2BJYA

The x-ray crystal structure of listeria innocua dps h31g-h43g mutant.
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
150
structure length
150
Chain Sequence
VDTKEFLNHQVANLNVFTVKIHQIGWYMRGHNFFTLGEKMDDLYSEFGEQMDEVAERLLAIGGSPFSTLKEFLENASVEEAPYTKPKTMDQLMEDLVGTLELLRDEYKQGIELTDKEGDDVTNDMLIAFKASIDKHIWMFKAFLGKAPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Iron oxidation and storage
molecule keywords NON-HEME IRON-CONTAINING FERRITIN
publication title The Unusual Intersubunit Ferroxidase Center of Listeria Innocua Dps is Required for Hydrogen Peroxide Detoxification But not for Iron Uptake. A Study with Site-Specific Mutants
pubmed doi rcsb
source organism Listeria innocua
total genus 64
structure length 150
sequence length 150
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2005-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2bjyA00
4IXKA 3HIUA 4DYYA 3QB9A 2VXIA 5C6FA 2XJMA 3FVBA 2V2MA 5HJHA 1LKOA 5J9VA 2XJNA 3GVYA 1B71A 2IB0A 4OYNA 1HRSA 3SHXA 3GHQA 3F38A 3ISEA 3R2RA 3PW1B 4EVBA 1LKMA 3R2HA 1YUZA 1LB3A 3PVYB 2D5KA 3PWFA 4RC7B 4ZKHA 1YV1A 3A9QA 4DASA 3OJ5A 4CYAA 3R2SA 2Z5QA 3Q4OA 3IS7A 1R03A 2OH3A 3TA8A 1F33A 1OTKA 3RBCA 1NF6A 5GN8B 2C6RA 4AM4A 2W0OA 3E1LA 2BJYA 4Z3BA 4TW3A 3U90A 3PW8C 1L8HA 2X170 3NP2X 4ZKXA 1VEIA 1N1QA 4TOFA 1UMNA 2C41A 1QYBA 1TKPA 3R2LA 3KA8A 1JKUA 4LYUA 3PZAA 1TK6A 4DYZA 2WTLA 2YJKA 4M35A 3E1JA 4MN9A 2CHPA 4E6KA 3F32A 3BVEA 3ERZA 4CVSA 3AF7X 3O7SA 2CN6A 5HJFA 3RGDA 3E2CA 3BVIA 3F33A 4AM5A 1JYBA 2CF7A 3UOIA 4XKSA 4LQJA 3AJPA 5I4JA 4KVSA 1Z4AA 2ZA7A 4MY7A 1JI5A 1O9IA 4TODA 2V15A 3AK9A 4EVEA 5D8YA 1DPSA 3FI6A 4YKHA 4QUWA 1XZ1A 4CMYV 4RC8A 4PGIA 2CLUA 4P18A 5D8OA 3IQ1A 3UNOA 2CN7A 4IWKA 2CHIA 3WVVA 3PVRB 3E6RA 1IESA 5FFAA 2GS4A 3VNXA 2FG8A 3MPSA 2GYQA 3R2MA 5E2DA 2FJCA 1UVHA 4XGSA 5FFBA 1BCFA 3EZ0A 1DATA 3PW1A 1ZUJA 3AK8A 4TOAA 2PYBA 2FHAA 5JKMA 4ETRA 2V2IA 5LBHA 3T9JA 3H7GA 3PVYA 4RC7A 2JD60 5GU0X 4ML5A 2ZG8X 2JD70 3QZ3A 2YW7A 3F34A 1H96A 5HQOA 5GOUA 2QF9A 2XJOA 1BG7A 5D8SA 4ITWA 2XKQA 4TOBA 4DE6A 5JKMG 4M32A 1RCGA 3PVTB 3WVUA 2V2PA 3KWOA 5LG8A 5GN8A 3F39A 4MUDA 1TKOA 2BKCA 3E1OA 2C2FA 3RD0A 5K53A 3OGHA 1VJXA 4Y08A 1EUMA 3ISFA 2V2RA 5ERJA 4DI0A 2V2NA 2YW6A 5D8PA 2WLUA 1NFVA 4ITTA 1IERA 4LPJA 4CMYA 4XKTA 5JACA 2HR5A 2Y3QA 3UOFA 1TJOA 4RC5B 2FFXJ 2FG4A 3E1MA 4TOEA 4RC5A 3R2KA 5LG2A 1FHAA 5JKLA 5D8RA 1DVBA 1VLGA 1JI4A 1S2ZA 4ZL6A 1JTSA 2GYDA 2BW1A 3Q4RA 4PG1A 3F37A 3F36A 5CMRA 2Z5PA 5GU3X 5CZUA 5D8XA 5IX6A 3HL1A 4CVPA 3KA9A 5JKLG 2CIHA 2G4HA 1QGHA 2Z5RA 3SH6A 3GE4A 4ISPA 1VEQA 4TOHA 2FZFA 4LQNA 1RCEA 3QD8A 3KA4A 3BVLA 4TO9A 1NF4A 1JIGA 5J8WA 4II4B 3SIDA 4LQVA 2QQYA 4REUA 2ZG7X 3O7RA 3R2OA 3FSEA 4ZLWA 2ZURX 1LKPA 1F30A 3PVRA 5K52A 3KA6A 3QVDA 5ERKA 5LS9A 4RC6B 2YJJA 1JKVA 2VXXA 1SQ3A 4ZMCA 4PG0A 1GWGA 2V2LA 3PWQA 1SOFA 2VZBA 3KX9A 1RCCA 2CEIA 1RYTA 3E1QA 3Q4QA 3RE7A 3E6SA 5GU2X 5FFEA 1BFRA 2XGWA 2IY4A 4R42A 