3BVIA

Structural basis for the iron uptake mechanism of helicobacter pylori ferritin
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
172
structure length
172
Chain Sequence
HHSQDPMLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIIFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferritin
publication title Structural basis for the iron uptake mechanism of Helicobacter pylori ferritin
rcsb
source organism Helicobacter pylori
molecule tags Oxidoreductase
total genus 77
structure length 172
sequence length 172
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.16.3.2: Bacterial non-heme ferritin.
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3bviA00
1YUZA 4KVQA 4TOCA 2GYDA 3SHXA 3KA3A 4ERUA 4LQVA 2CLBA 4EVEA 3IQ1A 5FFAA 3F34A 2FFXJ 2C41A 5D8XA 4OYNA 2CN7A 3WNWA 4RC7A 3AJPA 4MUDA 4QUWA 5J9VA 3R2MA 2CIHA 2Y3QA 4EVCA 3AF7X 3BVKA 4ETRA 3PW1A 4ZMCA 4IXKA 4ML5A 3AK9A 1IERA 1S2ZA 3E6SA 2FJCA 4XKUA 1TJOA 1JYBA 1DPSA 4ZL6A 1NF6A 1KRQA 2PYBA 3E1NA 4ZKHA 3GVYA 4TODA 3PVTA 3BVLA 1VJXA 3EGMA 3KA9A 2VZBA 2WLAA 5K52A 2BW1A 2OC5A 2ZG8X 3NP0X 5HJHA 3R2RA 5FEJA 5FFBA 3PVYA 1L8IA 3R2SA 1VLGA 3BT5A 5CMRA 4ITWA 4CYBA 5K53A 3E1MA 5E2DA 2BK6A 3TA8A 2ITBA 2CEIA 3E1PA 4CY9A 3PVRA 4XKSA 2ZG7X 5JKLG 3KXUA 4ZKXA 4EVBA 5IX6A 4CVSA 2XJMA 4TOHA 4LPMA 4LYUA 4RC7B 1UMNA 3AK8A 4TW3A 5GU1X 2V2JA 1RCCA 3A9QA 1NF4A 1JI4A 4AM2A 3E2CA 5FFEA 1L8HA 2RBDA 3F36A 2CLUA 3HIUA 4PG0A 3PW1B 3T9JA 3HL1A 4KVSA 4DYUA 2FKZA 3AF9X 3H7GA 4ITTA 4RC6A 3Q4OA 3PWFA 3SIDA 3E1OA 3UOFA 3F35A 3F38A 2V2PA 1S3QA 3OJ5A 4LQNA 2FG4A 4P18A 2ZA8A 1O9IA 1RCDA 3PVTB 4MJYA 5ERJA 2V2SA 1JKUA 3QB9A 2HR5A 5FFCA 2IU2A 3AJQA 3PVYB 5I4JA 3SH6A 2Z6MA 1BG7A 4ZTTA 5D8OA 1F30A 4DYYA 5HJFA 4DYXA 1O9RA 2FZFA 1ZS3A 4E6KA 4TOGA 1QGHA 1TK6A 1TKOA 3R2HA 1YV1A 3PVRB 2YW6A 4RC8A 1B71A 3R2KA 3KA4A 4LYXA 5LG2A 2W0OA 5GU2X 1JIGA 4PGKA 3FI6A 1OTKA 1DATA 2IY4A 2BJYA 2G4HA 3KA8A 4XGSA 1XZ3A 3AF8X 1HRSA 1RCEA 1JTSA 1LKPA 3E6RA 2QQYA 2WTLA 1LKMA 4DZ0A 5D8RA 4RC6B 2JD70 1S30A 4II4A 4LQHA 4U3GA 1NFVA 2V2NA 2V2LA 2CN6A 4ZKWA 1R03A 