3PWQA

The phenylacetyl-coa monooxygenase paaac subcomplex
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
248
structure length
248
Chain Sequence
SNQLTAYTLRLGDNCLVLSQRLGEWCGHAPELEIDLALANIGLDLLGQARNFLSYAAELAGEGDEDTLAFTRDERQFSNLLLVEQPNGNFADTIARQYFIDAWHVALFTRLMESRDPQLAAISAKAIKEARYHLRFSRGWLERLGNGTDVSGQKMQQAINKLWRFTAELFDADEIDIALSEEGIAVDPRTLRAAWEAEVFAGINEATLNVPQEQAYRTGGKKGLHTEHLGPMLAEMQYLQRVLPGQQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylacetic acid degradation protein paaC
publication title Structural and Functional Studies of the Escherichia coli Phenylacetyl-CoA Monooxygenase Complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 103
structure length 248
sequence length 248
chains with identical sequence B, E, G, I, J, K, R
ec nomenclature
pdb deposition date 2010-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3pwqA00
4LQJA 4RC6B 4YKHA 3BVEA 4MY7A 3PW1B 1S30A 3F35A 2Z5QA 5GU1X 1IERA 3Q4OA 1IESA 4DZ0A 3PVTA 3ERZA 1BFRA 3F37A 2WTLA 3E1PA 4CMYA 3F38A 3E6RA 4CYBA 4LYXA 2V2MA 5LS9A 3PVYB 1DATA 1JI4A 2HR5A 5D8SA 1AEWA 1VEIA 4LQNA 2FZFA 3Q4RA 3AJOA 1QYBA 4TOAA 3F36A 5HQOA 3R2RA 2BW1A 1NF4A 3KX9A 1NNQA 4PG0A 3O7SA 4DE6A 3IS8A 3HIUA 1S3QA 2BK6A 1YV1A 4EVDA 3WVWA 3QHCA 5LG2A 2CEIA 4RC5A 3PW8A 4RC8A 1O9RA 2V2LA 4LQHA 3WVVA 4ZJKA 1TJOA 4R42A 3FVBA 2XJOA 2CN6A 3BVKA 4M34A 3E6SA 3F39A 5IX6A 5FFEA 4TODA 3UNOA 1VEQA 3PWQC 2V2PA 3NP0X 4RC6A 1UVHA 5FFAA 3RE7A 1FHAA 1SQ3A 5FFBA 1RCIA 1BCFA 1VJXA 3IQ1A 5I4JA 4CVPA 3QHBA 3A68A 5GOUA 3PVTB 4CY9A 2XKQA 3H7GA 1RCEA 4PG1A 5J9VA 2VXIA 2YW6A 2CLBA 1SOFA 4DI0A 4ISMA 4AM2A 4IWKA 3AJPA 1JKVA 4XKUA 1YUXA 2XJNA 4RC7A 2ZURX 2CHPA 1JI5A 3BT5A 4M32A 4KVSA 2W0OA 1RCCA 2X170 3NOZX 2ZA6A 2GS4A 2IB0A 2JD60 2ZA7A 2C6RA 3EZUA 4OYNA 4RC5B 1ZUJA 3E1MA 4CVSA 4TOHA 4ZKXA 2C41A 2IU2A 1Z6OM 2GYDA 5J93A 3PVRB 2IY4A 4ZL5A 2ZG8X 5CMQA 4ERUA 1DPSA 4AM5A 2JD70 2FFXJ 4QUWA 1OTKA 1J30A 4P18A 5JKMG 3GVYA 4DYYA 1N1QA 1HRSA 2FJCA 5CZUA 1TKPA 4Z5SA 5E2DA 4II4A 3SH6A 2WLAA 5E1UA 3R2HA 2QF9A 5J8SA 2V2SA 4TO9A 2ZG9X 4ETRA 2VXXA 4TOBA 4LPJA 1RYTA 3RAVA 3RD0A 4RC7B 5JKMA 2V15A 3SIDA 4ITTA 4CYAA 5D8RA 5CMRA 1XZ1A 1S2ZA 1Z6OA 3KA6A 5LG8A 2FKZA 3PVRA 2Z5RA 4MUDA 5D8YA 2C2FA 3AF8X 3UOIA 3FI6A 2BKCA 1TK6A 3PWQA 3F32A 2YJKA 2OC5A 5HJHA 3GHQA 1L8HA 2VZBA 1QGHA 1NF6A 1O9IA 1JYBA 1YUZA 4DASA 2C2UA 5D8PA 4EVBA 1B71A 1JKUA 3EGMA 3RBCA 5D8XA 1UMNA 4II4B 3SE1A 2CF7A 3QB9A 4IWJA 1TKOA 2Y3QA 3BVFA 1LB3A 3ISFA 4TW3A 3U90A 4DYUA 5C6FA 1RCGA 5K53A 3UOFA 3E1QA 2V2IA 1DVBA 2F7NA 5JKLA 4TOEA 4LYUA 1MOJA 2Z6MA 2V2RA 4KVRA 4TOCA 3IS7A 4TOFA 4ISPA 2GYQA 3BVLA 3QD8A 4M35A 3Q4QA 1MFRA 1LKMA 5K52A 3NP2X 3AJQA 2Z90A 3O7RA 5LBHA 1NFVA 2D5KA 1LKOA 2XJMA 4PGKA 2ITBA 2FL0A 4REUA 5FFCA 3BKNA 2YJJA 3R2LA 4ITWA 3ES3A 1KRQA 4M33A 2PYBA 3F33A 2G4HA 4DYXA 4CVRA 2CIHA 3OJ5A 2HTNA 3AF7X 3OGHA 3E1OA 2FG4A 3Q4NA 4MJYA 3E1LA 3MPSA 5ERJA 3KXUA 2ZG7X 4LPNA 3AK9A 3E1JA 2JD80 