2RBDA 1JGCA 2BK6A 4TOCA 4U3GA 4KVQA 2OC5A 4KVRA 4ERUA 2FL0A 4MKUA 3BVFA 3PVTA 5FEJA 4DZ0A 1ZS3A 4TOGA 3RAVA 2IU2A 2JD80 1JREA 4ZTTA 2ITBA 2FKZA 2WLAA 1AEWA 4AM2A 2HTNA 1J30A 3BKNA 1RCDA 3E1NA 3NP0X 5CMQA 4CVTA 4LYXA 5J8SA 2CLBA 3SE1A 3QHCA 3ES3A 1Z6OM 3AF8X 4CVRA 3Q4NA 1VELA 5FFCA 2V2JA 2ZA6A 4M33A 3AJOA 1L8IA 4Z5SA 3AJQA 4A25A 4LPNA 3BT5A 2V2OA 5GU1X 2C2JA 4CY9A 2Z6MA 4LQHA 3IS8A 4ZJKA 1Z6OA 3WNWA 2ZA8A 2UX1A 2C2UA 4DYXA 4M34A 3KA3A 5J93A 1YUXA 2Z90A 2F7NA 2ZG9X 4XKUA 1S30A 3BVKA 3EGMA 5AXSA 3F35A 1KRQA 1O9RA 3PWQC 4ZKWA 3PW8A 3NOZX 1MFRA 3WVWA 4DYUA 1RCIA 3KXUA 3AF9X 4II4A 5D8QA 4PGKA 5E1UA 4EVDA 4EVCA 4CYBA 3EZUA 4LPMA 5FFDA 4RC6A 1S3QA 3A68A 3E1PA 1NNQA 3QHBA 1MOJA 4IWJA 4ISMA 4ZL5A 4MJYA 1XZ3A 2V2SA
chains in the Genus database with same CATH superfamily
4IXKA 3HIUA 4DYYA 3QB9A 2VXIA 5C6FA 2XJMA 3FVBA 2V2MA 5HJHA 1LKOA 5J9VA 2XJNA 3GVYA 1B71A 2IB0A 4OYNA 1HRSA 3SHXA 4WJG4 3GHQA 3F38A 3ISEA 3R2RA 3PW1B 4EVBA 1LKMA 3R2HA 1YUZA 1LB3A 3PVYB 2D5KA 3PWFA 4RC7B 4ZKHA 1YV1A 3A9QA 4DASA 3OJ5A 4CYAA 3R2SA 2Z5QA 3Q4OA 3IS7A 1R03A 2OH3A 3FRRA 3TA8A 3V3KB 3JZAB 1F33A 1OTKA 3C1ZA 3RBCA 2V8UA 1NF6A 5GN8B 2C6RA 4AM4A 2W0OA 3E1LA 2BJYA 4Z3BA 4TW3A 3U90A 3PW8C 1L8HA 2X170 4MXPA 3NP2X 4ZKXA 1VEIA 1N1QA 4TOFA 4W4LB 1UMNA 2C41A 1QYBA 1TKPA 3R2LA 3KA8A 1JKUA 4LYUA 2WWXB 3PZAA 1TK6A 4DYZA 2WTLA 2YJKA 4M35A 3E1JA 5HU6D 4MN9A 2CHPA 4E6KA 3F32A 3BVEA 3ERZA 4CVSA 3AF7X 3O7SA 2CN6A 5HJFA 3RGDA 3E2CA 3BVIA 3F33A 4AM5A 1JYBA 2CF7A 3UOIA 4XKSA 4LQJA 3AJPA 5I4JA 4KVSA 1Z4AA 2ZA7A 4MY7A 1JI5A 1O9IA 4TODA 2V15A 3AK9A 4EVEA 5D8YA 1DPSA 3FI6A 4YKHA 4QUWA 1XZ1A 4CMYV 3DBYA 4RC8A 4PGIA 2N02A 2CLUA 4P18A 5D8OA 3IQ1A 3UNOA 2CN7A 4IWKA 2CHIA 3WVVA 3PVRB 3E6RA 1IESA 3VV9A 5FFAA 2GS4A 3VNXA 2FG8A 3MPSA 2GYQA 3R2MA 2AR0A 5E2DA 2FJCA 3L0MA 1UVHA 4XGSA 5FFBA 1BCFA 3EZ0A 1DATA 3PW1A 1ZUJA 3AK8A 4TOAA 2PYBA 2FHAA 5JKMA 4ETRA 2V2IA 5LBHA 3T9JA 3H7GA 3PVYA 4RC7A 2JD60 5GU0X 2ZG8X 4ML5A 2JD70 3QZ3A 3W54A 2YW7A 3F34A 1H96A 5HQOA 5GOUA 2QF9A 2XJOA 1BG7A 5D8SA 4ITWA 2XKQA 4TOBA 4DE6A 5JKMG 4M32A 1RCGA 3PVTB 3WVUA 2V2PA 3KWOA 5LG8A 5GN8A 3KHKA 3F39A 3KDQA 4MUDA 1TKOA 2BKCA 3E1OA 2C2FA 2OKCA 3RD0A 3JZ9A 5K53A 3OGHA 1VJXA 4Y08A 1EUMA 3ISFA 2V2RA 5ERJA 4DI0A 2V2NA 3C23A 2YW6A 5D8PA 2WLUA 1NFVA 4ITTA 1IERA 4LPJA 4CMYA 4XKTA 5JACA 2HR5A 2MGYA 2Y3QA 3UOFA 1TJOA 4RC5B 2FFXJ 2FG4A 3E1MA 4TOEA 4RC5A 3R2KA 5LG2A 1FHAA 5JKLA 5D8RA 1DVBA 1VLGA 1JI4A 1S2ZA 4ZL6A 1JTSA 2GYDA 2BW1A 3Q4RA 4PG1A 3F37A 3F36A 5CMRA 2Z5PA 3VVAA 5GU3X 5CZUA 5D8XA 5IX6A 3HL1A 4CVPA 3KA9A 5JKLG 2CIHA 4X0JA 2G4HA 1QGHA 2Z5RA 3SH6A 3GE4A 5JDOB 4ISPA 1VEQA 4TOHA 2FZFA 4LQNA 2Y44A 1RCEA 3QD8A 3KA4A 3BVLA 4TO9A 1NF4A 1JIGA 5J8WA 4II4B 3SIDA 4LQVA 2QQYA 4REUA 2ZG7X 3O7RA 3R2OA 3FSEA 4ZLWA 2ZURX 1LKPA 1F30A 3PVRA 5K52A 3KA6A 3QVDA 5ERKA 5LS9A 4RC6B 2YJJA 1JKVA 2VXXA 1SQ3A 4ZMCA 4PG0A 1GWGA 2V2LA 3GGYA 3PWQA 1SOFA 2VZBA 3KX9A 1RCCA 2CEIA 1RYTA 