA 1LKOA 2BKCA 3KA8A 3U90A 5HQOA 1AEWA 1BCFA 2Z5RA 5D8OA 3NP2X 3R2MA 5D8PA 1O9IA 2C2UA 2V2OA 2Z90A 3A68A 3GVYA 4ZL6A 2FHAA 3PZAA 4M32A 1JKVA 2XJNA 3ES3A 3BVIA 1S2ZA 3PWQA 4TOBA 5GU0X 4MY7A 3FSEA 1VELA 1S30A 1Z6OM 1DVBA 2IY4A 4RC5B 3QHCA 4ZKHA 1DATA 3E1OA 3E1JA 4CVTA 4CMYV 3F32A 3MPSA 4TO9A 2WLAA 4TOAA 1TKOA 5D8YA 3EZUA 1VLGA 3AJPA 3R2HA 3UOFA 2GYDA 5D8SA 3AK9A 5J8WA 3GHQA 2V2IA 4YKHA 4Z3BA 4E6KA 5E1UA 1SOFA 2ITBA 5E2DA 3QZ3A 4LQHA 4ERUA 3BT5A 4EVCA 3KA9A 3PVRB 2JD60 3A9QA 5LG2A 5CZUA 1UMNA 4U3GA 3QB9A 5D8RA 4EVDA 4KVQA 3AK8A 3F38A 2YJJA 2XKQA 1Z4AA 3ERZA 3E6RA 1RCDA 5GN8A 3AF7X 3Q4NA 5GOUA 4IWKA 2HR5A 1RCIA 3PW1B 3R2OA 3E2CA 4ETRA 1JI4A 2CLUA 3UNOA 3BKNA 2V2NA 3Q4QA 5JKMG 4ZL5A 5FFCA 2OC5A 4II4A 1RCEA 3PW8C 4TOHA 2V2SA 2GS4A 4EVBA 3RAVA 2YJKA 2OH3A 5D8XA 3R2LA 5I4JA 3PVYA 2BW1A 4CVPA 3TA8A 4OYNA 3WVVA 1H96A 3BVEA 3WVUA 5K53A 5AXSA 1QGHA 2CIHA 3FVBA 1TKPA 2ZG7X 4DYYA 3F36A 4Z5SA 3GE4A 2CHPA 3EZ0A 3H7GA 4AM2A 1S3QA 4ISPA 3AF8X 3SHXA 1ZUJA 1QYBA 4Y08A 1VEQA 4DI0A 4MJYA 2WLUA 4ZKXA 3RD0A 4CYBA 4ZKWA
chains in the Genus database with same CATH superfamily
1J30A 4RC7B 2CN7A 4RC6A 4AM4A 2WTLA 3E1LA 1NFVA 4LPNA 5ERJA 1VEIA 4M33A 2XJMA 3GGZA 4DYZA 5JKLA 1LKPA 1JI5A 2CHIA 2Y3QA 1RCGA 2PYBA 1O9RA 4RC8A 3PWFA 2VXIA 3ISFA 5C6FA 1NNQA 3PVTA 2V15A 2FG8A 4MN9A 2OKCA 3PW8A 2FJCA 3F39A 1LB3A 1FHAA 2HTNA 3OJ5A 2V2PA 4P18A 3EGMA 3KWOA 2IU2A 3F35A 2ZA8A 4A25A 2G38B 4XKUA 4IXKA 1JYBA 3IS7A 3O7SA 3E1NA 1TJOA 4MXPA 5GU1X 1TK6A 1JREA 3OGHA 3UOIA 3F34A 5IX6A 5FFAA 4DASA 3Q4OA 5FFEA 5CMQA 4EVEA 3QVDA 2Z5QA 3SE1A 1RCCA 4XKSA 2W0OA 3R2SA 1EUMA 5HU6D 4LYXA 1UVHA 2ZURX 3FRSA 2FL0A 3SH6A 1JTSA 1NF6A 3R2KA 2D5KA 2FZFA 4CVRA 2CEIA 3R2RA 4ISMA 4DE6A 2C41A 4LQVA 3F33A 3NP0X 2C2FA 4TW3A 5HJFA 4DYXA 4RC5A 2Z5PA 2FKZA 1F33A 2V8UA 3M6JA 1IERA 2UX1A 2Z6MA 3BVLA 3VVAA 1JIGA 3QD8A 3GGYA 4DYUA 3HL1A 1JGCA 1BFRA 4LQNA 3NOZX 4PGIA 4LQJA 1N1QA 2ZG9X 5J93A 5LBHA 3BVFA 1R03A 2BK6A 2FG4A 4R42A 3BVKA 2CN6A 3RGDA 2V2RA 2XGWA 5GN8B 3SIDA 2CLBA 3KX9A 1BG7A 3O7RA 3PVRA 4XGSA 3VV9A 1MFRA 2ZA7A 4YXMA 2VXXA 2XJOA 4QUWA 5FFBA 1NF4A 4XKTA 4II4B 2G4HA 3E1PA 2ZA6A 3HIUA 3Q4RA 4ITTA 4TODA 4ZTTA 5JDOA 4DZ0A 5CMRA 2ZG8X 2N02A 1YUZA 3IS8A 3QHBA 1HRSA 3PW1A 1L8IA 3PVYB 4CMYA 1JKUA 3AJOA 4REUA 4ML5A 3N6OA 1VJXA 5D8QA 4CYAA 4KVSA 2AR0A 4PG0A 4KXRB 5JKMA 3V3KB 3FRRA 2X170 3UFBA 5GU2X 4PG1A 4TOFA 2BJYA 3FI6A 2MGYA 5J8SA 1XZ1A 2QF9A 2C6RA 4E40A 4ZMCA 1SQ3A 1RYTA 3LKDA 2V2JA 3KXUA 4LPJA 2YW6A 3E1MA 3T9JA 3IQ1A 3E6SA 1B71A 1IESA 3PWQC 4TOCA 5JKLG 3JZAB 3AJQA 1MOJA 4RC6B 2JD80 2QQYA 4CY9A 3JZ9A 1Z6OA 3KA3A 4TOEA 