2V2NA 2RBDA 5FEJA 4LQVA 1VELA 3KA9A 5GU2X 4E6KA 3TA8A 1GWGA 3E2CA 2BJYA 4LPMA 4ZTTA 3PW8C 3WNWA 1JTSA 2XGWA 4Z3BA 1Z4AA 3E1NA 4ZL6A 5D8OA 2V2OA 3F34A 1L8IA 2Z5PA 5AXSA 5GN8A 3R2KA 2WLUA 2QQYA 2FHAA 5JACA 1EUMA 4EVCA 2ZA8A 3FSEA 1JGCA 1RCDA 3WVUA 3RGDA 4IXKA 2C2JA 3PW1A 5HJFA 4ZLWA 4ZKWA 5JKLG 3KA8A 5FFDA 3VNXA 1XZ3A 4CVTA 3ISEA 4TOGA 5GU0X 5D8QA 3R2MA 1BG7A 1F30A 2CN7A 2YW7A 3T9JA 1H96A 3PVYA 2OH3A 4A25A 5ERKA 4U3GA 4AM4A 1R03A 3QVDA 1ZS3A 4PGIA 3R2SA 2UX1A 3KA3A 2FG8A 1LKPA 3EZ0A 3QZ3A 5J8WA 3SHXA 1JREA 3A9QA 4MKUA 4Y08A 3AK8A 4XKTA 4ZMCA 2V2JA 3HL1A 3R2OA 1F33A 4EVEA 1JIGA 5GN8B 4XKSA 2CLUA 4CMYV 3PWFA 5GU3X 3KWOA 3AF9X 4XGSA 4ML5A 4ZKHA 1VLGA 4KVQA 3KA4A 3PZAA 4DYZA 3BVIA 3GE4A 2CHIA 4MN9A
chains in the Genus database with same CATH superfamily
4LQJA 4RC6B 4YKHA 3BVEA 4MY7A 3PW1B 2WWXB 1S30A 3F35A 2Z5QA 5GU1X 1IERA 3C1ZA 3Q4OA 1IESA 4DZ0A 3PVTA 3ERZA 1BFRA 3F37A 2WTLA 3E1PA 4CMYA 3F38A 3E6RA 4CYBA 4LYXA 2V2MA 5LS9A 3PVYB 3VV9A 1DATA 1JI4A 2HR5A 5D8SA 3GGZA 1AEWA 1VEIA 4LQNA 2FZFA 3Q4RA 3AJOA 1QYBA 4W4LB 4TOAA 3F36A 5HQOA 3R2RA 4MN9A 2BW1A 1NF4A 3KX9A 3GGYA 3W54A 1NNQA 4PG0A 3O7SA 4DE6A 3IS8A 3HIUA 1S3QA 2BK6A 1YV1A 4EVDA 3WVWA 3QHCA 5LG2A 2CEIA 4RC5A 3PW8A 4RC8A 1O9RA 2V2LA 4LQHA 3WVVA 4ZJKA 1TJOA 4R42A 3KHKA 3FVBA 2XJOA 2CN6A 3BVKA 4M34A 3E6SA 3F39A 5IX6A 5FFEA 4TODA 3UNOA 1VEQA 3PWQC 2V2PA 3NP0X 4RC6A 1UVHA 5FFAA 3RE7A 1FHAA 1SQ3A 5FFBA 1RCIA 1BCFA 1VJXA 3IQ1A 5I4JA 4CVPA 3QHBA 3A68A 5GOUA 3PVTB 4CY9A 2XKQA 3H7GA 1RCEA 4PG1A 5J9VA 2VXIA 2YW6A 2CLBA 1SOFA 4DI0A 4ISMA 4AM2A 4IWKA 3AJPA 1JKVA 4XKUA 1YUXA 2XJNA 4RC7A 2ZURX 2CHPA 1JI5A 3BT5A 4M32A 4KVSA 2W0OA 1RCCA 2X170 3NOZX 2ZA6A 2GS4A 2IB0A 3UFBA 2JD60 2ZA7A 2C6RA 4E40A 3EZUA 4OYNA 4RC5B 4YVZA 1ZUJA 3E1MA 4CVSA 4TOHA 4ZKXA 2C41A 2IU2A 1Z6OM 4YXMA 2GYDA 4W4KB 5J93A 3PVRB 2IY4A 4ZL5A 4YXJA 2ZG8X 5CMQA 4ERUA 1DPSA 4AM5A 2JD70 2FFXJ 4QUWA 1OTKA 1J30A 4P18A 5JKMG 3GVYA 4DYYA 1N1QA 1HRSA 2FJCA 5CZUA 1TKPA 4Z5SA 5E2DA 3KDQA 4II4A 2WLAA 3SH6A 5E1UA 4MXPA 3R2HA 2QF9A 5J8SA 2V2SA 4TO9A 2ZG9X 4ETRA 2VXXA 4TOBA 4LPJA 1RYTA 3RAVA 3RD0A 4RC7B 5JKMA 2V15A 3SIDA 4ITTA 2V8UA 4CYAA 5D8RA 5CMRA 2V8TA 1XZ1A 1S2ZA 1Z6OA 3KA6A 5LG8A 2FKZA 5HU6D 3PVRA 2Z5RA 4MUDA 4KXRB 5D8YA 2C2FA 3AF8X 3UOIA 3FI6A 2BKCA 1TK6A 3PWQA 3F32A 2YJKA 2OC5A 5HJHA 3GHQA 1L8HA 2VZBA 1QGHA 1NF6A 1O9IA 1JYBA 1YUZA 4DASA 2C2UA 5D8PA 4EVBA 3JZ9A 1B71A 1JKUA 3EGMA 3RBCA 5D8XA 1UMNA 2AR0A 4WJG4 4II4B 3SE1A 2CF7A 3QB9A 4IWJA 1TKOA 2Y3QA 3BVFA 1LB3A 3ISFA 4TW3A 3FRSA 3U90A 4DYUA 5C6FA 3JZAB 1RCGA 5K53A 3UOFA 2OKCA 3E1QA 2V2IA 3VVAA 1DVBA 2F7NA 5JKLA 4TOEA 4LYUA 1MOJA 2Z6MA 2V2RA 4KVRA 4TOCA 3IS7A 4TOFA 4ISPA 3C23A 2GYQA 3BVLA 3QD8A 2CWLA 4M35A 3Q4QA 3LKDA 1MFRA 1LKMA 5K52A 3NP2X 3AJQA 2Z90A 3O7RA 5LBHA 1NFVA 2D5KA 1LKOA 2XJMA 4PGKA 2ITBA 2FL0A 4REUA 5FFCA 3BKNA 2YJJA 3R2LA 4ITWA 3ES3A 1KRQA 4M33A 2PYBA 3F33A 2G4HA 4DYXA 4CVRA 2CIHA 3OJ5A 2HTNA 