3E1QA 3Q4QA 3RE7A 2G38B 3E6SA 2CWLA 5GU2X 5FFEA 1BFRA 2XGWA 2IY4A 4R42A 3C1YA 2RBDA 1JGCA 2BK6A 4TOCA 4U3GA 4E40A 4KVQA 2OC5A 4KVRA 4ERUA 2FL0A 4MKUA 3BVFA 3PVTA 5FEJA 4DZ0A 1ZS3A 4TOGA 3RAVA 2IU2A 2JD80 1JREA 4ZTTA 2ITBA 2FKZA 2WLAA 1AEWA 4AM2A 2HTNA 1J30A 2V8TA 3BKNA 1RCDA 3E1NA 3LKDA 3NP0X 5CMQA 4CVTA 4LYXA 5J8SA 2CLBA 3SE1A 3QHCA 3M6JA 3ES3A 4W4KB 1Z6OM 3AF8X 4CVRA 3Q4NA 1VELA 3UFBA 5FFCA 2V2JA 2ZA6A 4M33A 3AJOA 1L8IA 4Z5SA 3FRSA 3AJQA 4A25A 4LPNA 3BT5A 2V2OA 5GU1X 3N6OA 2C2JA 4CY9A 2Z6MA 4LQHA 3IS8A 4ZJKA 1Z6OA 3WNWA 2ZA8A 2UX1A 2C2UA 4DYXA 3GGZA 4M34A 3KA3A 5J93A 1YUXA 2Z90A 2F7NA 2ZG9X 4XKUA 1S30A 3BVKA 4YVZA 3EGMA 5AXSA 5JDOA 3C21A 3F35A 1KRQA 1O9RA 3PWQC 4ZKWA 3PW8A 3NOZX 1MFRA 4YXJA 3WVWA 4DYUA 1RCIA 4KXRB 3KXUA 3AF9X 4YXMA 4II4A 5D8QA 4PGKA 5E1UA 4EVDA 4EVCA 4CYBA 3EZUA 4LPMA 5FFDA 4RC6A 1S3QA 3A68A 3E1PA 1NNQA 3QHBA 1MOJA 4IWJA 4ISMA 4ZL5A 3D19A 4MJYA 1XZ3A 2V2SA
chains in the Genus database with same CATH topology
4IXKA 3HIUA 4DYYA 3QB9A 2VXIA 5C6FA 2XJMA 3FVBA 2V2MA 5HJHA 1LKOA 5J9VA 2XJNA 3GVYA 1B71A 2IB0A 4OYNA 1HRSA 3SHXA 4WJG4 3GHQA 3F38A 3ISEA 3R2RA 3PW1B 4EVBA 1LKMA 3R2HA 1YUZA 1LB3A 3PVYB 2D5KA 3PWFA 4RC7B 4ZKHA 1YV1A 3A9QA 4DASA 3OJ5A 4CYAA 3R2SA 2Z5QA 3Q4OA 3IS7A 1R03A 2OH3A 3FRRA 3TA8A 3V3KB 3JZAB 1F33A 1OTKA 3C1ZA 3RBCA 2V8UA 1NF6A 5GN8B 2C6RA 4AM4A 2W0OA 3E1LA 2BJYA 4Z3BA 4TW3A 3U90A 3PW8C 1L8HA 2X170 4MXPA 3NP2X 4ZKXA 1VEIA 1N1QA 4TOFA 4W4LB 1UMNA 2C41A 1QYBA 1TKPA 3R2LA 3KA8A 1JKUA 4LYUA 2WWXB 3PZAA 1TK6A 4DYZA 2WTLA 2YJKA 4M35A 3E1JA 5HU6D 4MN9A 2CHPA 4E6KA 3F32A 3BVEA 3ERZA 4CVSA 3AF7X 3O7SA 2CN6A 5HJFA 3RGDA 3E2CA 3BVIA 3F33A 4AM5A 1JYBA 2CF7A 3UOIA 4XKSA 4LQJA 3AJPA 5I4JA 4KVSA 1Z4AA 2ZA7A 4MY7A 1JI5A 1O9IA 4TODA 2V15A 3AK9A 4EVEA 5D8YA 1DPSA 3FI6A 4YKHA 4QUWA 1XZ1A 4CMYV 3DBYA 4RC8A 4PGIA 2N02A 2CLUA 4P18A 5D8OA 3IQ1A 3UNOA 2CN7A 4IWKA 2CHIA 3WVVA 3PVRB 3E6RA 1IESA 3VV9A 5FFAA 2GS4A 3VNXA 2FG8A 3MPSA 2GYQA 3R2MA 2AR0A 5E2DA 2FJCA 3L0MA 1UVHA 4XGSA 5FFBA 1BCFA 3EZ0A 1DATA 3PW1A 1ZUJA 3AK8A 4TOAA 2PYBA 2FHAA 5JKMA 4ETRA 2V2IA 5LBHA 3T9JA 3H7GA 3PVYA 4RC7A 2JD60 5GU0X 2ZG8X 4ML5A 2JD70 3QZ3A 3W54A 2YW7A 3F34A 1H96A 5HQOA 5GOUA 2QF9A 2XJOA 1BG7A 5D8SA 4ITWA 2XKQA 4TOBA 4DE6A 5JKMG 4M32A 1RCGA 3PVTB 3WVUA 2V2PA 3KWOA 5LG8A 5GN8A 3KHKA 3F39A 3KDQA 4MUDA 1TKOA 2BKCA 3E1OA 2C2FA 2OKCA 3RD0A 3JZ9A 5K53A 3OGHA 1VJXA 4Y08A 1EUMA 3ISFA 2V2RA 5ERJA 4DI0A 2V2NA 3C23A 2YW6A 5D8PA 2WLUA 1NFVA 4ITTA 1IERA 4LPJA 4CMYA 4XKTA 5JACA 2HR5A 2MGYA 2Y3QA 3UOFA 1TJOA 4RC5B 2FFXJ 2FG4A 3E1MA 4TOEA 4RC5A 3R2KA 5LG2A 1FHAA 5JKLA 5D8RA 1DVBA 1VLGA 1JI4A 1S2ZA 4ZL6A 1JTSA 2GYDA 2BW1A 3Q4RA 4PG1A 3F37A 3F36A 5CMRA 2Z5PA 3VVAA 5GU3X 5CZUA 5D8XA 5IX6A 3HL1A 4CVPA 3KA9A 5JKLG 2CIHA 4X0JA 2G4HA 1QGHA 2Z5RA 3SH6A 3GE4A 5JDOB 4ISPA 1VEQA 4TOHA 2FZFA 4LQNA 2Y44A 1RCEA 3QD8A 3KA4A 3BVLA 4TO9A 1NF4A 1JIGA 5J8WA 4II4B 3SIDA 4LQVA 2QQYA 4REUA 2ZG7X 3O7RA 