2FKZA

Reduced (all ferrous) form of the azotobacter vinelandii bacterioferritin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
155
structure length
155
Chain Sequence
MKGDKIVIQHLNKILGNELIAINQYFLHARMYEDWGLEKLGKHEYHESIDEMKHADKLIKRILFLEGLPNLQELGKLLIGEHTKEMLECDLKLEQAGLPDLKAAIAYCESVGDYASRELLEDILESEEDHIDWLETQLDLIDKIGLENYLQSQMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Bacterioferritin
publication title Redox-Dependent Structural Changes in the Azotobacter vinelandii Bacterioferritin: New Insights into the Ferroxidase and Iron Transport Mechanism(,).
pubmed doi rcsb
total genus 70
structure length 155
sequence length 155
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2006-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2fkzA00
4DI0A 3WVVA 2CHIA 2FG4A 5C6FA 5GU3X 4RC7A 4CYBA 3F35A 3PVTA 3F33A 2V2PA 3UOFA 2XJOA 4TOBA 4TOHA 3UOIA 3GE4A 2GYDA 2V2OA 1XZ1A 5HJFA 4KVSA 5ERJA 1Z6OA 3SE1A 3NP2X 1F30A 3QHCA 4LQJA 2Z5RA 4M32A 1FHAA 3RE7A 1OTKA 4CVTA 5HQOA 4KVRA 4II4B 4LQVA 3SHXA 2CEIA 1QYBA 3KWOA 4LQHA 3SH6A 4PG0A 3EZ0A 1VEQA 5FFDA 2V2MA 2Z5PA 3R2SA 2YW6A 2WTLA 2C6RA 1VLGA 5J8WA 2ZA7A 1JI5A 3Q4QA 2WLAA 1JKVA 1RYTA 1Z6OM 2V2RA 2YJKA 3KA8A 4CVRA 1R03A 3KA3A 5K53A 2QQYA 1DPSA 2JD60 4ITWA 5JKLG 4R42A 5FFBA 2V2IA 3AJPA 1LKOA 3SIDA 3Q4OA 5FFAA 4ZKHA 2CLBA 3BVEA 3FSEA 3PW8C 1NFVA 3O7SA 1BCFA 2CLUA 2ZA6A 3H7GA 3OGHA 2XKQA 3QD8A 5ERKA 3AF9X 2CN7A 5CMRA 3RGDA 2GS4A 4EVDA 4RC5B 3PWQC 5I4JA 5CMQA 2CIHA 2BKCA 3PVYA 1S2ZA 5IX6A 4AM2A 1B71A 1RCIA 3F37A 2UX1A 3FI6A 2V15A 3AF7X 1VEIA 4AM5A 4TOEA 5GOUA 3R2MA 2FJCA 3E1LA 2G4HA 4EVCA 2ZA8A 4DE6A 1N1QA 1UVHA 4ZTTA 4RC8A 3KXUA 1RCDA 3BVIA 4CY9A 2Z5QA 4XKUA 1LKPA 4PG1A 4YKHA 1NF6A 2Y3QA 1L8HA 3MPSA 1BFRA 3KX9A 4CMYV 5JKLA 3BVFA 1H96A 3E1JA 4ISMA 3HL1A 5D8QA 1SOFA 4QUWA 4Z5SA 2QF9A 3VNXA 3NOZX 3A9QA 2IU2A 3WVUA 3HIUA 4DYUA 4U3GA 5K52A 3TA8A 4RC6A 3PVRA 3ERZA 3ES3A 4KVQA 5GU2X 3A68A 3KA4A 1NNQA 3WVWA 1LKMA 4ZL6A 2F7NA 3R2HA 4M33A 5D8YA 4LYXA 3FVBA 4Z3BA 3R2RA 1IESA 3F34A 5JKMG 5D8OA 4IWKA 2ZURX 3AF8X 3F38A 3ISEA 1YUXA 3RAVA 2PYBA 2V2LA 1RCEA 4ISPA 4Y08A 1Z4AA 4TO9A 5JACA 1YUZA 2WLUA 3T9JA 3R2OA 3Q4NA 2VXIA 4DASA 4ETRA 1YV1A 1JYBA 3E1PA 5D8XA 1SQ3A 2C2FA 4CVPA 3F39A 2V2NA 4ITTA 2IB0A 1DVBA 4CMYA 1TKPA 2OC5A 4EVBA 4DYZA 2BW1A 2JD80 2IY4A 2FL0A 4RC7B 3NP0X 2YW7A 4II4A 5D8SA 4LPJA 1MOJA 3PZAA 1KRQA 2FFXJ 1EUMA 2HR5A 3OJ5A 3E1MA 1JKUA 4LPMA 2YJJA 1IERA 3AK9A 2BK6A 3IS8A 2X170 4TOAA 4TODA 3RD0A 2CF7A 1ZS3A 5E2DA 4MKUA 5FFEA 3PWFA 3EZUA 4PGKA 5JKMA 2Z90A 3BT5A 3PW8A 4MJYA 2C2JA 1F33A 4MY7A 3AJQA 3BVLA 1JTSA 3KA9A 2ZG9X 3R2LA 4M35A 2VZBA 5HJHA 3AK8A 3R2KA 2ITBA 1TKOA 1S3QA 3PWQA 5LG8A 4EVEA 5GN8B 3E1NA 4ML5A 2V2SA 3PW1B 1JI4A 4MN9A 2GYQA 4RC5A 5D8PA 3BVKA 1VELA 2FKZA 1J30A 1NF4A 5D8RA 2Z6MA 3QZ3A 3GHQA 3O7RA 5GU1X 4CVSA 2FHAA 4LQNA 3E6RA 5FEJA 3U90A 4DZ0A 4TOFA 4OYNA 5E1UA 2OH3A 2JD70 2CHPA 4ERUA 1L8IA 