3AF7X 3OGHA 2MGYA 3E1OA 2FG4A 3Q4NA 4MJYA 3E1LA 3MPSA 5ERJA 3KXUA 2ZG7X 3FRRA 4LPNA 3AK9A 3E1JA 2JD80 2V2NA 2RBDA 5FEJA 4LQVA 1VELA 3KA9A 5GU2X 4E6KA 3TA8A 1GWGA 3E2CA 2BJYA 4LPMA 4ZTTA 5JDOA 3PW8C 3WNWA 1JTSA 2XGWA 4Z3BA 2Y44A 3C1YA 1Z4AA 3E1NA 4ZL6A 5D8OA 2V2OA 3F34A 1L8IA 2Z5PA 5AXSA 5GN8A 3R2KA 2WLUA 2QQYA 2FHAA 5JACA 1EUMA 4EVCA 4X0JA 2ZA8A 3FSEA 1JGCA 1RCDA 3WVUA 3RGDA 4IXKA 2C2JA 3PW1A 5HJFA 4ZLWA 4ZKWA 5JKLG 3KA8A 5FFDA 2G38B 3VNXA 1XZ3A 4CVTA 3ISEA 4TOGA 5GU0X 5D8QA 3R2MA 3V3KB 3L0MA 1BG7A 1F30A 2CN7A 3D19A 2YW7A 3T9JA 1H96A 3PVYA 2OH3A 4A25A 5ERKA 3DBYA 4U3GA 4AM4A 1R03A 3QVDA 3M6JA 1ZS3A 4PGIA 3R2SA 2UX1A 3KA3A 2FG8A 1LKPA 3EZ0A 3QZ3A 5J8WA 3SHXA 1JREA 2N02A 3A9QA 5JDOB 4MKUA 4Y08A 3AK8A 4XKTA 4ZMCA 2V2JA 3HL1A 3R2OA 1F33A 4EVEA 1JIGA 5GN8B 4XKSA 2CLUA 4CMYV 3PWFA 5GU3X 3KWOA 3AF9X 4XGSA 4ML5A 4ZKHA 1VLGA 4KVQA 3KA4A 3PZAA 3C21A 4DYZA 3BVIA 3GE4A 2CHIA 3N6OA
chains in the Genus database with same CATH topology
4LQJA 4RC6B 4YKHA 3BVEA 4MY7A 3PW1B 2WWXB 1S30A 3F35A 2Z5QA 5GU1X 1IERA 3C1ZA 3Q4OA 1IESA 4DZ0A 3PVTA 3ERZA 1BFRA 3F37A 2WTLA 3E1PA 4CMYA 3F38A 3E6RA 4CYBA 4LYXA 2V2MA 5LS9A 3PVYB 3VV9A 1DATA 1JI4A 2HR5A 5D8SA 3GGZA 1AEWA 1VEIA 4LQNA 2FZFA 3Q4RA 3AJOA 1QYBA 4W4LB 4TOAA 3F36A 5HQOA 3R2RA 4MN9A 2BW1A 1NF4A 3KX9A 3GGYA 3W54A 1NNQA 4PG0A 3O7SA 4DE6A 3IS8A 3HIUA 1S3QA 2BK6A 1YV1A 4EVDA 3WVWA 3QHCA 5LG2A 2CEIA 4RC5A 3PW8A 4RC8A 1O9RA 2V2LA 4LQHA 3WVVA 4ZJKA 1TJOA 4R42A 3KHKA 3FVBA 2XJOA 2CN6A 3BVKA 4M34A 3E6SA 3F39A 5IX6A 5FFEA 4TODA 3UNOA 1VEQA 3PWQC 2V2PA 3NP0X 4RC6A 1UVHA 5FFAA 3RE7A 1FHAA 1SQ3A 5FFBA 1RCIA 1BCFA 1VJXA 3IQ1A 5I4JA 4CVPA 3QHBA 3A68A 5GOUA 3PVTB 4CY9A 2XKQA 3H7GA 1RCEA 4PG1A 5J9VA 2VXIA 2YW6A 2CLBA 1SOFA 4DI0A 4ISMA 4AM2A 4IWKA 3AJPA 1JKVA 4XKUA 1YUXA 2XJNA 4RC7A 2ZURX 2CHPA 1JI5A 3BT5A 4M32A 4KVSA 2W0OA 1RCCA 2X170 3NOZX 2ZA6A 2GS4A 2IB0A 3UFBA 2JD60 2ZA7A 2C6RA 4E40A 3EZUA 4OYNA 4RC5B 4YVZA 1ZUJA 3E1MA 4CVSA 4TOHA 4ZKXA 2C41A 2IU2A 1Z6OM 4YXMA 2GYDA 4W4KB 5J93A 3PVRB 2IY4A 4ZL5A 4YXJA 2ZG8X 5CMQA 4ERUA 1DPSA 4AM5A 2JD70 2FFXJ 4QUWA 1OTKA 1J30A 4P18A 5JKMG 3GVYA 4DYYA 1N1QA 1HRSA 2FJCA 5CZUA 1TKPA 4Z5SA 5E2DA 3KDQA 4II4A 2WLAA 3SH6A 5E1UA 4MXPA 3R2HA 2QF9A 5J8SA 2V2SA 4TO9A 2ZG9X 4ETRA 2VXXA 4TOBA 4LPJA 1RYTA 3RAVA 3RD0A 4RC7B 5JKMA 2V15A 3SIDA 4ITTA 2V8UA 4CYAA 5D8RA 5CMRA 2V8TA 1XZ1A 1S2ZA 1Z6OA 3KA6A 5LG8A 2FKZA 5HU6D 3PVRA 2Z5RA 4MUDA 4KXRB 5D8YA 2C2FA 3AF8X 3UOIA 3FI6A 2BKCA 1TK6A 3PWQA 3F32A 2YJKA 2OC5A 5HJHA 3GHQA 1L8HA 2VZBA 1QGHA 1NF6A 1O9IA 1JYBA 1YUZA 4DASA 2C2UA 5D8PA 4EVBA 3JZ9A 1B71A 1JKUA 3EGMA 3RBCA 5D8XA 1UMNA 2AR0A 4WJG4 4II4B 3SE1A 2CF7A 3QB9A 4IWJA 1TKOA 2Y3QA 3BVFA 1LB3A 3ISFA 4TW3A 3FRSA 3U90A 4DYUA 5C6FA 3JZAB 1RCGA 5K53A 3UOFA 2OKCA 3E1QA 2V2IA 3VVAA 1DVBA 2F7NA 5JKLA 4TOEA 4LYUA 1MOJA 2Z6MA 2V2RA 4KVRA 4TOCA 3IS7A 4TOFA 4ISPA 3C23A 2GYQA 3BVLA 3QD8A 2CWLA 4M35A 3Q4QA 3LKDA 1MFRA 1LKMA 5K52A 