3R2OA 3FSEA 4ZLWA 2ZURX 1LKPA 1F30A 3PVRA 5K52A 3KA6A 3QVDA 5ERKA 5LS9A 4RC6B 2YJJA 1JKVA 2VXXA 1SQ3A 4ZMCA 4PG0A 1GWGA 2V2LA 3GGYA 3PWQA 1SOFA 2VZBA 3KX9A 1RCCA 2CEIA 1RYTA 3E1QA 3Q4QA 3RE7A 2G38B 3E6SA 2CWLA 5GU2X 5FFEA 1BFRA 2XGWA 2IY4A 4R42A 3C1YA 2RBDA 1JGCA 2BK6A 4TOCA 4U3GA 4E40A 4KVQA 2OC5A 4KVRA 4ERUA 2FL0A 4MKUA 3BVFA 3PVTA 5FEJA 4DZ0A 1ZS3A 4TOGA 3RAVA 2IU2A 2JD80 1JREA 4ZTTA 2ITBA 2FKZA 2WLAA 1AEWA 4AM2A 2HTNA 1J30A 2V8TA 3BKNA 1RCDA 3E1NA 3LKDA 3NP0X 5CMQA 4CVTA 4LYXA 5J8SA 2CLBA 3SE1A 3QHCA 3M6JA 3ES3A 4W4KB 1Z6OM 3AF8X 4CVRA 3Q4NA 1VELA 3UFBA 5FFCA 2V2JA 2ZA6A 4M33A 3AJOA 1L8IA 4Z5SA 3FRSA 3AJQA 4A25A 4LPNA 3BT5A 2V2OA 5GU1X 3N6OA 2C2JA 4CY9A 2Z6MA 4LQHA 3IS8A 4ZJKA 1Z6OA 3WNWA 2ZA8A 2UX1A 2C2UA 4DYXA 3GGZA 4M34A 3KA3A 5J93A 1YUXA 2Z90A 2F7NA 2ZG9X 4XKUA 1S30A 3BVKA 4YVZA 3EGMA 5AXSA 5JDOA 3C21A 3F35A 1KRQA 1O9RA 3PWQC 4ZKWA 3PW8A 3NOZX 1MFRA 4YXJA 3WVWA 4DYUA 1RCIA 4KXRB 3KXUA 3AF9X 4YXMA 4II4A 5D8QA 4PGKA 5E1UA 4EVDA 4EVCA 4CYBA 3EZUA 4LPMA 5FFDA 4RC6A 1S3QA 3A68A 3E1PA 1NNQA 3QHBA 1MOJA 4IWJA 4ISMA 4ZL5A 3D19A 4MJYA 1XZ3A 2V2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IXK A;  3HIU A;  4DYY A;  3QB9 A;  2VXI A;  5C6F A;  2XJM A;  3FVB A;  2V2M A;  5HJH A;  1LKO A;  5J9V A;  2XJN A;  3GVY A;  1B71 A;  2IB0 A;  4OYN A;  1HRS A;  3SHX A;  3GHQ A;  3F38 A;  3ISE A;  3R2R A;  3PW1 B;  4EVB A;  1LKM A;  3R2H A;  1YUZ A;  1LB3 A;  3PVY B;  2D5K A;  3PWF A;  4RC7 B;  4ZKH A;  1YV1 A;  3A9Q A;  4DAS A;  3OJ5 A;  4CYA A;  3R2S A;  2Z5Q A;  3Q4O A;  3IS7 A;  1R03 A;  2OH3 A;  3TA8 A;  1F33 A;  1OTK A;  3RBC A;  1NF6 A;  5GN8 B;  2C6R A;  4AM4 A;  2W0O A;  3E1L A;  2BJY A;  4Z3B A;  4TW3 A;  3U90 A;  3PW8 C;  1L8H A;  2X17 0;  3NP2 X;  4ZKX A;  1VEI A;  1N1Q A;  4TOF A;  1UMN A;  2C41 A;  1QYB A;  1TKP A;  3R2L A;  3KA8 A;  1JKU A;  4LYU A;  3PZA A;  1TK6 A;  4DYZ A;  2WTL A;  2YJK A;  4M35 A;  3E1J A;  4MN9 A;  2CHP A;  4E6K A;  3F32 A;  3BVE A;  3ERZ A;  4CVS A;  3AF7 X;  3O7S A;  2CN6 A;  5HJF A;  3RGD A;  3E2C A;  3BVI A;  3F33 A;  4AM5 A;  1JYB A;  2CF7 A;  3UOI A;  4XKS A;  4LQJ A;  3AJP A;  5I4J A;  4KVS A;  1Z4A A;  2ZA7 A;  4MY7 A;  1JI5 A;  1O9I A;  4TOD A;  2V15 A;  3AK9 A;  4EVE A;  5D8Y A;  1DPS A;  3FI6 A;  4YKH A;  4QUW A;  1XZ1 A;  4CMY V;  4RC8 A;  4PGI A;  2CLU A;  4P18 A;  5D8O A;  3IQ1 A;  3UNO A;  2CN7 A;  4IWK A;  2CHI A;  3WVV A;  3PVR B;  3E6R A;  1IES A;  5FFA A;  2GS4 A;  3VNX A;  2FG8 A;  3MPS A;  2GYQ A;  3R2M A;  5E2D A;  2FJC A;  1UVH A;  4XGS A;  5FFB A;  1BCF A;  3EZ0 A;  1DAT A;  3PW1 A;  1ZUJ A;  3AK8 A;  4TOA A;  2PYB A;  2FHA A;  5JKM A;  4ETR A;  2V2I A;  5LBH A;  3T9J A;  3H7G A;  3PVY A;  4RC7 A;  2JD6 0;  5GU0 X;  4ML5 A;  2ZG8 X;  2JD7 0;  3QZ3 A;  2YW7 A;  3F34 A;  1H96 A;  5HQO A;  5GOU A;  2QF9 A;  2XJO A;  1BG7 A;  5D8S A;  4ITW A;  2XKQ A;  4TOB A;  4DE6 A;  5JKM G;  4M32 A;  1RCG A;  