4IWJA 2V2LA 3WVWA 4CVSA 1XZ3A 2CF7A 4LYUA 4M35A 4ZJKA 2VZBA 2IB0A 5ERKA 2JD70 2C2JA 3KA4A 3RBCA 3KHKA 4TOGA 2GYQA 3PVTB 4RC7A 5FEJA 3KA6A 1KRQA 3VNXA 4MKUA 4PGKA 4MUDA 4ZLWA 3DBYA 5LG8A 1YUXA 4KVRA 5GU3X 2WWXB 1ZS3A 2V2MA 5J9VA 5LS9A 3ISEA 1F30A 5HJHA 2RBDA 2YW7A 4X0JA 2F7NA 3AF9X 4LPMA 2FFXJ 5K52A 4AM5A 1GWGA 3F37A 1YV1A 4M34A 3E1QA 5JACA 1LKMA 3WNWA 1OTKA 5FFDA 1L8HA 3RE7A 1DPSA 4ITWA 4W4LB 1LKOA 2BKCA 3KA8A 3U90A 5HQOA 1AEWA 1BCFA 2Z5RA 5D8OA 3NP2X 3R2MA 5D8PA 3C21A 1O9IA 2C2UA 2V2OA 3L0MA 2Z90A 3A68A 3GVYA 4ZL6A 2FHAA 3PZAA 4M32A 1JKVA 2XJNA 3ES3A 3BVIA 1S2ZA 3PWQA 4TOBA 5GU0X 4MY7A 3FSEA 1VELA 1S30A 1Z6OM 1DVBA 2IY4A 4RC5B 3QHCA 4WJG4 4ZKHA 1DATA 3E1OA 3E1JA 4CVTA 4CMYV 3F32A 3MPSA 4TO9A 2WLAA 4TOAA 1TKOA 5D8YA 3W54A 3C23A 3EZUA 1VLGA 3AJPA 3R2HA 3UOFA 2GYDA 5D8SA 3AK9A 5J8WA 3GHQA 2V2IA 4YKHA 4Z3BA 4E6KA 5E1UA 1SOFA 2ITBA 5E2DA 3QZ3A 4LQHA 4ERUA 3BT5A 4EVCA 3KA9A 3PVRB 2JD60 3A9QA 5LG2A 5CZUA 1UMNA 4U3GA 3QB9A 5D8RA 4EVDA 4KVQA 3AK8A 3F38A 2YJJA 2V8TA 2CWLA 2XKQA 1Z4AA 3ERZA 4W4KB 3E6RA 5JDOB 1RCDA 5GN8A 3AF7X 2Y44A 3Q4NA 5GOUA 4IWKA 2HR5A 1RCIA 3PW1B 3R2OA 3E2CA 4ETRA 1JI4A 2CLUA 3UNOA 3BKNA 2V2NA 3Q4QA 5JKMG 4ZL5A 5FFCA 2OC5A 4II4A 1RCEA 3PW8C 4TOHA 2V2SA 2GS4A 4EVBA 3RAVA 2YJKA 2OH3A 5D8XA 3R2LA 5I4JA 3PVYA 2BW1A 4CVPA 3TA8A 3C1ZA 3D19A 4OYNA 3WVVA 1H96A 3BVEA 3WVUA 5K53A 5AXSA 3C1YA 4YXJA 1QGHA 2CIHA 3FVBA 1TKPA 2ZG7X 4DYYA 3F36A 4Z5SA 3GE4A 2CHPA 3EZ0A 3H7GA 4AM2A 1S3QA 4ISPA 3KDQA 3AF8X 3SHXA 1ZUJA 1QYBA 4Y08A 1VEQA 4DI0A 4MJYA 2WLUA 4ZKXA 3RD0A 4CYBA 4YVZA 4ZKWA
chains in the Genus database with same CATH topology
1J30A 4RC7B 2CN7A 4RC6A 4AM4A 2WTLA 3E1LA 1NFVA 4LPNA 5ERJA 1VEIA 4M33A 2XJMA 3GGZA 4DYZA 5JKLA 1LKPA 1JI5A 2CHIA 2Y3QA 1RCGA 2PYBA 1O9RA 4RC8A 3PWFA 2VXIA 3ISFA 5C6FA 1NNQA 3PVTA 2V15A 2FG8A 4MN9A 2OKCA 3PW8A 2FJCA 3F39A 1LB3A 1FHAA 2HTNA 3OJ5A 2V2PA 4P18A 3EGMA 3KWOA 2IU2A 3F35A 2ZA8A 4A25A 2G38B 4XKUA 4IXKA 1JYBA 3IS7A 3O7SA 3E1NA 1TJOA 4MXPA 5GU1X 1TK6A 1JREA 3OGHA 3UOIA 3F34A 5IX6A 5FFAA 4DASA 3Q4OA 5FFEA 5CMQA 4EVEA 3QVDA 2Z5QA 3SE1A 1RCCA 4XKSA 2W0OA 3R2SA 1EUMA 5HU6D 4LYXA 1UVHA 2ZURX 3FRSA 2FL0A 3SH6A 1JTSA 1NF6A 3R2KA 2D5KA 2FZFA 4CVRA 2CEIA 3R2RA 4ISMA 4DE6A 2C41A 4LQVA 3F33A 3NP0X 2C2FA 4TW3A 5HJFA 4DYXA 4RC5A 2Z5PA 2FKZA 1F33A 2V8UA 3M6JA 1IERA 2UX1A 2Z6MA 3BVLA 3VVAA 1JIGA 3QD8A 3GGYA 4DYUA 3HL1A 1JGCA 1BFRA 4LQNA 3NOZX 4PGIA 4LQJA 1N1QA 2ZG9X 5J93A 5LBHA 3BVFA 1R03A 2BK6A 2FG4A 4R42A 3BVKA 2CN6A 3RGDA 2V2RA 2XGWA 5GN8B 3SIDA 2CLBA 3KX9A 1BG7A 3O7RA 3PVRA 4XGSA 3VV9A 1MFRA 2ZA7A 4YXMA 2VXXA 2XJOA 4QUWA 