3NP2X 3AJQA 2Z90A 3O7RA 5LBHA 1NFVA 2D5KA 1LKOA 2XJMA 4PGKA 2ITBA 2FL0A 4REUA 5FFCA 3BKNA 2YJJA 3R2LA 4ITWA 3ES3A 1KRQA 4M33A 2PYBA 3F33A 2G4HA 4DYXA 4CVRA 2CIHA 3OJ5A 2HTNA 3AF7X 3OGHA 2MGYA 3E1OA 2FG4A 3Q4NA 4MJYA 3E1LA 3MPSA 5ERJA 3KXUA 2ZG7X 3FRRA 4LPNA 3AK9A 3E1JA 2JD80 2V2NA 2RBDA 5FEJA 4LQVA 1VELA 3KA9A 5GU2X 4E6KA 3TA8A 1GWGA 3E2CA 2BJYA 4LPMA 4ZTTA 5JDOA 3PW8C 3WNWA 1JTSA 2XGWA 4Z3BA 2Y44A 3C1YA 1Z4AA 3E1NA 4ZL6A 5D8OA 2V2OA 3F34A 1L8IA 2Z5PA 5AXSA 5GN8A 3R2KA 2WLUA 2QQYA 2FHAA 5JACA 1EUMA 4EVCA 4X0JA 2ZA8A 3FSEA 1JGCA 1RCDA 3WVUA 3RGDA 4IXKA 2C2JA 3PW1A 5HJFA 4ZLWA 4ZKWA 5JKLG 3KA8A 5FFDA 2G38B 3VNXA 1XZ3A 4CVTA 3ISEA 4TOGA 5GU0X 5D8QA 3R2MA 3V3KB 3L0MA 1BG7A 1F30A 2CN7A 3D19A 2YW7A 3T9JA 1H96A 3PVYA 2OH3A 4A25A 5ERKA 3DBYA 4U3GA 4AM4A 1R03A 3QVDA 3M6JA 1ZS3A 4PGIA 3R2SA 2UX1A 3KA3A 2FG8A 1LKPA 3EZ0A 3QZ3A 5J8WA 3SHXA 1JREA 2N02A 3A9QA 5JDOB 4MKUA 4Y08A 3AK8A 4XKTA 4ZMCA 2V2JA 3HL1A 3R2OA 1F33A 4EVEA 1JIGA 5GN8B 4XKSA 2CLUA 4CMYV 3PWFA 5GU3X 3KWOA 3AF9X 4XGSA 4ML5A 4ZKHA 1VLGA 4KVQA 3KA4A 3PZAA 3C21A 4DYZA 3BVIA 3GE4A 2CHIA 3N6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LQJ A;  4RC6 B;  4YKH A;  3BVE A;  4MY7 A;  3PW1 B;  1S30 A;  3F35 A;  2Z5Q A;  5GU1 X;  1IER A;  3Q4O A;  1IES A;  4DZ0 A;  3PVT A;  3ERZ A;  1BFR A;  3F37 A;  2WTL A;  3E1P A;  4CMY A;  3F38 A;  3E6R A;  4CYB A;  4LYX A;  2V2M A;  5LS9 A;  3PVY B;  1DAT A;  1JI4 A;  2HR5 A;  5D8S A;  1AEW A;  1VEI A;  4LQN A;  2FZF A;  3Q4R A;  3AJO A;  1QYB A;  4TOA A;  3F36 A;  5HQO A;  3R2R A;  2BW1 A;  1NF4 A;  3KX9 A;  1NNQ A;  4PG0 A;  3O7S A;  4DE6 A;  3IS8 A;  3HIU A;  1S3Q A;  2BK6 A;  1YV1 A;  4EVD A;  3WVW A;  3QHC A;  5LG2 A;  2CEI A;  4RC5 A;  3PW8 A;  4RC8 A;  1O9R A;  2V2L A;  4LQH A;  3WVV A;  4ZJK A;  1TJO A;  4R42 A;  3FVB A;  2XJO A;  2CN6 A;  3BVK A;  4M34 A;  3E6S A;  3F39 A;  5IX6 A;  5FFE A;  4TOD A;  3UNO A;  1VEQ A;  3PWQ C;  2V2P A;  3NP0 X;  4RC6 A;  1UVH A;  5FFA A;  3RE7 A;  1FHA A;  1SQ3 A;  5FFB A;  1RCI A;  1BCF A;  1VJX A;  3IQ1 A;  5I4J A;  4CVP A;  3QHB A;  3A68 A;  5GOU A;  3PVT B;  4CY9 A;  2XKQ A;  3H7G A;  1RCE A;  4PG1 A;  5J9V A;  2VXI A;  2YW6 A;  2CLB A;  1SOF A;  4DI0 A;  4ISM A;  4AM2 A;  4IWK A;  3AJP A;  1JKV A;  4XKU A;  1YUX A;  2XJN A;  4RC7 A;  2ZUR X;  2CHP A;  1JI5 A;  3BT5 A;  4M32 A;  4KVS A;  2W0O A;  1RCC A;  2X17 0;  3NOZ X;  2ZA6 A;  2GS4 A;  2IB0 A;  2JD6 0;  2ZA7 A;  2C6R A;  3EZU A;  4OYN A;  4RC5 B;  1ZUJ A;  3E1M A;  4CVS A;  4TOH A;  4ZKX A;  2C41 A;  2IU2 A;  1Z6O M;  2GYD A;  5J93 A;  3PVR B;  2IY4 A;  4ZL5 A;  2ZG8 X;  5CMQ A;  4ERU A;  1DPS A;  4AM5 A;  2JD7 0;  2FFX J;  4QUW A;  1OTK A;  1J30 A;  4P18 A;  5JKM G;  3GVY A;  4DYY A;  1N1Q A;  1HRS A;  2FJC A;  5CZU A;  1TKP A;  4Z5S A;  5E2D A;  4II4 A;  3SH6 A;  2WLA A;  5E1U A;  3R2H A;  2QF9 A;  5J8S A;  2V2S A;  4TO9 A;  2ZG9 X;  4ETR A;  2VXX A;  4TOB A;  