2V15A 2F7NA 3QVDA 3ERZA 3PW8A 3UOIA 2Z5RA 2D5KA 2XGWA 3VNXA 2C2FA 3QZ3A 2VXXA 2V2RA 3BVIA 4DE6A 5GOUA 4Z5SA 2IB0A 1GWGA 4TOFA 2JD80 2Z90A 2XKQA 5J93A 3R2OA 1YUXA 1RYTA 1IESA 3PZAA 3RD0A 4LQJA 5D8SA 2XJNA 3WVVA 2GS4A 3KX9A 2C2UA 1AEWA 5LBHA 1JGCA 2Z5PA 2C2JA 3O7SA 4CMYV 4CMYA 2YJKA 1F33A 2CHIA 2ZG9X 4IWJA 1BFRA 4TOEA 1LB3A 3AJOA 4RC5A 5FFDA 3KA6A 4TOAA 5E1UA 3ISFA 1VELA 3QHBA 1MOJA 5GN8A 3A68A 4AM5A 3SE1A 4PGIA 1QYBA 1VEIA 4EVDA 5D8PA 2WLUA 2ZA7A 1JKVA 1Z6OM 4II4B 2XJOA 5JKMG 1VEQA 2CF7A 2UX1A 4YKHA 4CYAA 2ZURX 2YW7A 4CVTA 3Q4QA 1RCIA 1FHAA 4DASA 1UVHA 4R42A 5JACA 3F37A 2OH3A 4TOBA 5D8QA 3ES3A 4MKUA 4PG1A 5CZUA 4AM4A 2C6RA 1TKPA 3PW8C 3Q4NA 2FL0A 3RBCA 5LS9A 3PWQA 4CVPA 1DVBA 2YJJA 4ZLWA 4KVRA 1EUMA 4M35A 3OGHA 5LG8A 2FG8A 3F39A 1RCGA 3WVUA 3RE7A 1BCFA 3IS8A 3ISEA 1LKOA 1N1QA 4A25A 4RC5B 5ERKA 1MFRA 3O7RA 2Z5QA 5GN8B 4MN9A 3F33A 4REUA 3NOZX 3UNOA 3F32A 4IWKA 3NP2X 2BKCA 3RGDA 3WVWA 5JKLA 1JREA 3E1LA 3FVBA 3MPSA 4ZL5A 2V2IA 5GU0X 2X170 1Z4AA 3R2LA 3E1QA 4XKTA 4Z3BA 4M32A 4ISPA 4LPJA 2ZA6A 3EZUA 3GHQA 2HTNA 4DI0A 3BKNA 4LPNA 2VXIA 3GE4A 3IS7A 5D8YA 4ISMA 4M34A 3FSEA 1SOFA 2CHPA 1XZ1A 4DYZA 1SQ3A 3EZ0A 2V2OA 4Y08A 4TO9A 2V2MA 3QHCA 1ZUJA 3QD8A 5GU3X 1H96A 2QF9A 4MY7A 5CMQA 3Q4RA 3U90A 2FHAA 5JKMA 3E1JA 1JI5A 1Z6OA 4CVRA 3RAVA 3BVEA 3PWQC 3BVFA 1J30A 5J8SA 2GYQA 4M33A 5J8WA 2JD60 5AXSA 5C6FA 4ZJKA 3KWOA 5HQOA 1NNQA
chains in the Genus database with same CATH superfamily
1YUZA 4KVQA 4TOCA 2GYDA 3SHXA 3KA3A 2CWLA 4ERUA 4LQVA 2CLBA 4EVEA 3C21A 3IQ1A 5FFAA 3F34A 2FFXJ 2C41A 5D8XA 4OYNA 2CN7A 3KHKA 4E40A 3WNWA 4RC7A 3AJPA 3V3KB 4MUDA 4QUWA 5J9VA 3R2MA 2CIHA 2Y3QA 4EVCA 5JDOB 3AF7X 3BVKA 4ETRA 3PW1A 4MXPA 4ZMCA 4IXKA 4ML5A 3AK9A 1IERA 1S2ZA 3E6SA 2FJCA 3JZ9A 4XKUA 1TJOA 1JYBA 1DPSA 4ZL6A 3W54A 1NF6A 1KRQA 2PYBA 3E1NA 4ZKHA 3GVYA 4TODA 3PVTA 3BVLA 1VJXA 3EGMA 3KA9A 2VZBA 2WLAA 5K52A 2BW1A 2OC5A 2ZG8X 3NP0X 5HJHA 3R2RA 2AR0A 5FEJA 5FFBA 3PVYA 1L8IA 3R2SA 1VLGA 3BT5A 5CMRA 4ITWA 4CYBA 5K53A 3E1MA 5E2DA 2BK6A 3TA8A 2ITBA 2CEIA 3E1PA 4CY9A 3PVRA 4XKSA 2ZG7X 5JKLG 3KXUA 