5FFBA 1NF4A 4XKTA 4II4B 2G4HA 3E1PA 2ZA6A 3HIUA 3Q4RA 4ITTA 4TODA 4ZTTA 5JDOA 4DZ0A 5CMRA 2ZG8X 2N02A 1YUZA 3IS8A 3QHBA 1HRSA 3PW1A 1L8IA 3PVYB 4CMYA 1JKUA 3AJOA 4REUA 4ML5A 3N6OA 1VJXA 5D8QA 4CYAA 4KVSA 2AR0A 4PG0A 4KXRB 5JKMA 3V3KB 3FRRA 2X170 3UFBA 5GU2X 4PG1A 4TOFA 2BJYA 3FI6A 2MGYA 5J8SA 1XZ1A 2QF9A 2C6RA 4E40A 4ZMCA 1SQ3A 1RYTA 3LKDA 2V2JA 3KXUA 4LPJA 2YW6A 3E1MA 3T9JA 3IQ1A 3E6SA 1B71A 1IESA 3PWQC 4TOCA 5JKLG 3JZAB 3AJQA 1MOJA 4RC6B 2JD80 2QQYA 4CY9A 3JZ9A 1Z6OA 3KA3A 4TOEA 4IWJA 2V2LA 3WVWA 4CVSA 1XZ3A 2CF7A 4LYUA 4M35A 4ZJKA 2VZBA 2IB0A 5ERKA 2JD70 2C2JA 3KA4A 3RBCA 3KHKA 4TOGA 2GYQA 3PVTB 4RC7A 5FEJA 3KA6A 1KRQA 3VNXA 4MKUA 4PGKA 4MUDA 4ZLWA 3DBYA 5LG8A 1YUXA 4KVRA 5GU3X 2WWXB 1ZS3A 2V2MA 5J9VA 5LS9A 3ISEA 1F30A 5HJHA 2RBDA 2YW7A 4X0JA 2F7NA 3AF9X 4LPMA 2FFXJ 5K52A 4AM5A 1GWGA 3F37A 1YV1A 4M34A 3E1QA 5JACA 1LKMA 3WNWA 1OTKA 5FFDA 1L8HA 3RE7A 1DPSA 4ITWA 4W4LB 1LKOA 2BKCA 3KA8A 3U90A 5HQOA 1AEWA 1BCFA 2Z5RA 5D8OA 3NP2X 3R2MA 5D8PA 3C21A 1O9IA 2C2UA 2V2OA 3L0MA 2Z90A 3A68A 3GVYA 4ZL6A 2FHAA 3PZAA 4M32A 1JKVA 2XJNA 3ES3A 3BVIA 1S2ZA 3PWQA 4TOBA 5GU0X 4MY7A 3FSEA 1VELA 1S30A 1Z6OM 1DVBA 2IY4A 4RC5B 3QHCA 4WJG4 4ZKHA 1DATA 3E1OA 3E1JA 4CVTA 4CMYV 3F32A 3MPSA 4TO9A 2WLAA 4TOAA 1TKOA 5D8YA 3W54A 3C23A 3EZUA 1VLGA 3AJPA 3R2HA 3UOFA 2GYDA 5D8SA 3AK9A 5J8WA 3GHQA 2V2IA 4YKHA 4Z3BA 4E6KA 5E1UA 1SOFA 2ITBA 5E2DA 3QZ3A 4LQHA 4ERUA 3BT5A 4EVCA 3KA9A 3PVRB 2JD60 3A9QA 5LG2A 5CZUA 1UMNA 4U3GA 3QB9A 5D8RA 4EVDA 4KVQA 3AK8A 3F38A 2YJJA 2V8TA 2CWLA 2XKQA 1Z4AA 3ERZA 4W4KB 3E6RA 5JDOB 1RCDA 5GN8A 3AF7X 2Y44A 3Q4NA 5GOUA 4IWKA 2HR5A 1RCIA 3PW1B 3R2OA 3E2CA 4ETRA 1JI4A 2CLUA 3UNOA 3BKNA 2V2NA 3Q4QA 5JKMG 4ZL5A 5FFCA 2OC5A 4II4A 1RCEA 3PW8C 4TOHA 2V2SA 2GS4A 4EVBA 3RAVA 2YJKA 2OH3A 5D8XA 3R2LA 5I4JA 3PVYA 2BW1A 4CVPA 3TA8A 3C1ZA 3D19A 4OYNA 3WVVA 1H96A 3BVEA 3WVUA 5K53A 5AXSA 3C1YA 4YXJA 1QGHA 2CIHA 3FVBA 1TKPA 2ZG7X 4DYYA 3F36A 4Z5SA 3GE4A 2CHPA 3EZ0A 3H7GA 4AM2A 1S3QA 4ISPA 3KDQA 3AF8X 3SHXA 1ZUJA 1QYBA 4Y08A 1VEQA 4DI0A 4MJYA 2WLUA 4ZKXA 3RD0A 4CYBA 4YVZA 4ZKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J30 A;  4RC7 B;  2CN7 A;  4RC6 A;  4AM4 A;  2WTL A;  3E1L A;  1NFV A;  4LPN A;  5ERJ A;  1VEI A;  4M33 A;  2XJM A;  4DYZ A;  5JKL A;  1LKP A;  1JI5 A;  2CHI A;  2Y3Q A;  1RCG A;  2PYB A;  1O9R A;  4RC8 A;  3PWF A;  2VXI A;  3ISF A;  5C6F A;  1NNQ A;  3PVT A;  2V15 A;  2FG8 A;  4MN9 A;  3PW8 A;  2FJC A;  3F39 A;  1LB3 A;  1FHA A;  2HTN A;  3OJ5 A;  2V2P A;  4P18 A;  3EGM A;  3KWO A;  2IU2 A;  3F35 A;  2ZA8 A;  4A25 A;  4XKU A;  4IXK A;  1JYB A;  