4LPJ A;  1RYT A;  3RAV A;  3RD0 A;  4RC7 B;  5JKM A;  2V15 A;  3SID A;  4ITT A;  4CYA A;  5D8R A;  5CMR A;  1XZ1 A;  1S2Z A;  1Z6O A;  3KA6 A;  5LG8 A;  2FKZ A;  3PVR A;  2Z5R A;  4MUD A;  5D8Y A;  2C2F A;  3AF8 X;  3UOI A;  3FI6 A;  2BKC A;  1TK6 A;  3PWQ A;  3F32 A;  2YJK A;  2OC5 A;  5HJH A;  3GHQ A;  1L8H A;  2VZB A;  1QGH A;  1NF6 A;  1O9I A;  1JYB A;  1YUZ A;  4DAS A;  2C2U A;  5D8P A;  4EVB A;  1B71 A;  1JKU A;  3EGM A;  3RBC A;  5D8X A;  1UMN A;  4II4 B;  3SE1 A;  2CF7 A;  3QB9 A;  4IWJ A;  1TKO A;  2Y3Q A;  3BVF A;  1LB3 A;  3ISF A;  4TW3 A;  3U90 A;  4DYU A;  5C6F A;  1RCG A;  5K53 A;  3UOF A;  3E1Q A;  2V2I A;  1DVB A;  2F7N A;  5JKL A;  4TOE A;  4LYU A;  1MOJ A;  2Z6M A;  2V2R A;  4KVR A;  4TOC A;  3IS7 A;  4TOF A;  4ISP A;  2GYQ A;  3BVL A;  3QD8 A;  4M35 A;  3Q4Q A;  1MFR A;  1LKM A;  5K52 A;  3NP2 X;  3AJQ A;  2Z90 A;  3O7R A;  5LBH A;  1NFV A;  2D5K A;  1LKO A;  2XJM A;  4PGK A;  2ITB A;  2FL0 A;  4REU A;  5FFC A;  3BKN A;  2YJJ A;  3R2L A;  4ITW A;  3ES3 A;  1KRQ A;  4M33 A;  2PYB A;  3F33 A;  2G4H A;  4DYX A;  4CVR A;  2CIH A;  3OJ5 A;  2HTN A;  3AF7 X;  3OGH A;  3E1O A;  2FG4 A;  3Q4N A;  4MJY A;  3E1L A;  3MPS A;  5ERJ A;  3KXU A;  2ZG7 X;  4LPN A;  3AK9 A;  3E1J A;  2JD8 0;  2V2N A;  2RBD A;  5FEJ A;  4LQV A;  1VEL A;  3KA9 A;  5GU2 X;  4E6K A;  3TA8 A;  1GWG A;  3E2C A;  2BJY A;  4LPM A;  4ZTT A;  3PW8 C;  3WNW A;  1JTS A;  2XGW A;  4Z3B A;  1Z4A A;  3E1N A;  4ZL6 A;  5D8O A;  2V2O A;  3F34 A;  1L8I A;  2Z5P A;  5AXS A;  5GN8 A;  3R2K A;  2WLU A;  2QQY A;  2FHA A;  5JAC A;  1EUM A;  4EVC A;  2ZA8 A;  3FSE A;  1JGC A;  1RCD A;  3WVU A;  3RGD A;  4IXK A;  2C2J A;  3PW1 A;  5HJF A;  4ZLW A;  4ZKW A;  5JKL G;  3KA8 A;  5FFD A;  3VNX A;  1XZ3 A;  4CVT A;  3ISE A;  4TOG A;  5GU0 X;  5D8Q A;  3R2M A;  1BG7 A;  1F30 A;  2CN7 A;  2YW7 A;  3T9J A;  1H96 A;  3PVY A;  2OH3 A;  4A25 A;  5ERK A;  4U3G A;  4AM4 A;  1R03 A;  3QVD A;  1ZS3 A;  4PGI A;  3R2S A;  2UX1 A;  3KA3 A;  2FG8 A;  1LKP A;  3EZ0 A;  3QZ3 A;  5J8W A;  3SHX A;  1JRE A;  3A9Q A;  4MKU A;  4Y08 A;  3AK8 A;  4XKT A;  4ZMC A;  2V2J A;  3HL1 A;  3R2O A;  1F33 A;  4EVE A;  1JIG A;  5GN8 B;  4XKS A;  2CLU A;  4CMY V;  3PWF A;  5GU3 X;  3KWO A;  3AF9 X;  4XGS A;  4ML5 A;  4ZKH A;  1VLG A;  4KVQ A;  3KA4 A;  3PZA A;  4DYZ A;  3BVI A;  3GE4 A;  2CHI A;  4MN9 A; 
#chains in the Genus database with same CATH topology
 4LQJ A;  4RC6 B;  4YKH A;  3BVE A;  4MY7 A;  3PW1 B;  2WWX B;  1S30 A;  3F35 A;  2Z5Q A;  5GU1 X;  1IER A;  3C1Z A;  3Q4O A;  1IES A;  4DZ0 A;  3PVT A;  3ERZ A;  1BFR A;  3F37 A;  2WTL A;  3E1P A;  4CMY A;  3F38 A;  3E6R A;  4CYB A;  4LYX A;  2V2M A;  5LS9 A;  3PVY B;  3VV9 A;  1DAT A;  1JI4 A;  2HR5 A;  5D8S A;  3GGZ A;  1AEW A;  1VEI A;  4LQN A;  2FZF A;  3Q4R A;  3AJO A;  1QYB A;  4W4L B;  4TOA A;  3F36 A;  5HQO A;  3R2R A;  4MN9 A;  2BW1 A;  1NF4 A;  3KX9 A;  