2D5KA 1RCCA 2W0OA 1UMNA 3F32A 1XZ3A 4DYXA 1TJOA 5J8SA 4IXKA 2ZG8X 3E1OA 5LG2A 2C41A 4ZJKA 1TK6A 3QVDA 1DATA 3PVYB 4IWJA 3F36A 5GN8A 1JIGA 4PGIA 1MFRA 4TOCA 2XJNA 3BKNA 1ZUJA 5FFCA 1HRSA 2HTNA 3PW1A 5LBHA 3GVYA 4TOGA 3IQ1A 1QGHA 5AXSA 2FZFA 1VJXA 3KA6A 3E2CA 2RBDA 3E1QA 4E6KA 2XJMA 5CZUA 3PVTB 1BG7A 5LS9A 4LPNA 3IS7A 4LYUA 3AJOA 2VXXA 4XKSA 3ISFA 5J9VA 1GWGA 2V2JA 3EGMA 4TW3A 1S30A 4AM4A 5J93A 4CYAA 2FG8A 5GU0X 1RCGA 3E6SA 2BJYA 4P18A 4DYYA 1O9IA 4RC6B 1LB3A 3PVRB 4XGSA 4MUDA 1JREA 2CN6A 3WNWA 4ZLWA 3Q4RA 1AEWA 2XGWA 4REUA 2C2UA 3RBCA 1JGCA 4ZMCA 4ZL5A 3QB9A 2ZG7X 4A25A 1O9RA 3UNOA 4ZKWA 4M34A 4ZKXA 4XKTA 3QHBA
chains in the Genus database with same CATH superfamily
4DI0A 3LKDA 3WVVA 2CHIA 3D19A 2FG4A 5C6FA 5GU3X 4RC7A 4CYBA 3F35A 3PVTA 3F33A 2V2PA 3V3KB 3UOFA 3W54A 2XJOA 4TOBA 4TOHA 3UOIA 3GE4A 2GYDA 2MGYA 1XZ1A 2V2OA 5HJFA 4KVSA 5ERJA 1Z6OA 3SE1A 3NP2X 1F30A 3DBYA 3M6JA 3QHCA 4LQJA 2Y44A 2Z5RA 4M32A 1FHAA 3RE7A 1OTKA 4CVTA 5HQOA 4KVRA 4II4B 4LQVA 3SHXA 2CEIA 1QYBA 3KWOA 4LQHA 3SH6A 4PG0A 3EZ0A 1VEQA 5FFDA 2V2MA 2Z5PA 3R2SA 2YW6A 2WTLA 2C6RA 1VLGA 5J8WA 2ZA7A 1JI5A 3Q4QA 2WLAA 1JKVA 1RYTA 1Z6OM 2V2RA 2YJKA 3KA8A 4CVRA 1R03A 2V8UA 3KA3A 4X0JA 5K53A 2QQYA 1DPSA 2JD60 4ITWA 5JKLG 4R42A 5FFBA 2V2IA 3AJPA 1LKOA 3SIDA 3Q4OA 5FFAA 4ZKHA 2CLBA 3BVEA 3FSEA 3PW8C 1NFVA 3O7SA 1BCFA 2CLUA 2ZA6A 3H7GA 3OGHA 2XKQA 3QD8A 5ERKA 3AF9X 2CN7A 2N02A 5CMRA 3RGDA 2GS4A 4EVDA 5HU6D 4RC5B 3PWQC 5I4JA 5CMQA 2CIHA 2BKCA 3PVYA 1S2ZA 5IX6A 4AM2A 1B71A 1RCIA 2AR0A 3F37A 2UX1A 3C1ZA 3FI6A 2V15A 3AF7X 1VEIA 4AM5A 4YVZA 5GOUA 3R2MA 4TOEA 2FJCA 3E1LA 2G4HA 4EVCA 2ZA8A 4DE6A 1N1QA 1UVHA 4ZTTA 4RC8A 3KXUA 1RCDA 3BVIA 4CY9A 2Z5QA 4XKUA 1LKPA 4PG1A 4E40A 5JDOB 4YKHA 1NF6A 2Y3QA 3N6OA 1L8HA 3MPSA 1BFRA 3KX9A 4CMYV 3L0MA 5JKLA 3BVFA 1H96A 3E1JA 4ISMA 3HL1A 5D8QA 1SOFA 4QUWA 3FRRA 4Z5SA 2QF9A 3VNXA 3NOZX 3A9QA 2IU2A 3WVUA 3HIUA 4DYUA 4U3GA 5K52A 3TA8A 3JZAB 4RC6A 3PVRA 3ERZA 3ES3A 4KVQA 5GU2X 3A68A 3KA4A 1NNQA 3WVWA 1LKMA 4ZL6A 2F7NA 3R2HA 4M33A 5D8YA 4LYXA 3FVBA 4Z3BA 3R2RA 1IESA 3F34A 5JKMG 5D8OA 4IWKA 2ZURX 3AF8X 3F38A 3ISEA 1YUXA 3RAVA 2PYBA 2V2LA 2G38B 1RCEA 4ISPA 3JZ9A 4Y08A 3VV9A 1Z4AA 4W4KB 3KHKA 4TO9A 5JACA 1YUZA 2WLUA 3T9JA 3R2OA 3Q4NA 2VXIA 4DASA 4ETRA 1YV1A 1JYBA 3E1PA 5D8XA 1SQ3A 2C2FA 4CVPA 3F39A 2V2NA 4ITTA 2IB0A 1DVBA 4CMYA 1TKPA 2OC5A 4EVBA 4DYZA 2BW1A 2JD80 2IY4A 2FL0A 4RC7B 3NP0X 2YW7A 4II4A 5D8SA 4LPJA 1MOJA 3PZAA 1KRQA 2FFXJ 1EUMA 2HR5A 3OJ5A 3E1MA 1JKUA 4LPMA 2YJJA 1IERA 3AK9A 2BK6A 3IS8A 2X170 4TOAA 2OKCA 4TODA 3RD0A 2CF7A 1ZS3A 5E2DA 4MKUA 5FFEA 3PWFA 3EZUA 4PGKA 5JKMA 2Z90A 3BT5A 3PW8A 4MJYA 2C2JA 1F33A 4MY7A 3AJQA 3BVLA 1JTSA 3KA9A 2ZG9X 3R2LA 4M35A 2VZBA 5HJHA 3AK8A 3R2KA 2ITBA 1TKOA 1S3QA 3PWQA 5LG8A 4EVEA 5GN8B 3E1NA 4ML5A 3FRSA 2CWLA 2V2SA 3PW1B 1JI4A 4MN9A 2GYQA 4RC5A 5D8PA 3BVKA 1VELA 2FKZA 1J30A 1NF4A 5D8RA 2Z6MA 3QZ3A 3GHQA 3O7RA 5GU1X 4CVSA 