4ZKXA 4EVBA 5IX6A 4CVSA 2XJMA 4TOHA 4LPMA 4LYUA 4RC7B 1UMNA 3AK8A 4TW3A 5GU1X 2V2JA 1RCCA 3A9QA 1NF4A 1JI4A 3M6JA 4AM2A 3E2CA 5FFEA 1L8HA 2RBDA 3F36A 2CLUA 3HIUA 4PG0A 3PW1B 3T9JA 3HL1A 4KVSA 4DYUA 2FKZA 3AF9X 3H7GA 4ITTA 4RC6A 3Q4OA 3PWFA 4KXRB 3SIDA 3E1OA 4X0JA 3UOFA 3F35A 3C1ZA 3F38A 2V2PA 1S3QA 3OJ5A 4LQNA 2FG4A 4P18A 2ZA8A 1O9IA 1RCDA 3PVTB 4MJYA 5ERJA 2V2SA 1JKUA 3QB9A 2HR5A 5FFCA 2IU2A 3AJQA 3PVYB 5I4JA 3SH6A 2Z6MA 1BG7A 4ZTTA 5D8OA 1F30A 4DYYA 5HJFA 4DYXA 3C1YA 1O9RA 3VVAA 2FZFA 1ZS3A 4E6KA 4TOGA 1QGHA 1TK6A 1TKOA 3R2HA 1YV1A 3PVRB 2YW6A 4RC8A 1B71A 3R2KA 3KA4A 4LYXA 5LG2A 2W0OA 5GU2X 1JIGA 4PGKA 3FI6A 1OTKA 1DATA 2IY4A 2BJYA 2G4HA 3KA8A 4XGSA 1XZ3A 3AF8X 1HRSA 1RCEA 2N02A 1JTSA 1LKPA 3E6RA 2QQYA 2WTLA 1LKMA 2MGYA 4DZ0A 5D8RA 4RC6B 2JD70 1S30A 4II4A 4LQHA 4U3GA 1NFVA 2V2NA 2V2LA 2CN6A 4ZKWA 1R03A 2V15A 2F7NA 3QVDA 3ERZA 3PW8A 3UOIA 2Z5RA 2D5KA 2XGWA 3VNXA 2C2FA 3QZ3A 2VXXA 4YVZA 2V2RA 3BVIA 4DE6A 3N6OA 5GOUA 4Z5SA 2IB0A 1GWGA 4TOFA 2JD80 2Z90A 2XKQA 2V8TA 2Y44A 3R2OA 5J93A 4W4LB 1YUXA 1RYTA 1IESA 3PZAA 3RD0A 4LQJA 5D8SA 3UFBA 2XJNA 3WVVA 2GS4A 3KX9A 2C2UA 1AEWA 5LBHA 1JGCA 2Z5PA 2C2JA 3O7SA 4CMYV 4CMYA 2YJKA 1F33A 2CHIA 2ZG9X 4IWJA 1BFRA 4TOEA 3JZAB 1LB3A 3AJOA 4RC5A 5FFDA 3KA6A 4TOAA 5E1UA 3ISFA 1VELA 3QHBA 1MOJA 5GN8A 3A68A 4AM5A 3SE1A 4PGIA 1QYBA 1VEIA 4EVDA 5D8PA 2WLUA 2ZA7A 1JKVA 1Z6OM 4II4B 2XJOA 5JKMG 1VEQA 2CF7A 2UX1A 4YKHA 4CYAA 2ZURX 2WWXB 2YW7A 4CVTA 3Q4QA 1RCIA 1FHAA 4DASA 1UVHA 4R42A 5JACA 3F37A 2OH3A 4TOBA 5D8QA 3C23A 3ES3A 4MKUA 4PG1A 5CZUA 4AM4A 2C6RA 3FRRA 1TKPA 3PW8C 3Q4NA 2FL0A 3RBCA 5LS9A 3PWQA 4CVPA 1DVBA 2YJJA 4ZLWA 4KVRA 3VV9A 1EUMA 4M35A 3OGHA 5LG8A 2FG8A 3F39A 1RCGA 3WVUA 3RE7A 1BCFA 3IS8A 2V8UA 3ISEA 1LKOA 1N1QA 4A25A 4RC5B 5ERKA 1MFRA 3O7RA 2Z5QA 5GN8B 4YXMA 4MN9A 3F33A 3L0MA 4YXJA 3LKDA 4REUA 3NOZX 3UNOA 3F32A 3KDQA 3NP2X 2BKCA 4IWKA 3GGYA 3RGDA 3WVWA 5JKLA 1JREA 3E1LA 3FVBA 3MPSA 4ZL5A 2V2IA 5GU0X 2X170 3FRSA 1Z4AA 3R2LA 3E1QA 4XKTA 4Z3BA 4ISPA 4LPJA 4M32A 2ZA6A 3EZUA 3GHQA 2HTNA 2G38B 4DI0A 3BKNA 4LPNA 2VXIA 3GE4A 3GGZA 