3GGY A;  3W54 A;  1NNQ A;  4PG0 A;  3O7S A;  4DE6 A;  3IS8 A;  3HIU A;  1S3Q A;  2BK6 A;  1YV1 A;  4EVD A;  3WVW A;  3QHC A;  5LG2 A;  2CEI A;  4RC5 A;  3PW8 A;  4RC8 A;  1O9R A;  2V2L A;  4LQH A;  3WVV A;  4ZJK A;  1TJO A;  4R42 A;  3KHK A;  3FVB A;  2XJO A;  2CN6 A;  3BVK A;  4M34 A;  3E6S A;  3F39 A;  5IX6 A;  5FFE A;  4TOD A;  3UNO A;  1VEQ A;  3PWQ C;  2V2P A;  3NP0 X;  4RC6 A;  1UVH A;  5FFA A;  3RE7 A;  1FHA A;  1SQ3 A;  5FFB A;  1RCI A;  1BCF A;  1VJX A;  3IQ1 A;  5I4J A;  4CVP A;  3QHB A;  3A68 A;  5GOU A;  3PVT B;  4CY9 A;  2XKQ A;  3H7G A;  1RCE A;  4PG1 A;  5J9V A;  2VXI A;  2YW6 A;  2CLB A;  1SOF A;  4DI0 A;  4ISM A;  4AM2 A;  4IWK A;  3AJP A;  1JKV A;  4XKU A;  1YUX A;  2XJN A;  4RC7 A;  2ZUR X;  2CHP A;  1JI5 A;  3BT5 A;  4M32 A;  4KVS A;  2W0O A;  1RCC A;  2X17 0;  3NOZ X;  2ZA6 A;  2GS4 A;  2IB0 A;  3UFB A;  2JD6 0;  2ZA7 A;  2C6R A;  4E40 A;  3EZU A;  4OYN A;  4RC5 B;  4YVZ A;  1ZUJ A;  3E1M A;  4CVS A;  4TOH A;  4ZKX A;  2C41 A;  2IU2 A;  1Z6O M;  4YXM A;  2GYD A;  4W4K B;  5J93 A;  3PVR B;  2IY4 A;  4ZL5 A;  4YXJ A;  2ZG8 X;  5CMQ A;  4ERU A;  1DPS A;  4AM5 A;  2JD7 0;  2FFX J;  4QUW A;  1OTK A;  1J30 A;  4P18 A;  5JKM G;  3GVY A;  4DYY A;  1N1Q A;  1HRS A;  2FJC A;  5CZU A;  1TKP A;  4Z5S A;  5E2D A;  3KDQ A;  4II4 A;  2WLA A;  3SH6 A;  5E1U A;  4MXP A;  3R2H A;  2QF9 A;  5J8S A;  2V2S A;  4TO9 A;  2ZG9 X;  4ETR A;  2VXX A;  4TOB A;  4LPJ A;  1RYT A;  3RAV A;  3RD0 A;  4RC7 B;  5JKM A;  2V15 A;  3SID A;  4ITT A;  2V8U A;  4CYA A;  5D8R A;  5CMR A;  2V8T A;  1XZ1 A;  1S2Z A;  1Z6O A;  3KA6 A;  5LG8 A;  2FKZ A;  5HU6 D;  3PVR A;  2Z5R A;  4MUD A;  4KXR B;  5D8Y A;  2C2F A;  3AF8 X;  3UOI A;  3FI6 A;  2BKC A;  1TK6 A;  3PWQ A;  3F32 A;  2YJK A;  2OC5 A;  5HJH A;  3GHQ A;  1L8H A;  2VZB A;  1QGH A;  1NF6 A;  1O9I A;  1JYB A;  1YUZ A;  4DAS A;  2C2U A;  5D8P A;  4EVB A;  3JZ9 A;  1B71 A;  1JKU A;  3EGM A;  3RBC A;  5D8X A;  1UMN A;  2AR0 A;  4WJG 4;  4II4 B;  3SE1 A;  2CF7 A;  3QB9 A;  4IWJ A;  1TKO A;  2Y3Q A;  3BVF A;  1LB3 A;  3ISF A;  4TW3 A;  3FRS A;  3U90 A;  4DYU A;  5C6F A;  3JZA B;  1RCG A;  5K53 A;  3UOF A;  2OKC A;  3E1Q A;  2V2I A;  3VVA A;  1DVB A;  2F7N A;  5JKL A;  4TOE A;  4LYU A;  1MOJ A;  2Z6M A;  2V2R A;  4KVR A;  4TOC A;  3IS7 A;  4TOF A;  4ISP A;  3C23 A;  2GYQ A;  3BVL A;  3QD8 A;  2CWL A;  4M35 A;  3Q4Q A;  3LKD A;  1MFR A;  1LKM A;  5K52 A;  3NP2 X;  3AJQ A;  2Z90 A;  3O7R A;  5LBH A;  1NFV A;  2D5K A;  1LKO A;  2XJM A;  4PGK A;  2ITB A;  2FL0 A;  4REU A;  5FFC A;  3BKN A;  2YJJ A;  3R2L A;  4ITW A;  3ES3 A;  1KRQ A;  4M33 A;  2PYB A;  3F33 A;  2G4H A;  4DYX A;  4CVR A;  2CIH A;  3OJ5 A;  2HTN A;  3AF7 X;  3OGH A;  2MGY A;  3E1O A;  2FG4 A;  3Q4N A;  4MJY A;  3E1L A;  3MPS A;  5ERJ A;  3KXU A;  2ZG7 X;  3FRR A;  4LPN A;  3AK9 A;  3E1J A;  2JD8 0;  2V2N A;  2RBD A;  5FEJ A;  4LQV A;  1VEL A;  3KA9 A;  5GU2 