3PVT B;  3WVU A;  2V2P A;  3KWO A;  5LG8 A;  5GN8 A;  3F39 A;  4MUD A;  1TKO A;  2BKC A;  3E1O A;  2C2F A;  3RD0 A;  5K53 A;  3OGH A;  1VJX A;  4Y08 A;  1EUM A;  3ISF A;  2V2R A;  5ERJ A;  4DI0 A;  2V2N A;  2YW6 A;  5D8P A;  2WLU A;  1NFV A;  4ITT A;  1IER A;  4LPJ A;  4CMY A;  4XKT A;  5JAC A;  2HR5 A;  2Y3Q A;  3UOF A;  1TJO A;  4RC5 B;  2FFX J;  2FG4 A;  3E1M A;  4TOE A;  4RC5 A;  3R2K A;  5LG2 A;  1FHA A;  5JKL A;  5D8R A;  1DVB A;  1VLG A;  1JI4 A;  1S2Z A;  4ZL6 A;  1JTS A;  2GYD A;  2BW1 A;  3Q4R A;  4PG1 A;  3F37 A;  3F36 A;  5CMR A;  2Z5P A;  5GU3 X;  5CZU A;  5D8X A;  5IX6 A;  3HL1 A;  4CVP A;  3KA9 A;  5JKL G;  2CIH A;  2G4H A;  1QGH A;  2Z5R A;  3SH6 A;  3GE4 A;  4ISP A;  1VEQ A;  4TOH A;  2FZF A;  4LQN A;  1RCE A;  3QD8 A;  3KA4 A;  3BVL A;  4TO9 A;  1NF4 A;  1JIG A;  5J8W A;  4II4 B;  3SID A;  4LQV A;  2QQY A;  4REU A;  2ZG7 X;  3O7R A;  3R2O A;  3FSE A;  4ZLW A;  2ZUR X;  1LKP A;  1F30 A;  3PVR A;  5K52 A;  3KA6 A;  3QVD A;  5ERK A;  5LS9 A;  4RC6 B;  2YJJ A;  1JKV A;  2VXX A;  1SQ3 A;  4ZMC A;  4PG0 A;  1GWG A;  2V2L A;  3PWQ A;  1SOF A;  2VZB A;  3KX9 A;  1RCC A;  2CEI A;  1RYT A;  3E1Q A;  3Q4Q A;  3RE7 A;  3E6S A;  5GU2 X;  5FFE A;  1BFR A;  2XGW A;  2IY4 A;  4R42 A;  2RBD A;  1JGC A;  2BK6 A;  4TOC A;  4U3G A;  4KVQ A;  2OC5 A;  4KVR A;  4ERU A;  2FL0 A;  4MKU A;  3BVF A;  3PVT A;  5FEJ A;  4DZ0 A;  1ZS3 A;  4TOG A;  3RAV A;  2IU2 A;  2JD8 0;  1JRE A;  4ZTT A;  2ITB A;  2FKZ A;  2WLA A;  1AEW A;  4AM2 A;  2HTN A;  1J30 A;  3BKN A;  1RCD A;  3E1N A;  3NP0 X;  5CMQ A;  4CVT A;  4LYX A;  5J8S A;  2CLB A;  3SE1 A;  3QHC A;  3ES3 A;  1Z6O M;  3AF8 X;  4CVR A;  3Q4N A;  1VEL A;  5FFC A;  2V2J A;  2ZA6 A;  4M33 A;  3AJO A;  1L8I A;  4Z5S A;  3AJQ A;  4A25 A;  4LPN A;  3BT5 A;  2V2O A;  5GU1 X;  2C2J A;  4CY9 A;  2Z6M A;  4LQH A;  3IS8 A;  4ZJK A;  1Z6O A;  3WNW A;  2ZA8 A;  2UX1 A;  2C2U A;  4DYX A;  4M34 A;  3KA3 A;  5J93 A;  1YUX A;  2Z90 A;  2F7N A;  2ZG9 X;  4XKU A;  1S30 A;  3BVK A;  3EGM A;  5AXS A;  3F35 A;  1KRQ A;  1O9R A;  3PWQ C;  4ZKW A;  3PW8 A;  3NOZ X;  1MFR A;  3WVW A;  4DYU A;  1RCI A;  3KXU A;  3AF9 X;  4II4 A;  5D8Q A;  4PGK A;  5E1U A;  4EVD A;  4EVC A;  4CYB A;  3EZU A;  4LPM A;  5FFD A;  4RC6 A;  1S3Q A;  3A68 A;  3E1P A;  1NNQ A;  3QHB A;  1MOJ A;  4IWJ A;  4ISM A;  4ZL5 A;  4MJY A;  1XZ3 A;  2V2S A; 
#chains in the Genus database with same CATH topology
 4IXK A;  3HIU A;  4DYY A;  3QB9 A;  2VXI A;  5C6F A;  2XJM A;  3FVB A;  2V2M A;  5HJH A;  1LKO A;  5J9V A;  2XJN A;  3GVY A;  1B71 A;  2IB0 A;  4OYN A;  1HRS A;  3SHX A;  4WJG 4;  3GHQ A;  3F38 A;  3ISE A;  3R2R A;  3PW1 B;  4EVB A;  1LKM A;  3R2H A;  1YUZ A;  1LB3 A;  3PVY B;  2D5K A;  3PWF A;  4RC7 B;  4ZKH A;  1YV1 A;  3A9Q A;  4DAS A;  3OJ5 A;  4CYA A;  3R2S A;  2Z5Q A;  3Q4O A;  3IS7 A;  1R03 A;  2OH3 A;  3FRR A;  3TA8 A;  3V3K B;  3JZA B;  1F33 A;  1OTK