3IS7 A;  3O7S A;  3E1N A;  1TJO A;  5GU1 X;  1TK6 A;  1JRE A;  3OGH A;  3UOI A;  3F34 A;  5IX6 A;  5FFA A;  4DAS A;  3Q4O A;  5FFE A;  5CMQ A;  4EVE A;  3QVD A;  2Z5Q A;  3SE1 A;  1RCC A;  4XKS A;  2W0O A;  3R2S A;  1EUM A;  4LYX A;  1UVH A;  2ZUR X;  2FL0 A;  3SH6 A;  1JTS A;  1NF6 A;  3R2K A;  2D5K A;  2FZF A;  4CVR A;  2CEI A;  3R2R A;  4ISM A;  4DE6 A;  2C41 A;  4LQV A;  3F33 A;  3NP0 X;  2C2F A;  4TW3 A;  5HJF A;  4DYX A;  4RC5 A;  2Z5P A;  2FKZ A;  1F33 A;  1IER A;  2UX1 A;  2Z6M A;  3BVL A;  1JIG A;  3QD8 A;  4DYU A;  3HL1 A;  1JGC A;  1BFR A;  4LQN A;  3NOZ X;  4PGI A;  4LQJ A;  1N1Q A;  2ZG9 X;  5J93 A;  5LBH A;  3BVF A;  1R03 A;  2BK6 A;  2FG4 A;  4R42 A;  3BVK A;  2CN6 A;  3RGD A;  2V2R A;  2XGW A;  5GN8 B;  3SID A;  2CLB A;  3KX9 A;  1BG7 A;  3O7R A;  3PVR A;  4XGS A;  1MFR A;  2ZA7 A;  2VXX A;  2XJO A;  4QUW A;  5FFB A;  1NF4 A;  4XKT A;  4II4 B;  2G4H A;  3E1P A;  2ZA6 A;  3HIU A;  3Q4R A;  4ITT A;  4TOD A;  4ZTT A;  4DZ0 A;  5CMR A;  2ZG8 X;  1YUZ A;  3IS8 A;  3QHB A;  1HRS A;  3PW1 A;  1L8I A;  3PVY B;  4CMY A;  1JKU A;  3AJO A;  4REU A;  4ML5 A;  1VJX A;  5D8Q A;  4CYA A;  4KVS A;  4PG0 A;  5JKM A;  2X17 0;  5GU2 X;  4PG1 A;  4TOF A;  2BJY A;  3FI6 A;  5J8S A;  1XZ1 A;  2QF9 A;  2C6R A;  4ZMC A;  1SQ3 A;  1RYT A;  2V2J A;  3KXU A;  4LPJ A;  2YW6 A;  3E1M A;  3T9J A;  3IQ1 A;  3E6S A;  1B71 A;  1IES A;  3PWQ C;  4TOC A;  5JKL G;  3AJQ A;  1MOJ A;  4RC6 B;  2JD8 0;  2QQY A;  4CY9 A;  1Z6O A;  3KA3 A;  4TOE A;  4IWJ A;  2V2L A;  3WVW A;  4CVS A;  1XZ3 A;  2CF7 A;  4LYU A;  4M35 A;  4ZJK A;  2VZB A;  2IB0 A;  5ERK A;  2JD7 0;  2C2J A;  3KA4 A;  3RBC A;  4TOG A;  2GYQ A;  3PVT B;  4RC7 A;  5FEJ A;  3KA6 A;  1KRQ A;  3VNX A;  4MKU A;  4PGK A;  4MUD A;  4ZLW A;  5LG8 A;  1YUX A;  4KVR A;  5GU3 X;  5LS9 A;  1ZS3 A;  2V2M A;  5J9V A;  3ISE A;  1F30 A;  5HJH A;  2RBD A;  2YW7 A;  2F7N A;  3AF9 X;  4LPM A;  2FFX J;  5K52 A;  4AM5 A;  1GWG A;  3F37 A;  1YV1 A;  4M34 A;  3E1Q A;  5JAC A;  1LKM A;  3WNW A;  1OTK A;  5FFD A;  1L8H A;  3RE7 A;  1DPS A;  4ITW A;  1LKO A;  2BKC A;  3KA8 A;  3U90 A;  5HQO A;  1AEW A;  1BCF A;  2Z5R A;  5D8O A;  3NP2 X;  3R2M A;  5D8P A;  1O9I A;  2C2U A;  2V2O A;  2Z90 A;  3A68 A;  3GVY A;  4ZL6 A;  2FHA A;  3PZA A;  4M32 A;  1JKV A;  2XJN A;  3ES3 A;  3BVI A;  1S2Z A;  3PWQ A;  4TOB A;  5GU0 X;  4MY7 A;  3FSE A;  1VEL A;  1S30 A;  1Z6O M;  1DVB A;  2IY4 A;  4RC5 B;  3QHC A;  4ZKH A;  1DAT A;  3E1O A;  3E1J A;  4CVT A;  4CMY V;  3F32 A;  3MPS A;  4TO9 A;  2WLA A;  4TOA A;  1TKO A;  5D8Y A;  3EZU A;  1VLG A;  3AJP A;  3R2H A;  3UOF A;  2GYD A;  5D8S A;  3AK9 A;  5J8W A;  3GHQ A;  2V2I A;  4YKH A;  4Z3B A;  4E6K A;  5E1U A;  1SOF A;  2ITB A;  5E2D A;  3QZ3 A;  4LQH A;  4ERU A;  3BT5 A;  4EVC A;  3KA9 A;  3PVR B;  2JD6 0;  3A9Q A;  5LG2 A;  5CZU A;  1UMN A;  4U3G A;  3QB9 A;  5D8R A;  4EVD A;  4KVQ A;  3AK8 A;  3F38 A;  2YJJ A;  2XKQ A;  1Z4A A;  3ERZ A;  3E6R A;  1RCD A;  5GN8 A;  3AF7 X;  3Q4N A;  5GOU A;  4IWK A;  2HR5 A;  1RCI A;  3PW1 B;  3R2O A;  3E2C A;  4ETR A;  1JI4 A;  2CLU A;  3UNO A;  3BKN A;  2V2N A;  3Q4Q A;  5JKM G;  4ZL5 A;  5FFC A;  2OC5 A;  4II4 A;  1RCE A;  3PW8 C;  4TOH A;  2V2S A;  2GS4 A;  4EVB A;  3RAV A;  2YJK A;  2OH3 A;  5D8X A;  3R2L A;  5I4J A;  3PVY A;  2BW1 A;  4CVP A;  3TA8 A;  4OYN A;  3WVV A;  1H96 A;  3BVE A;  3WVU A;  5K53 A;  5AXS A;  1QGH A;  2CIH A;  3FVB A;  1TKP A;  2ZG7 X;  4DYY A;  3F36 A;  4Z5S A;  3GE4 A;  2CHP A;  3EZ0 A;  3H7G A;  4AM2 A;  1S3Q A;  4ISP A;  3AF8 X;  3SHX A;  1ZUJ A;  1QYB A;  4Y08 A;  1VEQ A;  4DI0 A;  4MJY A;  2WLU A;  4ZKX A;  3RD0 A;  4CYB A;  4ZKW A; 
#chains in the Genus database with same CATH topology
 1J30 A;  4RC7 B;  2CN7 A;  4RC6 A;  4AM4 A;  2WTL A;  3E1L A;  1NFV A;  4LPN A;  5ERJ A;  1VEI A;  4M33 A;  2XJM A;  3GGZ A;  4DYZ A;  5JKL A;  1LKP A;  1JI5 A;  2CHI A;  2Y3Q A;  1RCG A;  2PYB A;  1O9R A;  4RC8 A;  3PWF A;  2VXI A;  3ISF A;  5C6F A;  1NNQ A;  3PVT A;  2V15 A;  2FG8 A;  4MN9 A;  2OKC A;  3PW8 A;  2FJC A;  3F39 A;  1LB3 A;  1FHA A;  2HTN A;  3OJ5 A;  2V2P A;  4P18 A;  3EGM A;  3KWO A;  2IU2 A;  3F35 A;  2ZA8 A;  4A25 A;  2G38 B;  4XKU A;  4IXK A;  1JYB A;  3IS7 A;  3O7S A;  3E1N A;  1TJO A;  4MXP A;  5GU1 X;  1TK6 A;  1JRE A;  3OGH A;  3UOI A;  3F34 A;  5IX6 A;  5FFA A;  4DAS A;  3Q4O A;  5FFE A;  5CMQ A;  4EVE A;  3QVD A;  2Z5Q A;  3SE1 A;  1RCC A;  4XKS A;  2W0O A;  3R2S A;  1EUM A;  5HU6 D;  4LYX A;  1UVH A;  2ZUR X;  3FRS A;  2FL0 A;  3SH6 A;  1JTS A;  1NF6 A;  3R2K A;  2D5K A;  2FZF A;  4CVR A;  2CEI A;  3R2R A;  4ISM A;  4DE6 A;  2C41 A;  4LQV A;  3F33 A;  3NP0 X;  2C2F A;  4TW3 A;  5HJF A;  4DYX A;  4RC5 A;  2Z5P A;  2FKZ A;  1F33 A;  2V8U A;  3M6J A;  1IER A;  2UX1 A;  2Z6M A;  3BVL A;  3VVA A;  1JIG A;  3QD8 A;  3GGY A;  4DYU A;  3HL1 A;  1JGC A;  1BFR A;  4LQN A;  3NOZ X;  4PGI A;  4LQJ A;  1N1Q A;  2ZG9 X;  5J93 A;  5LBH A;  3BVF A;  1R03 A;  2BK6 A;  2FG4 A;  4R42 A;  3BVK A;  2CN6 A;  3RGD A;  2V2R A;  2XGW A;  5GN8 B;  3SID A;  2CLB A;  3KX9 A;  1BG7 A;  3O7R A;  3PVR A;  4XGS A;  3VV9 A;  1MFR A;  2ZA7 A;  4YXM A;  2VXX A;  2XJO A;  4QUW A;  5FFB A;  