X;  4E6K A;  3TA8 A;  1GWG A;  3E2C A;  2BJY A;  4LPM A;  4ZTT A;  5JDO A;  3PW8 C;  3WNW A;  1JTS A;  2XGW A;  4Z3B A;  2Y44 A;  3C1Y A;  1Z4A A;  3E1N A;  4ZL6 A;  5D8O A;  2V2O A;  3F34 A;  1L8I A;  2Z5P A;  5AXS A;  5GN8 A;  3R2K A;  2WLU A;  2QQY A;  2FHA A;  5JAC A;  1EUM A;  4EVC A;  4X0J A;  2ZA8 A;  3FSE A;  1JGC A;  1RCD A;  3WVU A;  3RGD A;  4IXK A;  2C2J A;  3PW1 A;  5HJF A;  4ZLW A;  4ZKW A;  5JKL G;  3KA8 A;  5FFD A;  2G38 B;  3VNX A;  1XZ3 A;  4CVT A;  3ISE A;  4TOG A;  5GU0 X;  5D8Q A;  3R2M A;  3V3K B;  3L0M A;  1BG7 A;  1F30 A;  2CN7 A;  3D19 A;  2YW7 A;  3T9J A;  1H96 A;  3PVY A;  2OH3 A;  4A25 A;  5ERK A;  3DBY A;  4U3G A;  4AM4 A;  1R03 A;  3QVD A;  3M6J A;  1ZS3 A;  4PGI A;  3R2S A;  2UX1 A;  3KA3 A;  2FG8 A;  1LKP A;  3EZ0 A;  3QZ3 A;  5J8W A;  3SHX A;  1JRE A;  2N02 A;  3A9Q A;  5JDO B;  4MKU A;  4Y08 A;  3AK8 A;  4XKT A;  4ZMC A;  2V2J A;  3HL1 A;  3R2O A;  1F33 A;  4EVE A;  1JIG A;  5GN8 B;  4XKS A;  2CLU A;  4CMY V;  3PWF A;  5GU3 X;  3KWO A;  3AF9 X;  4XGS A;  4ML5 A;  4ZKH A;  1VLG A;  4KVQ A;  3KA4 A;  3PZA A;  3C21 A;  4DYZ A;  3BVI A;  3GE4 A;  2CHI A;  3N6O A; 
#chains in the Genus database with same CATH homology
 4LQJ A;  4RC6 B;  4YKH A;  3BVE A;  4MY7 A;  3PW1 B;  2WWX B;  1S30 A;  3F35 A;  2Z5Q A;  5GU1 X;  1IER A;  3C1Z A;  3Q4O A;  1IES A;  4DZ0 A;  3PVT A;  3ERZ A;  1BFR A;  3F37 A;  2WTL A;  3E1P A;  4CMY A;  3F38 A;  3E6R A;  4CYB A;  4LYX A;  2V2M A;  5LS9 A;  3PVY B;  3VV9 A;  1DAT A;  1JI4 A;  2HR5 A;  5D8S A;  3GGZ A;  1AEW A;  1VEI A;  4LQN A;  2FZF A;  3Q4R A;  3AJO A;  1QYB A;  4W4L B;  4TOA A;  3F36 A;  5HQO A;  3R2R A;  4MN9 A;  2BW1 A;  1NF4 A;  3KX9 A;  3GGY A;  3W54 A;  1NNQ A;  4PG0 A;  3O7S A;  4DE6 A;  3IS8 A;  3HIU A;  1S3Q A;  2BK6 A;  1YV1 A;  4EVD A;  3WVW A;  3QHC A;  5LG2 A;  2CEI A;  4RC5 A;  3PW8 A;  4RC8 A;  1O9R A;  2V2L A;  4LQH A;  3WVV A;  4ZJK A;  1TJO A;  4R42 A;  3KHK A;  3FVB A;  2XJO A;  2CN6 A;  3BVK A;  4M34 A;  3E6S A;  3F39 A;  5IX6 A;  5FFE A;  4TOD A;  3UNO A;  1VEQ A;  3PWQ C;  2V2P A;  3NP0 X;  4RC6 A;  1UVH A;  5FFA A;  3RE7 A;  1FHA A;  1SQ3 A;  5FFB A;  1RCI A;  1BCF A;  1VJX A;  3IQ1 A;  5I4J A;  4CVP A;  3QHB A;  3A68 A;  5GOU A;  3PVT B;  4CY9 A;  2XKQ A;  3H7G A;  1RCE A;  4PG1 A;  5J9V A;  2VXI A;  2YW6 A;  2CLB A;  1SOF A;  4DI0 A;  4ISM A;  4AM2 A;  4IWK A;  3AJP A;  1JKV A;  4XKU A;  1YUX A;  2XJN A;  4RC7 A;  2ZUR X;  2CHP A;  1JI5 A;  3BT5 A;  4M32 A;  4KVS A;  2W0O A;  1RCC A;  2X17 0;  3NOZ X;  2ZA6 A;  2GS4 A;  2IB0 A;  3UFB A;  2JD6 0;  2ZA7 A;  2C6R A;  4E40 A;  3EZU A;  4OYN A;  4RC5 B;  4YVZ A;  1ZUJ A;  3E1M A;  4CVS A;  4TOH A;  4ZKX A;  2C41 A;  2IU2 A;  1Z6O M;  4YXM A;  2GYD A;  4W4K B;  5J93 A;  3PVR B;  2IY4 A;  4ZL5 A;  4YXJ A;  2ZG8 X;  5CMQ A;  4ERU A;  1DPS A;  4AM5 A;  2JD7 0;  2FFX J;  4QUW A;  1OTK A;  1J30 A;  4P18 A;  5JKM G;  