2FHAA 4LQNA 4KXRB 3E6RA 5FEJA 3U90A 4DZ0A 4TOFA 4OYNA 5E1UA 2OH3A 2JD70 2CHPA 4ERUA 1L8IA 2D5KA 1RCCA 3UFBA 2W0OA 1UMNA 3F32A 5JDOA 1XZ3A 4DYXA 1TJOA 3GGYA 5J8SA 4IXKA 2ZG8X 3E1OA 5LG2A 2C41A 4ZJKA 1TK6A 3QVDA 4YXJA 1DATA 3PVYB 4IWJA 3F36A 5GN8A 1JIGA 3GGZA 4PGIA 1MFRA 3C23A 4TOCA 2XJNA 3BKNA 1ZUJA 5FFCA 1HRSA 2HTNA 3PW1A 5LBHA 3GVYA 4TOGA 3IQ1A 1QGHA 5AXSA 2FZFA 1VJXA 3KA6A 3C1YA 3E2CA 2RBDA 3E1QA 4E6KA 2XJMA 5CZUA 4WJG4 3PVTB 1BG7A 5LS9A 4LPNA 3IS7A 4LYUA 2WWXB 3AJOA 2VXXA 4XKSA 3ISFA 5J9VA 1GWGA 2V2JA 3EGMA 4TW3A 1S30A 3KDQA 4AM4A 5J93A 4CYAA 2FG8A 5GU0X 1RCGA 3E6SA 4W4LB 2BJYA 4P18A 4DYYA 4MXPA 2V8TA 1O9IA 3VVAA 4RC6B 1LB3A 3PVRB 4YXMA 4XGSA 4MUDA 1JREA 2CN6A 3WNWA 4ZLWA 3Q4RA 1AEWA 2XGWA 4REUA 2C2UA 3RBCA 1JGCA 4ZMCA 4ZL5A 3QB9A 3C21A 2ZG7X 4A25A 1O9RA 3UNOA 4ZKWA 4M34A 4ZKXA 4XKTA 3QHBA
chains in the Genus database with same CATH topology
4DI0A 3LKDA 3WVVA 2CHIA 3D19A 2FG4A 5C6FA 5GU3X 4RC7A 4CYBA 3F35A 3PVTA 3F33A 2V2PA 3V3KB 3UOFA 3W54A 2XJOA 4TOBA 4TOHA 3UOIA 3GE4A 2GYDA 2MGYA 1XZ1A 2V2OA 5HJFA 4KVSA 5ERJA 1Z6OA 3SE1A 3NP2X 1F30A 3DBYA 3M6JA 3QHCA 4LQJA 2Y44A 2Z5RA 4M32A 1FHAA 3RE7A 1OTKA 4CVTA 5HQOA 4KVRA 4II4B 4LQVA 3SHXA 2CEIA 1QYBA 3KWOA 4LQHA 3SH6A 4PG0A 3EZ0A 1VEQA 5FFDA 2V2MA 2Z5PA 3R2SA 2YW6A 2WTLA 2C6RA 1VLGA 5J8WA 2ZA7A 1JI5A 3Q4QA 2WLAA 1JKVA 1RYTA 1Z6OM 2V2RA 2YJKA 3KA8A 4CVRA 1R03A 2V8UA 3KA3A 4X0JA 5K53A 2QQYA 1DPSA 2JD60 4ITWA 5JKLG 4R42A 5FFBA 2V2IA 3AJPA 1LKOA 3SIDA 3Q4OA 5FFAA 4ZKHA 2CLBA 3BVEA 3FSEA 3PW8C 1NFVA 3O7SA 1BCFA 2CLUA 2ZA6A 3H7GA 3OGHA 2XKQA 3QD8A 5ERKA 3AF9X 2CN7A 2N02A 5CMRA 3RGDA 2GS4A 4EVDA 5HU6D 4RC5B 3PWQC 5I4JA 5CMQA 2CIHA 2BKCA 3PVYA 1S2ZA 5IX6A 4AM2A 1B71A 1RCIA 2AR0A 3F37A 2UX1A 3C1ZA 3FI6A 2V15A 3AF7X 1VEIA 4AM5A 4YVZA 5GOUA 3R2MA 4TOEA 2FJCA 3E1LA 2G4HA 4EVCA 2ZA8A 4DE6A 1N1QA 1UVHA 4ZTTA 4RC8A 3KXUA 1RCDA 3BVIA 4CY9A 2Z5QA 4XKUA 1LKPA 4PG1A 4E40A 5JDOB 4YKHA 1NF6A 2Y3QA 3N6OA 1L8HA 3MPSA 1BFRA 3KX9A 4CMYV 3L0MA 5JKLA 3BVFA 1H96A 3E1JA 4ISMA 3HL1A 5D8QA 1SOFA 4QUWA 3FRRA 4Z5SA 2QF9A 3VNXA 3NOZX 3A9QA 2IU2A 3WVUA 3HIUA 4DYUA 4U3GA 5K52A 3TA8A 3JZAB 4RC6A 3PVRA 3ERZA 3ES3A 4KVQA 5GU2X 3A68A 3KA4A 1NNQA 3WVWA 1LKMA 4ZL6A 2F7NA 3R2HA 4M33A 5D8YA 4LYXA 3FVBA 4Z3BA 3R2RA 1IESA 3F34A 5JKMG 5D8OA 4IWKA 2ZURX 3AF8X 3F38A 3ISEA 1YUXA 3RAVA 2PYBA 2V2LA 2G38B 1RCEA 4ISPA 3JZ9A 4Y08A 3VV9A 1Z4AA 4W4KB 3KHKA 4TO9A 5JACA 1YUZA 2WLUA 3T9JA 3R2OA 3Q4NA 2VXIA 4DASA 4ETRA 1YV1A 1JYBA 3E1PA 5D8XA 1SQ3A 2C2FA 4CVPA 3F39A 2V2NA 4ITTA 2IB0A 1DVBA 4CMYA 1TKPA 2OC5A 4EVBA 4DYZA 2BW1A 2JD80 2IY4A 2FL0A 4RC7B 3NP0X 2YW7A 4II4A 5D8SA 4LPJA 1MOJA 3PZAA 1KRQA 2FFXJ 1EUMA 2HR5A 3OJ5A 3E1MA 1JKUA 4LPMA 2YJJA 1IERA 3AK9A 2BK6A 3IS8A 2X170 4TOAA 2OKCA 4TODA 3RD0A 2CF7A 1ZS3A 5E2DA 4MKUA 5FFEA 3PWFA 3EZUA 4PGKA 5JKMA 2Z90A 3BT5A 3PW8A 4MJYA 2C2JA 1F33A 4MY7A 3AJQA 3BVLA 1JTSA 3KA9A 2ZG9X 3R2LA 4M35A 2VZBA 5HJHA 3AK8A 