3IS7A 5D8YA 4ISMA 4M34A 3FSEA 5JDOA 1SOFA 3D19A 4WJG4 4W4KB 2CHPA 1XZ1A 4DYZA 1SQ3A 3EZ0A 2V2OA 4Y08A 5HU6D 4TO9A 2V2MA 3QHCA 1ZUJA 3QD8A 5GU3X 1H96A 2QF9A 4MY7A 5CMQA 3Q4RA 3U90A 2FHAA 5JKMA 3E1JA 1JI5A 1Z6OA 4CVRA 3RAVA 3BVEA 3PWQC 3BVFA 1J30A 3DBYA 5J8SA 2GYQA 2OKCA 4M33A 5J8WA 2JD60 5AXSA 5C6FA 4ZJKA 3KWOA 5HQOA 1NNQA
chains in the Genus database with same CATH topology
1YUZA 4KVQA 4TOCA 2GYDA 3SHXA 3KA3A 2CWLA 4ERUA 4LQVA 2CLBA 4EVEA 3C21A 3IQ1A 5FFAA 3F34A 2FFXJ 2C41A 5D8XA 4OYNA 2CN7A 3KHKA 4E40A 3WNWA 4RC7A 3AJPA 3V3KB 4MUDA 4QUWA 5J9VA 3R2MA 2CIHA 2Y3QA 4EVCA 5JDOB 3AF7X 3BVKA 4ETRA 3PW1A 4MXPA 4ZMCA 4IXKA 4ML5A 3AK9A 1IERA 1S2ZA 3E6SA 2FJCA 3JZ9A 4XKUA 1TJOA 1JYBA 1DPSA 4ZL6A 3W54A 1NF6A 1KRQA 2PYBA 3E1NA 4ZKHA 3GVYA 4TODA 3PVTA 3BVLA 1VJXA 3EGMA 3KA9A 2VZBA 2WLAA 5K52A 2BW1A 2OC5A 2ZG8X 3NP0X 5HJHA 3R2RA 2AR0A 5FEJA 5FFBA 3PVYA 1L8IA 3R2SA 1VLGA 3BT5A 5CMRA 4ITWA 4CYBA 5K53A 3E1MA 5E2DA 2BK6A 3TA8A 2ITBA 2CEIA 3E1PA 4CY9A 3PVRA 4XKSA 2ZG7X 5JKLG 3KXUA 4ZKXA 4EVBA 5IX6A 4CVSA 2XJMA 4TOHA 4LPMA 4LYUA 4RC7B 1UMNA 3AK8A 4TW3A 5GU1X 2V2JA 1RCCA 3A9QA 1NF4A 1JI4A 3M6JA 4AM2A 3E2CA 5FFEA 1L8HA 2RBDA 3F36A 2CLUA 3HIUA 4PG0A 3PW1B 3T9JA 3HL1A 4KVSA 4DYUA 2FKZA 3AF9X 3H7GA 4ITTA 4RC6A 3Q4OA 3PWFA 4KXRB 3SIDA 3E1OA 4X0JA 3UOFA 3F35A 3C1ZA 3F38A 2V2PA 1S3QA 3OJ5A 4LQNA 2FG4A 4P18A 2ZA8A 1O9IA 1RCDA 3PVTB 4MJYA 5ERJA 2V2SA 1JKUA 3QB9A 2HR5A 5FFCA 2IU2A 3AJQA 3PVYB 5I4JA 3SH6A 2Z6MA 1BG7A 4ZTTA 5D8OA 1F30A 4DYYA 5HJFA 4DYXA 3C1YA 1O9RA 3VVAA 2FZFA 1ZS3A 4E6KA 4TOGA 1QGHA 1TK6A 1TKOA 3R2HA 1YV1A 3PVRB 2YW6A 4RC8A 1B71A 3R2KA 3KA4A 4LYXA 5LG2A 2W0OA 5GU2X 1JIGA 4PGKA 3FI6A 1OTKA 1DATA 2IY4A 2BJYA 2G4HA 3KA8A 4XGSA 1XZ3A 3AF8X 1HRSA 1RCEA 2N02A 1JTSA 1LKPA 3E6RA 2QQYA 2WTLA 1LKMA 2MGYA 4DZ0A 5D8RA 4RC6B 2JD70 1S30A 4II4A 4LQHA 4U3GA 1NFVA 2V2NA 2V2LA 2CN6A 4ZKWA 1R03A 2V15A 2F7NA 3QVDA 3ERZA 3PW8A 3UOIA 2Z5RA 2D5KA 2XGWA 3VNXA 2C2FA 3QZ3A 2VXXA 4YVZA 2V2RA 3BVIA 4DE6A 3N6OA 5GOUA 4Z5SA 2IB0A 1GWGA 4TOFA 2JD80 2Z90A 2XKQA 2V8TA 2Y44A 3R2OA 5J93A 4W4LB 1YUXA 1RYTA 