3GVY A;  4DYY A;  1N1Q A;  1HRS A;  2FJC A;  5CZU A;  1TKP A;  4Z5S A;  5E2D A;  3KDQ A;  4II4 A;  2WLA A;  3SH6 A;  5E1U A;  4MXP A;  3R2H A;  2QF9 A;  5J8S A;  2V2S A;  4TO9 A;  2ZG9 X;  4ETR A;  2VXX A;  4TOB A;  4LPJ A;  1RYT A;  3RAV A;  3RD0 A;  4RC7 B;  5JKM A;  2V15 A;  3SID A;  4ITT A;  2V8U A;  4CYA A;  5D8R A;  5CMR A;  2V8T A;  1XZ1 A;  1S2Z A;  1Z6O A;  3KA6 A;  5LG8 A;  2FKZ A;  5HU6 D;  3PVR A;  2Z5R A;  4MUD A;  4KXR B;  5D8Y A;  2C2F A;  3AF8 X;  3UOI A;  3FI6 A;  2BKC A;  1TK6 A;  3PWQ A;  3F32 A;  2YJK A;  2OC5 A;  5HJH A;  3GHQ A;  1L8H A;  2VZB A;  1QGH A;  1NF6 A;  1O9I A;  1JYB A;  1YUZ A;  4DAS A;  2C2U A;  5D8P A;  4EVB A;  3JZ9 A;  1B71 A;  1JKU A;  3EGM A;  3RBC A;  5D8X A;  1UMN A;  2AR0 A;  4WJG 4;  4II4 B;  3SE1 A;  2CF7 A;  3QB9 A;  4IWJ A;  1TKO A;  2Y3Q A;  3BVF A;  1LB3 A;  3ISF A;  4TW3 A;  3FRS A;  3U90 A;  4DYU A;  5C6F A;  3JZA B;  1RCG A;  5K53 A;  3UOF A;  2OKC A;  3E1Q A;  2V2I A;  3VVA A;  1DVB A;  2F7N A;  5JKL A;  4TOE A;  4LYU A;  1MOJ A;  2Z6M A;  2V2R A;  4KVR A;  4TOC A;  3IS7 A;  4TOF A;  4ISP A;  3C23 A;  2GYQ A;  3BVL A;  3QD8 A;  2CWL A;  4M35 A;  3Q4Q A;  3LKD A;  1MFR A;  1LKM A;  5K52 A;  3NP2 X;  3AJQ A;  2Z90 A;  3O7R A;  5LBH A;  1NFV A;  2D5K A;  1LKO A;  2XJM A;  4PGK A;  2ITB A;  2FL0 A;  4REU A;  5FFC A;  3BKN A;  2YJJ A;  3R2L A;  4ITW A;  3ES3 A;  1KRQ A;  4M33 A;  2PYB A;  3F33 A;  2G4H A;  4DYX A;  4CVR A;  2CIH A;  3OJ5 A;  2HTN A;  3AF7 X;  3OGH A;  2MGY A;  3E1O A;  2FG4 A;  3Q4N A;  4MJY A;  3E1L A;  3MPS A;  5ERJ A;  3KXU A;  2ZG7 X;  3FRR A;  4LPN A;  3AK9 A;  3E1J A;  2JD8 0;  2V2N A;  2RBD A;  5FEJ A;  4LQV A;  1VEL A;  3KA9 A;  5GU2 X;  4E6K A;  3TA8 A;  1GWG A;  3E2C A;  2BJY A;  4LPM A;  4ZTT A;  5JDO A;  3PW8 C;  3WNW A;  1JTS A;  2XGW A;  4Z3B A;  2Y44 A;  3C1Y A;  1Z4A A;  3E1N A;  4ZL6 A;  5D8O A;  2V2O A;  3F34 A;  1L8I A;  2Z5P A;  5AXS A;  5GN8 A;  3R2K A;  2WLU A;  2QQY A;  2FHA A;  5JAC A;  1EUM A;  4EVC A;  4X0J A;  2ZA8 A;  3FSE A;  1JGC A;  1RCD A;  3WVU A;  3RGD A;  4IXK A;  2C2J A;  3PW1 A;  5HJF A;  4ZLW A;  4ZKW A;  5JKL G;  3KA8 A;  5FFD A;  2G38 B;  3VNX A;  1XZ3 A;  4CVT A;  3ISE A;  4TOG A;  5GU0 X;  5D8Q A;  3R2M A;  3V3K B;  3L0M A;  1BG7 A;  1F30 A;  2CN7 A;  3D19 A;  2YW7 A;  3T9J A;  1H96 A;  3PVY A;  2OH3 A;  4A25 A;  5ERK A;  3DBY A;  4U3G A;  4AM4 A;  1R03 A;  3QVD A;  3M6J A;  1ZS3 A;  4PGI A;  3R2S A;  2UX1 A;  3KA3 A;  2FG8 A;  1LKP A;  3EZ0 A;  3QZ3 A;  5J8W A;  3SHX A;  1JRE A;  2N02 A;  3A9Q A;  5JDO B;  4MKU A;  4Y08 A;  3AK8 A;  4XKT A;  4ZMC A;  2V2J A;  3HL1 A;  3R2O A;  1F33 A;  4EVE A;  1JIG A;  5GN8 B;  4XKS A;  2CLU A;  4CMY V;  3PWF A;  5GU3 X;  3KWO A;  3AF9 X;  4XGS A;  4ML5 A;  4ZKH A;  1VLG A;  4KVQ A;  3KA4 A;  3PZA A;  3C21 A;  4DYZ A;  3BVI A;  3GE4 A;  2CHI A;  3N6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...