3R2KA 2ITBA 1TKOA 1S3QA 3PWQA 5LG8A 4EVEA 5GN8B 3E1NA 4ML5A 3FRSA 2CWLA 2V2SA 3PW1B 1JI4A 4MN9A 2GYQA 4RC5A 5D8PA 3BVKA 1VELA 2FKZA 1J30A 1NF4A 5D8RA 2Z6MA 3QZ3A 3GHQA 3O7RA 5GU1X 4CVSA 2FHAA 4LQNA 4KXRB 3E6RA 5FEJA 3U90A 4DZ0A 4TOFA 4OYNA 5E1UA 2OH3A 2JD70 2CHPA 4ERUA 1L8IA 2D5KA 1RCCA 3UFBA 2W0OA 1UMNA 3F32A 5JDOA 1XZ3A 4DYXA 1TJOA 3GGYA 5J8SA 4IXKA 2ZG8X 3E1OA 5LG2A 2C41A 4ZJKA 1TK6A 3QVDA 4YXJA 1DATA 3PVYB 4IWJA 3F36A 5GN8A 1JIGA 3GGZA 4PGIA 1MFRA 3C23A 4TOCA 2XJNA 3BKNA 1ZUJA 5FFCA 1HRSA 2HTNA 3PW1A 5LBHA 3GVYA 4TOGA 3IQ1A 1QGHA 5AXSA 2FZFA 1VJXA 3KA6A 3C1YA 3E2CA 2RBDA 3E1QA 4E6KA 2XJMA 5CZUA 4WJG4 3PVTB 1BG7A 5LS9A 4LPNA 3IS7A 4LYUA 2WWXB 3AJOA 2VXXA 4XKSA 3ISFA 5J9VA 1GWGA 2V2JA 3EGMA 4TW3A 1S30A 3KDQA 4AM4A 5J93A 4CYAA 2FG8A 5GU0X 1RCGA 3E6SA 4W4LB 2BJYA 4P18A 4DYYA 4MXPA 2V8TA 1O9IA 3VVAA 4RC6B 1LB3A 3PVRB 4YXMA 4XGSA 4MUDA 1JREA 2CN6A 3WNWA 4ZLWA 3Q4RA 1AEWA 2XGWA 4REUA 2C2UA 3RBCA 1JGCA 4ZMCA 4ZL5A 3QB9A 3C21A 2ZG7X 4A25A 1O9RA 3UNOA 4ZKWA 4M34A 4ZKXA 4XKTA 3QHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DI0 A;  3WVV A;  2CHI A;  2FG4 A;  5C6F A;  5GU3 X;  4RC7 A;  4CYB A;  3F35 A;  3PVT A;  3F33 A;  2V2P A;  3UOF A;  2XJO A;  4TOB A;  4TOH A;  3UOI A;  3GE4 A;  2GYD A;  2V2O A;  1XZ1 A;  5HJF A;  4KVS A;  5ERJ A;  1Z6O A;  3SE1 A;  3NP2 X;  1F30 A;  3QHC A;  4LQJ A;  2Z5R A;  4M32 A;  1FHA A;  3RE7 A;  1OTK A;  4CVT A;  5HQO A;  4KVR A;  4II4 B;  4LQV A;  3SHX A;  2CEI A;  1QYB A;  3KWO A;  4LQH A;  3SH6 A;  4PG0 A;  3EZ0 A;  1VEQ A;  5FFD A;  2V2M A;  2Z5P A;  3R2S A;  2YW6 A;  2WTL A;  2C6R A;  1VLG A;  5J8W A;  2ZA7 A;  1JI5 A;  3Q4Q A;  2WLA A;  1JKV A;  1RYT A;  1Z6O M;  2V2R A;  2YJK A;  3KA8 A;  4CVR A;  1R03 A;  3KA3 A;  5K53 A;  2QQY A;  1DPS A;  2JD6 0;  4ITW A;  5JKL G;  4R42 A;  5FFB A;  2V2I A;  3AJP A;  1LKO A;  3SID A;  3Q4O A;  5FFA A;  4ZKH A;  2CLB A;  3BVE A;  3FSE A;  3PW8 C;  1NFV A;  3O7S A;  1BCF A;  2CLU A;  2ZA6 A;  3H7G A;  3OGH A;  2XKQ A;  3QD8 A;  5ERK A;  3AF9 X;  2CN7 A;  5CMR A;  3RGD A;  2GS4 A;  4EVD A;  4RC5 B;  3PWQ C;  5I4J A;  5CMQ A;  2CIH A;  2BKC A;  3PVY A;  1S2Z A;  5IX6 A;  4AM2 A;  1B71 A;  1RCI A;  3F37 A;  2UX1 A;  3FI6 A;  2V15 A;  3AF7 X;  1VEI A;  4AM5 A;  4TOE A;  5GOU A;  3R2M A;  2FJC A;  3E1L A;  2G4H A;  4EVC A;  2ZA8 A;  4DE6 A;  1N1Q A;  1UVH A;  4ZTT A;  4RC8 A;  3KXU A;  1RCD A;  3BVI A;  4CY9 A;  2Z5Q A;  4XKU A;  1LKP A;  4PG1 A;  4YKH A;  1NF6 A;  2Y3Q A;  1L8H A;  3MPS A;  1BFR A;  3KX9 A;  4CMY V;  5JKL A;  3BVF A;  1H96 A;  3E1J A;  4ISM A;  3HL1 A;  5D8Q A;  1SOF A;  4QUW A;  4Z5S A;  2QF9 A;  3VNX A;  3NOZ X;  3A9Q A;  2IU2 A;  3WVU A;  3HIU A;  4DYU A;  4U3G A;  5K52 A;  3TA8 A;  4RC6 A;  3PVR A;  3ERZ A;  3ES3 A;  4KVQ A;  5GU2 X;  3A68 A;  3KA4 A;  1NNQ A;  3WVW A;  1LKM A;  4ZL6 A;  2F7N A;  3R2H A;  4M33 A;  5D8Y A;  4LYX A;  3FVB A;  4Z3B