1NF4 A;  4XKT A;  4II4 B;  2G4H A;  3E1P A;  2ZA6 A;  3HIU A;  3Q4R A;  4ITT A;  4TOD A;  4ZTT A;  5JDO A;  4DZ0 A;  5CMR A;  2ZG8 X;  2N02 A;  1YUZ A;  3IS8 A;  3QHB A;  1HRS A;  3PW1 A;  1L8I A;  3PVY B;  4CMY A;  1JKU A;  3AJO A;  4REU A;  4ML5 A;  3N6O A;  1VJX A;  5D8Q A;  4CYA A;  4KVS A;  2AR0 A;  4PG0 A;  4KXR B;  5JKM A;  3V3K B;  3FRR A;  2X17 0;  3UFB A;  5GU2 X;  4PG1 A;  4TOF A;  2BJY A;  3FI6 A;  2MGY A;  5J8S A;  1XZ1 A;  2QF9 A;  2C6R A;  4E40 A;  4ZMC A;  1SQ3 A;  1RYT A;  3LKD A;  2V2J A;  3KXU A;  4LPJ A;  2YW6 A;  3E1M A;  3T9J A;  3IQ1 A;  3E6S A;  1B71 A;  1IES A;  3PWQ C;  4TOC A;  5JKL G;  3JZA B;  3AJQ A;  1MOJ A;  4RC6 B;  2JD8 0;  2QQY A;  4CY9 A;  3JZ9 A;  1Z6O A;  3KA3 A;  4TOE A;  4IWJ A;  2V2L A;  3WVW A;  4CVS A;  1XZ3 A;  2CF7 A;  4LYU A;  4M35 A;  4ZJK A;  2VZB A;  2IB0 A;  5ERK A;  2JD7 0;  2C2J A;  3KA4 A;  3RBC A;  3KHK A;  4TOG A;  2GYQ A;  3PVT B;  4RC7 A;  5FEJ A;  3KA6 A;  1KRQ A;  3VNX A;  4MKU A;  4PGK A;  4MUD A;  4ZLW A;  3DBY A;  5LG8 A;  1YUX A;  4KVR A;  5GU3 X;  2WWX B;  1ZS3 A;  2V2M A;  5J9V A;  5LS9 A;  3ISE A;  1F30 A;  5HJH A;  2RBD A;  2YW7 A;  4X0J A;  2F7N A;  3AF9 X;  4LPM A;  2FFX J;  5K52 A;  4AM5 A;  1GWG A;  3F37 A;  1YV1 A;  4M34 A;  3E1Q A;  5JAC A;  1LKM A;  3WNW A;  1OTK A;  5FFD A;  1L8H A;  3RE7 A;  1DPS A;  4ITW A;  4W4L B;  1LKO A;  2BKC A;  3KA8 A;  3U90 A;  5HQO A;  1AEW A;  1BCF A;  2Z5R A;  5D8O A;  3NP2 X;  3R2M A;  5D8P A;  3C21 A;  1O9I A;  2C2U A;  2V2O A;  3L0M A;  2Z90 A;  3A68 A;  3GVY A;  4ZL6 A;  2FHA A;  3PZA A;  4M32 A;  1JKV A;  2XJN A;  3ES3 A;  3BVI A;  1S2Z A;  3PWQ A;  4TOB A;  5GU0 X;  4MY7 A;  3FSE A;  1VEL A;  1S30 A;  1Z6O M;  1DVB A;  2IY4 A;  4RC5 B;  3QHC A;  4WJG 4;  4ZKH A;  1DAT A;  3E1O A;  3E1J A;  4CVT A;  4CMY V;  3F32 A;  3MPS A;  4TO9 A;  2WLA A;  4TOA A;  1TKO A;  5D8Y A;  3W54 A;  3C23 A;  3EZU A;  1VLG A;  3AJP A;  3R2H A;  3UOF A;  2GYD A;  5D8S A;  3AK9 A;  5J8W A;  3GHQ A;  2V2I A;  4YKH A;  4Z3B A;  4E6K A;  5E1U A;  1SOF A;  2ITB A;  5E2D A;  3QZ3 A;  4LQH A;  4ERU A;  3BT5 A;  4EVC A;  3KA9 A;  3PVR B;  2JD6 0;  3A9Q A;  5LG2 A;  5CZU A;  1UMN A;  4U3G A;  3QB9 A;  5D8R A;  4EVD A;  4KVQ A;  3AK8 A;  3F38 A;  2YJJ A;  2V8T A;  2CWL A;  2XKQ A;  1Z4A A;  3ERZ A;  4W4K B;  3E6R A;  5JDO B;  1RCD A;  5GN8 A;  3AF7 X;  2Y44 A;  3Q4N A;  5GOU A;  4IWK A;  2HR5 A;  1RCI A;  3PW1 B;  3R2O A;  3E2C A;  4ETR A;  1JI4 A;  2CLU A;  3UNO A;  3BKN A;  2V2N A;  3Q4Q A;  5JKM G;  4ZL5 A;  5FFC A;  2OC5 A;  4II4 A;  1RCE A;  3PW8 C;  4TOH