A;  3C1Z A;  3RBC A;  2V8U A;  1NF6 A;  5GN8 B;  2C6R A;  4AM4 A;  2W0O A;  3E1L A;  2BJY A;  4Z3B A;  4TW3 A;  3U90 A;  3PW8 C;  1L8H A;  2X17 0;  4MXP A;  3NP2 X;  4ZKX A;  1VEI A;  1N1Q A;  4TOF A;  4W4L B;  1UMN A;  2C41 A;  1QYB A;  1TKP A;  3R2L A;  3KA8 A;  1JKU A;  4LYU A;  2WWX B;  3PZA A;  1TK6 A;  4DYZ A;  2WTL A;  2YJK A;  4M35 A;  3E1J A;  5HU6 D;  4MN9 A;  2CHP A;  4E6K A;  3F32 A;  3BVE A;  3ERZ A;  4CVS A;  3AF7 X;  3O7S A;  2CN6 A;  5HJF A;  3RGD A;  3E2C A;  3BVI A;  3F33 A;  4AM5 A;  1JYB A;  2CF7 A;  3UOI A;  4XKS A;  4LQJ A;  3AJP A;  5I4J A;  4KVS A;  1Z4A A;  2ZA7 A;  4MY7 A;  1JI5 A;  1O9I A;  4TOD A;  2V15 A;  3AK9 A;  4EVE A;  5D8Y A;  1DPS A;  3FI6 A;  4YKH A;  4QUW A;  1XZ1 A;  4CMY V;  3DBY A;  4RC8 A;  4PGI A;  2N02 A;  2CLU A;  4P18 A;  5D8O A;  3IQ1 A;  3UNO A;  2CN7 A;  4IWK A;  2CHI A;  3WVV A;  3PVR B;  3E6R A;  1IES A;  3VV9 A;  5FFA A;  2GS4 A;  3VNX A;  2FG8 A;  3MPS A;  2GYQ A;  3R2M A;  2AR0 A;  5E2D A;  2FJC A;  3L0M A;  1UVH A;  4XGS A;  5FFB A;  1BCF A;  3EZ0 A;  1DAT A;  3PW1 A;  1ZUJ A;  3AK8 A;  4TOA A;  2PYB A;  2FHA A;  5JKM A;  4ETR A;  2V2I A;  5LBH A;  3T9J A;  3H7G A;  3PVY A;  4RC7 A;  2JD6 0;  5GU0 X;  2ZG8 X;  4ML5 A;  2JD7 0;  3QZ3 A;  3W54 A;  2YW7 A;  3F34 A;  1H96 A;  5HQO A;  5GOU A;  2QF9 A;  2XJO A;  1BG7 A;  5D8S A;  4ITW A;  2XKQ A;  4TOB A;  4DE6 A;  5JKM G;  4M32 A;  1RCG A;  3PVT B;  3WVU A;  2V2P A;  3KWO A;  5LG8 A;  5GN8 A;  3KHK A;  3F39 A;  3KDQ A;  4MUD A;  1TKO A;  2BKC A;  3E1O A;  2C2F A;  2OKC A;  3RD0 A;  3JZ9 A;  5K53 A;  3OGH A;  1VJX A;  4Y08 A;  1EUM A;  3ISF A;  2V2R A;  5ERJ A;  4DI0 A;  2V2N A;  3C23 A;  2YW6 A;  5D8P A;  2WLU A;  1NFV A;  4ITT A;  1IER A;  4LPJ A;  4CMY A;  4XKT A;  5JAC A;  2HR5 A;  2MGY A;  2Y3Q A;  3UOF A;  1TJO A;  4RC5 B;  2FFX J;  2FG4 A;  3E1M A;  4TOE A;  4RC5 A;  3R2K A;  5LG2 A;  1FHA A;  5JKL A;  5D8R A;  1DVB A;  1VLG A;  1JI4 A;  1S2Z A;  4ZL6 A;  1JTS A;  2GYD A;  2BW1 A;  3Q4R A;  4PG1 A;  3F37 A;  3F36 A;  5CMR A;  2Z5P A;  3VVA A;  5GU3 X;  5CZU A;  5D8X A;  5IX6 A;  3HL1 A;  4CVP A;  3KA9 A;  5JKL G;  2CIH A;  4X0J A;  2G4H A;  1QGH A;  2Z5R A;  3SH6 A;  3GE4 A;  5JDO B;  4ISP A;  1VEQ A;  4TOH A;  2FZF A;  4LQN A;  2Y44 A;  1RCE A;  3QD8 A;  3KA4 A;  3BVL A;  4TO9 A;  1NF4 A;  1JIG A;  5J8W A;  4II4 B;  3SID A;  4LQV A;  2QQY A;  4REU A;  2ZG7 X;  3O7R A;  3R2O A;  3FSE A;  4ZLW A;  2ZUR X;  1LKP A;  1F30 A;  3PVR A;  5K52 A;  3KA6 A;  3QVD A;  5ERK A;  5LS9 A;  4RC6 B;  2YJJ A;  1JKV A;  2VXX A;  1SQ3 A;  4ZMC A;  4PG0 A;  1GWG A;  2V2L A;  3GGY A;  3PWQ A;  1SOF A;  2VZB A;  3KX9 A;  1RCC A;  2CEI A;  1RYT A;  3E1Q A;  3Q4Q A;  3RE7 A;  2G38 B;  3E6S A;  2CWL A;  5GU2 X;  5FFE A;  1BFR A;  2XGW A;  2IY4 A;  4R42 A;  3C1Y A;  2RBD A;  1JGC A;  2BK6 A;  4TOC A;  4U3G A;  4E40 A;  4KVQ A;  2OC5 A;  4KVR A;  4ERU A;  2FL0 A;  4MKU