A;  3R2R A;  1IES A;  3F34 A;  5JKM G;  5D8O A;  4IWK A;  2ZUR X;  3AF8 X;  3F38 A;  3ISE A;  1YUX A;  3RAV A;  2PYB A;  2V2L A;  1RCE A;  4ISP A;  4Y08 A;  1Z4A A;  4TO9 A;  5JAC A;  1YUZ A;  2WLU A;  3T9J A;  3R2O A;  3Q4N A;  2VXI A;  4DAS A;  4ETR A;  1YV1 A;  1JYB A;  3E1P A;  5D8X A;  1SQ3 A;  2C2F A;  4CVP A;  3F39 A;  2V2N A;  4ITT A;  2IB0 A;  1DVB A;  4CMY A;  1TKP A;  2OC5 A;  4EVB A;  4DYZ A;  2BW1 A;  2JD8 0;  2IY4 A;  2FL0 A;  4RC7 B;  3NP0 X;  2YW7 A;  4II4 A;  5D8S A;  4LPJ A;  1MOJ A;  3PZA A;  1KRQ A;  2FFX J;  1EUM A;  2HR5 A;  3OJ5 A;  3E1M A;  1JKU A;  4LPM A;  2YJJ A;  1IER A;  3AK9 A;  2BK6 A;  3IS8 A;  2X17 0;  4TOA A;  4TOD A;  3RD0 A;  2CF7 A;  1ZS3 A;  5E2D A;  4MKU A;  5FFE A;  3PWF A;  3EZU A;  4PGK A;  5JKM A;  2Z90 A;  3BT5 A;  3PW8 A;  4MJY A;  2C2J A;  1F33 A;  4MY7 A;  3AJQ A;  3BVL A;  1JTS A;  3KA9 A;  2ZG9 X;  3R2L A;  4M35 A;  2VZB A;  5HJH A;  3AK8 A;  3R2K A;  2ITB A;  1TKO A;  1S3Q A;  3PWQ A;  5LG8 A;  4EVE A;  5GN8 B;  3E1N A;  4ML5 A;  2V2S A;  3PW1 B;  1JI4 A;  4MN9 A;  2GYQ A;  4RC5 A;  5D8P A;  3BVK A;  1VEL A;  2FKZ A;  1J30 A;  1NF4 A;  5D8R A;  2Z6M A;  3QZ3 A;  3GHQ A;  3O7R A;  5GU1 X;  4CVS A;  2FHA A;  4LQN A;  3E6R A;  5FEJ A;  3U90 A;  4DZ0 A;  4TOF A;  4OYN A;  5E1U A;  2OH3 A;  2JD7 0;  2CHP A;  4ERU A;  1L8I A;  2D5K A;  1RCC A;  2W0O A;  1UMN A;  3F32 A;  1XZ3 A;  4DYX A;  1TJO A;  5J8S A;  4IXK A;  2ZG8 X;  3E1O A;  5LG2 A;  2C41 A;  4ZJK A;  1TK6 A;  3QVD A;  1DAT A;  3PVY B;  4IWJ A;  3F36 A;  5GN8 A;  1JIG A;  4PGI A;  1MFR A;  4TOC A;  2XJN A;  3BKN A;  1ZUJ A;  5FFC A;  1HRS A;  2HTN A;  3PW1 A;  5LBH A;  3GVY A;  4TOG A;  3IQ1 A;  1QGH A;  5AXS A;  2FZF A;  1VJX A;  3KA6 A;  3E2C A;  2RBD A;  3E1Q A;  4E6K A;  2XJM A;  5CZU A;  3PVT B;  1BG7 A;  5LS9 A;  4LPN A;  3IS7 A;  4LYU A;  3AJO A;  2VXX A;  4XKS A;  3ISF A;  5J9V A;  1GWG A;  2V2J A;  3EGM A;  4TW3 A;  1S30 A;  4AM4 A;  5J93 A;  4CYA A;  2FG8 A;  5GU0 X;  1RCG A;  3E6S A;  2BJY A;  4P18 A;  4DYY A;  1O9I A;  4RC6 B;  1LB3 A;  3PVR B;  4XGS A;  4MUD A;  1JRE A;  2CN6 A;  3WNW A;  4ZLW A;  3Q4R A;  1AEW A;  2XGW A;  4REU A;  2C2U A;  3RBC A;  1JGC A;  4ZMC A;  4ZL5 A;  3QB9 A;  2ZG7 X;  4A25 A;  1O9R A;  3UNO A;  4ZKW A;  4M34 A;  4ZKX A;  4XKT A;  3QHB A; 
#chains in the Genus database with same CATH topology
 4DI0 A;  3LKD A;  3WVV A;  2CHI A;  3D19 A;  2FG4 A;  5C6F A;  5GU3 X;  4RC7 A;  4CYB A;  3F35 A;  3PVT A;  3F33 A;  2V2P A;  3V3K B;  3UOF A;  3W54 A;  2XJO A;  4TOB A;  4TOH A;  3UOI A;  3GE4 A;  2GYD A;  2MGY A;  1XZ1 A;  2V2O A;  5HJF A;  4KVS A;  5ERJ A;  1Z6O A;  3SE1 A;  3NP2 X;  1F30 A;  3DBY A;  3M6J A;  3QHC A;  4LQJ A;  2Y44 A;  2Z5R A;  4M32 A;  1FHA A;  3RE7 A;  1OTK A;  4CVT A;  5HQO A;  4KVR A;  4II4 B;  4LQV A;  3SHX A;  2CEI A;  1QYB A;  3KWO A;  4LQH A;  3SH6 A;  4PG0 A;  3EZ0 A;  1VEQ A;  5FFD A;  2V2M A;  2Z5P A;  3R2S A;  2YW6 A;  2WTL A;  2C6R A;  1VLG A;  5J8W A;  2ZA7 A;  1JI5 A;  3Q4Q A;  2WLA A;  1JKV A;  1RYT A;  1Z6O M;  2V2R A;  2YJK A;  3KA8 A;  4CVR A;  1R03 A;  2V8U A;  3KA3 A;  4X0J A;  5K53 A;  2QQY A;  1DPS A;  2JD6 0;  4ITW A;  5JKL G;  4R42 A;  5FFB A;  2V2I A;  3AJP A;  1LKO A;  3SID A;  3Q4O A;  5FFA A;  4ZKH A;  2CLB A;  3BVE A;  3FSE A;  3PW8 C;  1NFV A;  3O7S A;  1BCF A;  2CLU A;  2ZA6 A;  3H7G A;  3OGH A;  2XKQ A;  3QD8 A;  5ERK A;  3AF9 X;  2CN7 A;  2N02 A;  5CMR A;  3RGD A;  2GS4 A;  4EVD A;  5HU6 D;  4RC5 B;  3PWQ C;  5I4J A;  5CMQ A;  2CIH A;  2BKC A;  3PVY A;  1S2Z A;  5IX6 A;  4AM2 A;  1B71 A;  1RCI A;  2AR0 A;  3F37 A;  2UX1 A;  3C1Z A;  3FI6 A;  2V15 A;  3AF7 X;  1VEI A;  4AM5 A;  4YVZ A;  5GOU A;  3R2M A;  4TOE A;  2FJC A;  3E1L A;  2G4H A;  4EVC A;  2ZA8 A;  4DE6 A;  1N1Q A;  1UVH A;  4ZTT A;  4RC8 A;  3KXU A;  1RCD A;  3BVI A;  4CY9 A;  2Z5Q A;  4XKU A;  1LKP A;  4PG1 A;  4E40 A;  5JDO B;  4YKH A;  1NF6 A;  2Y3Q A;  3N6O A;  1L8H A;  3MPS A;  1BFR A;  3KX9 A;  4CMY V;  3L0M A;  5JKL A;  3BVF A;  1H96 A;  3E1J A;  4ISM A;  3HL1 A;  5D8Q A;  1SOF A;  4QUW A;  3FRR A;  4Z5S A;  2QF9 A;  3VNX A;  3NOZ X;  3A9Q A;  2IU2 A;  3WVU A;  3HIU A;  4DYU A;  4U3G A;  5K52 A;  3TA8 A;  3JZA B;  4RC6 A;  3PVR A;  3ERZ A;  3ES3 A;  4KVQ A;  5GU2 X;  3A68 A;  3KA4 A;  1NNQ A;  3WVW A;  1LKM A;  4ZL6 A;  2F7N A;  3R2H A;  4M33 A;  5D8Y A;  4LYX A;  3FVB A;  4Z3B A;  3R2R A;  1IES A;  3F34 A;  5JKM G;  5D8O A;  4IWK A;  2ZUR X;  3AF8 X;  3F38 A;  3ISE A;  1YUX A;  3RAV A;  2PYB A;  2V2L A;  2G38 B;  1RCE A;  4ISP A;  3JZ9 A;  4Y08 A;  3VV9 A;  1Z4A A;  4W4K B;  3KHK A;  4TO9 A;  5JAC A;  1YUZ A;  2WLU A;  3T9J A;  3R2O A;  3Q4N A;  2VXI A;  4DAS A;  4ETR A;  1YV1 A;  1JYB A;  3E1P A;  5D8X A;  1SQ3 A;  2C2F A;  4CVP A;  3F39 A;  2V2N A;  4ITT A;  2IB0 A;  1DVB A;  4CMY A;  1TKP A;  2OC5 A;  4EVB A;  4DYZ A;  2BW1 A;  2JD8 0;  2IY4 A;  2FL0 A;  4RC7 B;  3NP0 X;  2YW7 A;  4II4 A;  5D8S A;  4LPJ A;  1MOJ A;  3PZA A;  1KRQ A;  2FFX J;  1EUM A;  2HR5 A;  3OJ5 A;  3E1M A;  1JKU A;  4LPM A;  2YJJ A;  1IER A;  3AK9 A;  2BK6 A;  3IS8 A;  2X17 0;  4TOA A;  2OKC A;  4TOD A;  3RD0 A;  2CF7 A;  1ZS3 A;  5E2D A;  4MKU A;  5FFE A;  3PWF A;  3EZU A;  4PGK A;  5JKM A;  2Z90 A;  3BT5 A;  3PW8 A;  4MJY A;  2C2J A;  1F33 A;  4MY7 A;  3AJQ A;  3BVL A;  1JTS A;  3KA9 A;  2ZG9 X;  3R2L A;  4M35 A;  2VZB A;  5HJH A;  3AK8 A;  3R2K A;  2ITB A;  1TKO A;  1S3Q A;  3PWQ A;  5LG8 A;  4EVE A;  5GN8 B;  3E1N A;  4ML5 A;  3FRS A;  2CWL A;  2V2S A;  3PW1 B;  1JI4 A;  4MN9 A;  2GYQ A;  4RC5 A;  5D8P A;  3BVK A;  1VEL A;  2FKZ A;  1J30 A;  1NF4 A;  5D8R A;  2Z6M A;  3QZ3 A;  3GHQ A;  3O7R A;  5GU1 X;  4CVS A;  2FHA A;  4LQN A;  4KXR B;  3E6R A;  5FEJ A;  3U90 A;  4DZ0 A;  4TOF A;  4OYN A;  5E1U A;  2OH3 A;  2JD7 0;  2CHP A;  4ERU