A;  2V2S A;  2GS4 A;  4EVB A;  3RAV A;  2YJK A;  2OH3 A;  5D8X A;  3R2L A;  5I4J A;  3PVY A;  2BW1 A;  4CVP A;  3TA8 A;  3C1Z A;  3D19 A;  4OYN A;  3WVV A;  1H96 A;  3BVE A;  3WVU A;  5K53 A;  5AXS A;  3C1Y A;  4YXJ A;  1QGH A;  2CIH A;  3FVB A;  1TKP A;  2ZG7 X;  4DYY A;  3F36 A;  4Z5S A;  3GE4 A;  2CHP A;  3EZ0 A;  3H7G A;  4AM2 A;  1S3Q A;  4ISP A;  3KDQ A;  3AF8 X;  3SHX A;  1ZUJ A;  1QYB A;  4Y08 A;  1VEQ A;  4DI0 A;  4MJY A;  2WLU A;  4ZKX A;  3RD0 A;  4CYB A;  4YVZ A;  4ZKW A; 
#chains in the Genus database with same CATH homology
 1J30 A;  4RC7 B;  2CN7 A;  4RC6 A;  4AM4 A;  2WTL A;  3E1L A;  1NFV A;  4LPN A;  5ERJ A;  1VEI A;  4M33 A;  2XJM A;  3GGZ A;  4DYZ A;  5JKL A;  1LKP A;  1JI5 A;  2CHI A;  2Y3Q A;  1RCG A;  2PYB A;  1O9R A;  4RC8 A;  3PWF A;  2VXI A;  3ISF A;  5C6F A;  1NNQ A;  3PVT A;  2V15 A;  2FG8 A;  4MN9 A;  2OKC A;  3PW8 A;  2FJC A;  3F39 A;  1LB3 A;  1FHA A;  2HTN A;  3OJ5 A;  2V2P A;  4P18 A;  3EGM A;  3KWO A;  2IU2 A;  3F35 A;  2ZA8 A;  4A25 A;  2G38 B;  4XKU A;  4IXK A;  1JYB A;  3IS7 A;  3O7S A;  3E1N A;  1TJO A;  4MXP A;  5GU1 X;  1TK6 A;  1JRE A;  3OGH A;  3UOI A;  3F34 A;  5IX6 A;  5FFA A;  4DAS A;  3Q4O A;  5FFE A;  5CMQ A;  4EVE A;  3QVD A;  2Z5Q A;  3SE1 A;  1RCC A;  4XKS A;  2W0O A;  3R2S A;  1EUM A;  5HU6 D;  4LYX A;  1UVH A;  2ZUR X;  3FRS A;  2FL0 A;  3SH6 A;  1JTS A;  1NF6 A;  3R2K A;  2D5K A;  2FZF A;  4CVR A;  2CEI A;  3R2R A;  4ISM A;  4DE6 A;  2C41 A;  4LQV A;  3F33 A;  3NP0 X;  2C2F A;  4TW3 A;  5HJF A;  4DYX A;  4RC5 A;  2Z5P A;  2FKZ A;  1F33 A;  2V8U A;  3M6J A;  1IER A;  2UX1 A;  2Z6M A;  3BVL A;  3VVA A;  1JIG A;  3QD8 A;  3GGY A;  4DYU A;  3HL1 A;  1JGC A;  1BFR A;  4LQN A;  3NOZ X;  4PGI A;  4LQJ A;  1N1Q A;  2ZG9 X;  5J93 A;  5LBH A;  3BVF A;  1R03 A;  2BK6 A;  2FG4 A;  4R42 A;  3BVK A;  2CN6 A;  3RGD A;  2V2R A;  2XGW A;  5GN8 B;  3SID A;  2CLB A;  3KX9 A;  1BG7 A;  3O7R A;  3PVR A;  4XGS A;  3VV9 A;  1MFR A;  2ZA7 A;  4YXM A;  2VXX A;  2XJO A;  4QUW A;  5FFB A;  1NF4 A;  4XKT A;  4II4 B;  2G4H A;  3E1P A;  2ZA6 A;  3HIU A;  3Q4R A;  4ITT A;  4TOD A;  4ZTT A;  5JDO A;  4DZ0 A;  5CMR A;  2ZG8 X;  2N02 A;  1YUZ A;  3IS8 A;  3QHB A;  1HRS A;  3PW1 A;  1L8I A;  3PVY B;  4CMY A;  1JKU A;  3AJO A;  4REU A;  4ML5 A;  3N6O A;  1VJX A;  5D8Q A;  4CYA A;  4KVS A;  2AR0 A;  4PG0 A;  4KXR B;  5JKM A;  3V3K B;  3FRR A;  2X17 0;  3UFB A;  5GU2 X;  4PG1 A;  4TOF A;  2BJY A;  3FI6 A;  2MGY A;  5J8S A;  1XZ1 A;  2QF9 A;  2C6R A;  4E40 A;  4ZMC A;  1SQ3 A;  1RYT A;  3LKD A;  2V2J A;  3KXU A;  4LPJ A;  2YW6 