A;  3BVF A;  3PVT A;  5FEJ A;  4DZ0 A;  1ZS3 A;  4TOG A;  3RAV A;  2IU2 A;  2JD8 0;  1JRE A;  4ZTT A;  2ITB A;  2FKZ A;  2WLA A;  1AEW A;  4AM2 A;  2HTN A;  1J30 A;  2V8T A;  3BKN A;  1RCD A;  3E1N A;  3LKD A;  3NP0 X;  5CMQ A;  4CVT A;  4LYX A;  5J8S A;  2CLB A;  3SE1 A;  3QHC A;  3M6J A;  3ES3 A;  4W4K B;  1Z6O M;  3AF8 X;  4CVR A;  3Q4N A;  1VEL A;  3UFB A;  5FFC A;  2V2J A;  2ZA6 A;  4M33 A;  3AJO A;  1L8I A;  4Z5S A;  3FRS A;  3AJQ A;  4A25 A;  4LPN A;  3BT5 A;  2V2O A;  5GU1 X;  3N6O A;  2C2J A;  4CY9 A;  2Z6M A;  4LQH A;  3IS8 A;  4ZJK A;  1Z6O A;  3WNW A;  2ZA8 A;  2UX1 A;  2C2U A;  4DYX A;  3GGZ A;  4M34 A;  3KA3 A;  5J93 A;  1YUX A;  2Z90 A;  2F7N A;  2ZG9 X;  4XKU A;  1S30 A;  3BVK A;  4YVZ A;  3EGM A;  5AXS A;  5JDO A;  3C21 A;  3F35 A;  1KRQ A;  1O9R A;  3PWQ C;  4ZKW A;  3PW8 A;  3NOZ X;  1MFR A;  4YXJ A;  3WVW A;  4DYU A;  1RCI A;  4KXR B;  3KXU A;  3AF9 X;  4YXM A;  4II4 A;  5D8Q A;  4PGK A;  5E1U A;  4EVD A;  4EVC A;  4CYB A;  3EZU A;  4LPM A;  5FFD A;  4RC6 A;  1S3Q A;  3A68 A;  3E1P A;  1NNQ A;  3QHB A;  1MOJ A;  4IWJ A;  4ISM A;  4ZL5 A;  3D19 A;  4MJY A;  1XZ3 A;  2V2S A; 
#chains in the Genus database with same CATH homology
 4IXK A;  3HIU A;  4DYY A;  3QB9 A;  2VXI A;  5C6F A;  2XJM A;  3FVB A;  2V2M A;  5HJH A;  1LKO A;  5J9V A;  2XJN A;  3GVY A;  1B71 A;  2IB0 A;  4OYN A;  1HRS A;  3SHX A;  4WJG 4;  3GHQ A;  3F38 A;  3ISE A;  3R2R A;  3PW1 B;  4EVB A;  1LKM A;  3R2H A;  1YUZ A;  1LB3 A;  3PVY B;  2D5K A;  3PWF A;  4RC7 B;  4ZKH A;  1YV1 A;  3A9Q A;  4DAS A;  3OJ5 A;  4CYA A;  3R2S A;  2Z5Q A;  3Q4O A;  3IS7 A;  1R03 A;  2OH3 A;  3FRR A;  3TA8 A;  3V3K B;  3JZA B;  1F33 A;  1OTK A;  3C1Z A;  3RBC A;  2V8U A;  1NF6 A;  5GN8 B;  2C6R A;  4AM4 A;  2W0O A;  3E1L A;  2BJY A;  4Z3B A;  4TW3 A;  3U90 A;  3PW8 C;  1L8H A;  2X17 0;  4MXP A;  3NP2 X;  4ZKX A;  1VEI A;  1N1Q A;  4TOF A;  4W4L B;  1UMN A;  2C41 A;  1QYB A;  1TKP A;  3R2L A;  3KA8 A;  1JKU A;  4LYU A;  2WWX B;  3PZA A;  1TK6 A;  4DYZ A;  2WTL A;  2YJK A;  4M35 A;  3E1J A;  5HU6 D;  4MN9 A;  2CHP A;  4E6K A;  3F32 A;  3BVE A;  3ERZ A;  4CVS A;  3AF7 X;  3O7S A;  2CN6 A;  5HJF A;  3RGD A;  3E2C A;  3BVI A;  3F33 A;  4AM5 A;  1JYB A;  2CF7 A;  3UOI A;  4XKS A;  4LQJ A;  3AJP A;  5I4J A;  4KVS A;  1Z4A A;  2ZA7 A;  4MY7 A;  1JI5 A;  1O9I A;  4TOD A;  2V15 A;  3AK9 A;  4EVE A;  5D8Y A;  1DPS A;  3FI6 A;  4YKH A;  4QUW A;  1XZ1 A;  4CMY V;  3DBY A;  4RC8 A;  4PGI A;  2N02 A;  2CLU A;  4P18 A;  5D8O A;  3IQ1 A;  3UNO A;  2CN7 A;  4IWK A;  2CHI A;  3WVV A;  3PVR B;  3E6R A;  1IES A;  3VV9 A;  5FFA A;  2GS4 A;  3VNX A;  2FG8 A;  3MPS A;  2GYQ A;  3R2M A;  2AR0 A;  5E2D A;  2FJC A;  3L0M A;  1UVH A;  4XGS A;  5FFB A;  1BCF A;  3EZ0 A;  1DAT A;  3PW1 A;  1ZUJ A;  3AK8 A;  4TOA A;  2PYB A;  2FHA A;  5JKM A;  4ETR A;  2V2I A;  5LBH A;  3T9J A;  3H7G A;  3PVY A;  4RC7 A;  2JD6 0;  