A;  1L8I A;  2D5K A;  1RCC A;  3UFB A;  2W0O A;  1UMN A;  3F32 A;  5JDO A;  1XZ3 A;  4DYX A;  1TJO A;  3GGY A;  5J8S A;  4IXK A;  2ZG8 X;  3E1O A;  5LG2 A;  2C41 A;  4ZJK A;  1TK6 A;  3QVD A;  4YXJ A;  1DAT A;  3PVY B;  4IWJ A;  3F36 A;  5GN8 A;  1JIG A;  3GGZ A;  4PGI A;  1MFR A;  3C23 A;  4TOC A;  2XJN A;  3BKN A;  1ZUJ A;  5FFC A;  1HRS A;  2HTN A;  3PW1 A;  5LBH A;  3GVY A;  4TOG A;  3IQ1 A;  1QGH A;  5AXS A;  2FZF A;  1VJX A;  3KA6 A;  3C1Y A;  3E2C A;  2RBD A;  3E1Q A;  4E6K A;  2XJM A;  5CZU A;  4WJG 4;  3PVT B;  1BG7 A;  5LS9 A;  4LPN A;  3IS7 A;  4LYU A;  2WWX B;  3AJO A;  2VXX A;  4XKS A;  3ISF A;  5J9V A;  1GWG A;  2V2J A;  3EGM A;  4TW3 A;  1S30 A;  3KDQ A;  4AM4 A;  5J93 A;  4CYA A;  2FG8 A;  5GU0 X;  1RCG A;  3E6S A;  4W4L B;  2BJY A;  4P18 A;  4DYY A;  4MXP A;  2V8T A;  1O9I A;  3VVA A;  4RC6 B;  1LB3 A;  3PVR B;  4YXM A;  4XGS A;  4MUD A;  1JRE A;  2CN6 A;  3WNW A;  4ZLW A;  3Q4R A;  1AEW A;  2XGW A;  4REU A;  2C2U A;  3RBC A;  1JGC A;  4ZMC A;  4ZL5 A;  3QB9 A;  3C21 A;  2ZG7 X;  4A25 A;  1O9R A;  3UNO A;  4ZKW A;  4M34 A;  4ZKX A;  4XKT A;  3QHB A; 
#chains in the Genus database with same CATH homology
 4DI0 A;  3LKD A;  3WVV A;  2CHI A;  3D19 A;  2FG4 A;  5C6F A;  5GU3 X;  4RC7 A;  4CYB A;  3F35 A;  3PVT A;  3F33 A;  2V2P A;  3V3K B;  3UOF A;  3W54 A;  2XJO A;  4TOB A;  4TOH A;  3UOI A;  3GE4 A;  2GYD A;  2MGY A;  1XZ1 A;  2V2O A;  5HJF A;  4KVS A;  5ERJ A;  1Z6O A;  3SE1 A;  3NP2 X;  1F30 A;  3DBY A;  3M6J A;  3QHC A;  4LQJ A;  2Y44 A;  2Z5R A;  4M32 A;  1FHA A;  3RE7 A;  1OTK A;  4CVT A;  5HQO A;  4KVR A;  4II4 B;  4LQV A;  3SHX A;  2CEI A;  1QYB A;  3KWO A;  4LQH A;  3SH6 A;  4PG0 A;  3EZ0 A;  1VEQ A;  5FFD A;  2V2M A;  2Z5P A;  3R2S A;  2YW6 A;  2WTL A;  2C6R A;  1VLG A;  5J8W A;  2ZA7 A;  1JI5 A;  3Q4Q A;  2WLA A;  1JKV A;  1RYT A;  1Z6O M;  2V2R A;  2YJK A;  3KA8 A;  4CVR A;  1R03 A;  2V8U A;  3KA3 A;  4X0J A;  5K53 A;  2QQY A;  1DPS A;  2JD6 0;  4ITW A;  5JKL G;  4R42 A;  5FFB A;  2V2I A;  3AJP A;  1LKO A;  3SID A;  3Q4O A;  5FFA A;  4ZKH A;  2CLB A;  3BVE A;  3FSE A;  3PW8 C;  1NFV A;  3O7S A;  1BCF A;  2CLU A;  2ZA6 A;  3H7G A;  3OGH A;  2XKQ A;  3QD8 A;  5ERK A;  3AF9 X;  2CN7 A;  2N02 A;  5CMR A;  3RGD A;  2GS4 A;  4EVD A;  5HU6 D;  4RC5 B;  3PWQ C;  5I4J A;  5CMQ A;  2CIH A;  2BKC A;  3PVY A;  1S2Z A;  5IX6 A;  4AM2 A;  1B71 A;  1RCI A;  2AR0 A;  3F37 A;  2UX1 A;  3C1Z A;  3FI6 A;  2V15 A;  3AF7 X;  1VEI A;  4AM5 A;  4YVZ A;  5GOU A;  3R2M A;  4TOE A;  2FJC A;  3E1L A;  2G4H A;  4EVC A;  2ZA8 A;  4DE6 A;  1N1Q A;  1UVH A;  4ZTT A;  4RC8 A;  3KXU A;  1RCD A;  3BVI A;  4CY9 A;  2Z5Q A;  4XKU A;  1LKP A;  4PG1 A;  4E40 A;  5JDO B;  4YKH A;  1NF6 A;  2Y3Q A;  3N6O A;  1L8H A;  3MPS A;  1BFR A;  3KX9 A;  4CMY V;  3L0M A;  5JKL A;  3BVF A;  1H96 A;  3E1J A;  4ISM A;  3HL1 A;  5D8Q A;  1SOF A;  4QUW A;  3FRR