A;  3E1M A;  3T9J A;  3IQ1 A;  3E6S A;  1B71 A;  1IES A;  3PWQ C;  4TOC A;  5JKL G;  3JZA B;  3AJQ A;  1MOJ A;  4RC6 B;  2JD8 0;  2QQY A;  4CY9 A;  3JZ9 A;  1Z6O A;  3KA3 A;  4TOE A;  4IWJ A;  2V2L A;  3WVW A;  4CVS A;  1XZ3 A;  2CF7 A;  4LYU A;  4M35 A;  4ZJK A;  2VZB A;  2IB0 A;  5ERK A;  2JD7 0;  2C2J A;  3KA4 A;  3RBC A;  3KHK A;  4TOG A;  2GYQ A;  3PVT B;  4RC7 A;  5FEJ A;  3KA6 A;  1KRQ A;  3VNX A;  4MKU A;  4PGK A;  4MUD A;  4ZLW A;  3DBY A;  5LG8 A;  1YUX A;  4KVR A;  5GU3 X;  2WWX B;  1ZS3 A;  2V2M A;  5J9V A;  5LS9 A;  3ISE A;  1F30 A;  5HJH A;  2RBD A;  2YW7 A;  4X0J A;  2F7N A;  3AF9 X;  4LPM A;  2FFX J;  5K52 A;  4AM5 A;  1GWG A;  3F37 A;  1YV1 A;  4M34 A;  3E1Q A;  5JAC A;  1LKM A;  3WNW A;  1OTK A;  5FFD A;  1L8H A;  3RE7 A;  1DPS A;  4ITW A;  4W4L B;  1LKO A;  2BKC A;  3KA8 A;  3U90 A;  5HQO A;  1AEW A;  1BCF A;  2Z5R A;  5D8O A;  3NP2 X;  3R2M A;  5D8P A;  3C21 A;  1O9I A;  2C2U A;  2V2O A;  3L0M A;  2Z90 A;  3A68 A;  3GVY A;  4ZL6 A;  2FHA A;  3PZA A;  4M32 A;  1JKV A;  2XJN A;  3ES3 A;  3BVI A;  1S2Z A;  3PWQ A;  4TOB A;  5GU0 X;  4MY7 A;  3FSE A;  1VEL A;  1S30 A;  1Z6O M;  1DVB A;  2IY4 A;  4RC5 B;  3QHC A;  4WJG 4;  4ZKH A;  1DAT A;  3E1O A;  3E1J A;  4CVT A;  4CMY V;  3F32 A;  3MPS A;  4TO9 A;  2WLA A;  4TOA A;  1TKO A;  5D8Y A;  3W54 A;  3C23 A;  3EZU A;  1VLG A;  3AJP A;  3R2H A;  3UOF A;  2GYD A;  5D8S A;  3AK9 A;  5J8W A;  3GHQ A;  2V2I A;  4YKH A;  4Z3B A;  4E6K A;  5E1U A;  1SOF A;  2ITB A;  5E2D A;  3QZ3 A;  4LQH A;  4ERU A;  3BT5 A;  4EVC A;  3KA9 A;  3PVR B;  2JD6 0;  3A9Q A;  5LG2 A;  5CZU A;  1UMN A;  4U3G A;  3QB9 A;  5D8R A;  4EVD A;  4KVQ A;  3AK8 A;  3F38 A;  2YJJ A;  2V8T A;  2CWL A;  2XKQ A;  1Z4A A;  3ERZ A;  4W4K B;  3E6R A;  5JDO B;  1RCD A;  5GN8 A;  3AF7 X;  2Y44 A;  3Q4N A;  5GOU A;  4IWK A;  2HR5 A;  1RCI A;  3PW1 B;  3R2O A;  3E2C A;  4ETR A;  1JI4 A;  2CLU A;  3UNO A;  3BKN A;  2V2N A;  3Q4Q A;  5JKM G;  4ZL5 A;  5FFC A;  2OC5 A;  4II4 A;  1RCE A;  3PW8 C;  4TOH A;  2V2S A;  2GS4 A;  4EVB A;  3RAV A;  2YJK A;  2OH3 A;  5D8X A;  3R2L A;  5I4J A;  3PVY A;  2BW1 A;  4CVP A;  3TA8 A;  3C1Z A;  3D19 A;  4OYN A;  3WVV A;  1H96 A;  3BVE A;  3WVU A;  5K53 A;  5AXS A;  3C1Y A;  4YXJ A;  1QGH A;  2CIH A;  3FVB A;  1TKP A;  2ZG7 X;  4DYY A;  3F36 A;  4Z5S A;  3GE4 A;  2CHP A;  3EZ0 A;  3H7G A;  4AM2 A;  1S3Q A;  4ISP A;  3KDQ A;  3AF8 X;  3SHX A;  1ZUJ A;  1QYB A;  4Y08 A;  1VEQ A;  4DI0 A;  4MJY A;  2WLU A;  4ZKX A;  3RD0 A;  4CYB A;  4YVZ A;  4ZKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...