5GU0 X;  2ZG8 X;  4ML5 A;  2JD7 0;  3QZ3 A;  3W54 A;  2YW7 A;  3F34 A;  1H96 A;  5HQO A;  5GOU A;  2QF9 A;  2XJO A;  1BG7 A;  5D8S A;  4ITW A;  2XKQ A;  4TOB A;  4DE6 A;  5JKM G;  4M32 A;  1RCG A;  3PVT B;  3WVU A;  2V2P A;  3KWO A;  5LG8 A;  5GN8 A;  3KHK A;  3F39 A;  3KDQ A;  4MUD A;  1TKO A;  2BKC A;  3E1O A;  2C2F A;  2OKC A;  3RD0 A;  3JZ9 A;  5K53 A;  3OGH A;  1VJX A;  4Y08 A;  1EUM A;  3ISF A;  2V2R A;  5ERJ A;  4DI0 A;  2V2N A;  3C23 A;  2YW6 A;  5D8P A;  2WLU A;  1NFV A;  4ITT A;  1IER A;  4LPJ A;  4CMY A;  4XKT A;  5JAC A;  2HR5 A;  2MGY A;  2Y3Q A;  3UOF A;  1TJO A;  4RC5 B;  2FFX J;  2FG4 A;  3E1M A;  4TOE A;  4RC5 A;  3R2K A;  5LG2 A;  1FHA A;  5JKL A;  5D8R A;  1DVB A;  1VLG A;  1JI4 A;  1S2Z A;  4ZL6 A;  1JTS A;  2GYD A;  2BW1 A;  3Q4R A;  4PG1 A;  3F37 A;  3F36 A;  5CMR A;  2Z5P A;  3VVA A;  5GU3 X;  5CZU A;  5D8X A;  5IX6 A;  3HL1 A;  4CVP A;  3KA9 A;  5JKL G;  2CIH A;  4X0J A;  2G4H A;  1QGH A;  2Z5R A;  3SH6 A;  3GE4 A;  5JDO B;  4ISP A;  1VEQ A;  4TOH A;  2FZF A;  4LQN A;  2Y44 A;  1RCE A;  3QD8 A;  3KA4 A;  3BVL A;  4TO9 A;  1NF4 A;  1JIG A;  5J8W A;  4II4 B;  3SID A;  4LQV A;  2QQY A;  4REU A;  2ZG7 X;  3O7R A;  3R2O A;  3FSE A;  4ZLW A;  2ZUR X;  1LKP A;  1F30 A;  3PVR A;  5K52 A;  3KA6 A;  3QVD A;  5ERK A;  5LS9 A;  4RC6 B;  2YJJ A;  1JKV A;  2VXX A;  1SQ3 A;  4ZMC A;  4PG0 A;  1GWG A;  2V2L A;  3GGY A;  3PWQ A;  1SOF A;  2VZB A;  3KX9 A;  1RCC A;  2CEI A;  1RYT A;  3E1Q A;  3Q4Q A;  3RE7 A;  2G38 B;  3E6S A;  2CWL A;  5GU2 X;  5FFE A;  1BFR A;  2XGW A;  2IY4 A;  4R42 A;  3C1Y A;  2RBD A;  1JGC A;  2BK6 A;  4TOC A;  4U3G A;  4E40 A;  4KVQ A;  2OC5 A;  4KVR A;  4ERU A;  2FL0 A;  4MKU A;  3BVF A;  3PVT A;  5FEJ A;  4DZ0 A;  1ZS3 A;  4TOG A;  3RAV A;  2IU2 A;  2JD8 0;  1JRE A;  4ZTT A;  2ITB A;  2FKZ A;  2WLA A;  1AEW A;  4AM2 A;  2HTN A;  1J30 A;  2V8T A;  3BKN A;  1RCD A;  3E1N A;  3LKD A;  3NP0 X;  5CMQ A;  4CVT A;  4LYX A;  5J8S A;  2CLB A;  3SE1 A;  3QHC A;  3M6J A;  3ES3 A;  4W4K B;  1Z6O M;  3AF8 X;  4CVR A;  3Q4N A;  1VEL A;  3UFB A;  5FFC A;  2V2J A;  2ZA6 A;  4M33 A;  3AJO A;  1L8I A;  4Z5S A;  3FRS A;  3AJQ A;  4A25 A;  4LPN A;  3BT5 A;  2V2O A;  5GU1 X;  3N6O A;  2C2J A;  4CY9 A;  2Z6M A;  4LQH A;  3IS8 A;  4ZJK A;  1Z6O A;  3WNW A;  2ZA8 A;  2UX1 A;  2C2U A;  4DYX A;  3GGZ A;  4M34 A;  3KA3 A;  5J93 A;  1YUX A;  2Z90 A;  2F7N A;  2ZG9 X;  4XKU A;  1S30 A;  3BVK A;  4YVZ A;  3EGM A;  5AXS A;  5JDO A;  3C21 A;  3F35 A;  1KRQ A;  1O9R A;  3PWQ C;  4ZKW A;  3PW8 A;  3NOZ X;  1MFR A;  4YXJ A;  3WVW A;  4DYU A;  1RCI A;  4KXR B;  3KXU A;  3AF9 X;  4YXM A;  4II4 A;  5D8Q A;  4PGK A;  5E1U A;  4EVD A;  4EVC A;  4CYB A;  3EZU A;  4LPM A;  5FFD A;  4RC6 A;  1S3Q A;  3A68 A;  3E1P A;  1NNQ A;  3QHB A;  1MOJ A;  4IWJ A;  4ISM A;  4ZL5 A;  3D19 A;  4MJY A;  1XZ3 A;  2V2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...