A;  4Z5S A;  2QF9 A;  3VNX A;  3NOZ X;  3A9Q A;  2IU2 A;  3WVU A;  3HIU A;  4DYU A;  4U3G A;  5K52 A;  3TA8 A;  3JZA B;  4RC6 A;  3PVR A;  3ERZ A;  3ES3 A;  4KVQ A;  5GU2 X;  3A68 A;  3KA4 A;  1NNQ A;  3WVW A;  1LKM A;  4ZL6 A;  2F7N A;  3R2H A;  4M33 A;  5D8Y A;  4LYX A;  3FVB A;  4Z3B A;  3R2R A;  1IES A;  3F34 A;  5JKM G;  5D8O A;  4IWK A;  2ZUR X;  3AF8 X;  3F38 A;  3ISE A;  1YUX A;  3RAV A;  2PYB A;  2V2L A;  2G38 B;  1RCE A;  4ISP A;  3JZ9 A;  4Y08 A;  3VV9 A;  1Z4A A;  4W4K B;  3KHK A;  4TO9 A;  5JAC A;  1YUZ A;  2WLU A;  3T9J A;  3R2O A;  3Q4N A;  2VXI A;  4DAS A;  4ETR A;  1YV1 A;  1JYB A;  3E1P A;  5D8X A;  1SQ3 A;  2C2F A;  4CVP A;  3F39 A;  2V2N A;  4ITT A;  2IB0 A;  1DVB A;  4CMY A;  1TKP A;  2OC5 A;  4EVB A;  4DYZ A;  2BW1 A;  2JD8 0;  2IY4 A;  2FL0 A;  4RC7 B;  3NP0 X;  2YW7 A;  4II4 A;  5D8S A;  4LPJ A;  1MOJ A;  3PZA A;  1KRQ A;  2FFX J;  1EUM A;  2HR5 A;  3OJ5 A;  3E1M A;  1JKU A;  4LPM A;  2YJJ A;  1IER A;  3AK9 A;  2BK6 A;  3IS8 A;  2X17 0;  4TOA A;  2OKC A;  4TOD A;  3RD0 A;  2CF7 A;  1ZS3 A;  5E2D A;  4MKU A;  5FFE A;  3PWF A;  3EZU A;  4PGK A;  5JKM A;  2Z90 A;  3BT5 A;  3PW8 A;  4MJY A;  2C2J A;  1F33 A;  4MY7 A;  3AJQ A;  3BVL A;  1JTS A;  3KA9 A;  2ZG9 X;  3R2L A;  4M35 A;  2VZB A;  5HJH A;  3AK8 A;  3R2K A;  2ITB A;  1TKO A;  1S3Q A;  3PWQ A;  5LG8 A;  4EVE A;  5GN8 B;  3E1N A;  4ML5 A;  3FRS A;  2CWL A;  2V2S A;  3PW1 B;  1JI4 A;  4MN9 A;  2GYQ A;  4RC5 A;  5D8P A;  3BVK A;  1VEL A;  2FKZ A;  1J30 A;  1NF4 A;  5D8R A;  2Z6M A;  3QZ3 A;  3GHQ A;  3O7R A;  5GU1 X;  4CVS A;  2FHA A;  4LQN A;  4KXR B;  3E6R A;  5FEJ A;  3U90 A;  4DZ0 A;  4TOF A;  4OYN A;  5E1U A;  2OH3 A;  2JD7 0;  2CHP A;  4ERU A;  1L8I A;  2D5K A;  1RCC A;  3UFB A;  2W0O A;  1UMN A;  3F32 A;  5JDO A;  1XZ3 A;  4DYX A;  1TJO A;  3GGY A;  5J8S A;  4IXK A;  2ZG8 X;  3E1O A;  5LG2 A;  2C41 A;  4ZJK A;  1TK6 A;  3QVD A;  4YXJ A;  1DAT A;  3PVY B;  4IWJ A;  3F36 A;  5GN8 A;  1JIG A;  3GGZ A;  4PGI A;  1MFR A;  3C23 A;  4TOC A;  2XJN A;  3BKN A;  1ZUJ A;  5FFC A;  1HRS A;  2HTN A;  3PW1 A;  5LBH A;  3GVY A;  4TOG A;  3IQ1 A;  1QGH A;  5AXS A;  2FZF A;  1VJX A;  3KA6 A;  3C1Y A;  3E2C A;  2RBD A;  3E1Q A;  4E6K A;  2XJM A;  5CZU A;  4WJG 4;  3PVT B;  1BG7 A;  5LS9 A;  4LPN A;  3IS7 A;  4LYU A;  2WWX B;  3AJO A;  2VXX A;  4XKS A;  3ISF A;  5J9V A;  1GWG A;  2V2J A;  3EGM A;  4TW3 A;  1S30 A;  3KDQ A;  4AM4 A;  5J93 A;  4CYA A;  2FG8 A;  5GU0 X;  1RCG A;  3E6S A;  4W4L B;  2BJY A;  4P18 A;  4DYY A;  4MXP A;  2V8T A;  1O9I A;  3VVA A;  4RC6 B;  1LB3 A;  3PVR B;  4YXM A;  4XGS A;  4MUD A;  1JRE A;  2CN6 A;  3WNW A;  4ZLW A;  3Q4R A;  1AEW A;  2XGW A;  4REU A;  2C2U A;  3RBC A;  1JGC A;  4ZMC A;  4ZL5 A;  3QB9 A;  3C21 A;  2ZG7 X;  4A25 A;  1O9R A;  3UNO A;  4ZKW A;  4M34 A;  4ZKX A;  4XKT A;  3QHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...