1IESA 3PZAA 3RD0A 4LQJA 5D8SA 3UFBA 2XJNA 3WVVA 2GS4A 3KX9A 2C2UA 1AEWA 5LBHA 1JGCA 2Z5PA 2C2JA 3O7SA 4CMYV 4CMYA 2YJKA 1F33A 2CHIA 2ZG9X 4IWJA 1BFRA 4TOEA 3JZAB 1LB3A 3AJOA 4RC5A 5FFDA 3KA6A 4TOAA 5E1UA 3ISFA 1VELA 3QHBA 1MOJA 5GN8A 3A68A 4AM5A 3SE1A 4PGIA 1QYBA 1VEIA 4EVDA 5D8PA 2WLUA 2ZA7A 1JKVA 1Z6OM 4II4B 2XJOA 5JKMG 1VEQA 2CF7A 2UX1A 4YKHA 4CYAA 2ZURX 2WWXB 2YW7A 4CVTA 3Q4QA 1RCIA 1FHAA 4DASA 1UVHA 4R42A 5JACA 3F37A 2OH3A 4TOBA 5D8QA 3C23A 3ES3A 4MKUA 4PG1A 5CZUA 4AM4A 2C6RA 3FRRA 1TKPA 3PW8C 3Q4NA 2FL0A 3RBCA 5LS9A 3PWQA 4CVPA 1DVBA 2YJJA 4ZLWA 4KVRA 3VV9A 1EUMA 4M35A 3OGHA 5LG8A 2FG8A 3F39A 1RCGA 3WVUA 3RE7A 1BCFA 3IS8A 2V8UA 3ISEA 1LKOA 1N1QA 4A25A 4RC5B 5ERKA 1MFRA 3O7RA 2Z5QA 5GN8B 4YXMA 4MN9A 3F33A 3L0MA 4YXJA 3LKDA 4REUA 3NOZX 3UNOA 3F32A 3KDQA 3NP2X 2BKCA 4IWKA 3GGYA 3RGDA 3WVWA 5JKLA 1JREA 3E1LA 3FVBA 3MPSA 4ZL5A 2V2IA 5GU0X 2X170 3FRSA 1Z4AA 3R2LA 3E1QA 4XKTA 4Z3BA 4ISPA 4LPJA 4M32A 2ZA6A 3EZUA 3GHQA 2HTNA 2G38B 4DI0A 3BKNA 4LPNA 2VXIA 3GE4A 3GGZA 3IS7A 5D8YA 4ISMA 4M34A 3FSEA 5JDOA 1SOFA 3D19A 4WJG4 4W4KB 2CHPA 1XZ1A 4DYZA 1SQ3A 3EZ0A 2V2OA 4Y08A 5HU6D 4TO9A 2V2MA 3QHCA 1ZUJA 3QD8A 5GU3X 1H96A 2QF9A 4MY7A 5CMQA 3Q4RA 3U90A 2FHAA 5JKMA 3E1JA 1JI5A 1Z6OA 4CVRA 3RAVA 3BVEA 3PWQC 3BVFA 1J30A 3DBYA 5J8SA 2GYQA 2OKCA 4M33A 5J8WA 2JD60 5AXSA 5C6FA 4ZJKA 3KWOA 5HQOA 1NNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YUZ A;  4KVQ A;  4TOC A;  2GYD A;  3SHX A;  3KA3 A;  4ERU A;  4LQV A;  2CLB A;  4EVE A;  3IQ1 A;  5FFA A;  3F34 A;  2FFX J;  2C41 A;  5D8X A;  4OYN A;  2CN7 A;  3WNW A;  4RC7 A;  3AJP A;  4MUD A;  4QUW A;  5J9V A;  3R2M A;  2CIH A;  2Y3Q A;  4EVC A;  3AF7 X;  3BVK A;  4ETR A;  3PW1 A;  4ZMC A;  4IXK A;  4ML5 A;  3AK9 A;  1IER A;  1S2Z A;  3E6S A;  2FJC A;  4XKU A;  1TJO A;  1JYB A;  1DPS A;  4ZL6 A;  1NF6 A;  1KRQ A;  2PYB A;  3E1N A;  4ZKH A;  3GVY A;  4TOD A;  3PVT A;  3BVL A;  1VJX A;  3EGM A;  3KA9 A;  2VZB A;  2WLA A;  5K52 A;  2BW1 A;  2OC5 A;  2ZG8 X;  3NP0 X;  5HJH A;  3R2R A;  5FEJ A;  5FFB A;  3PVY A;  1L8I A;  3R2S A;  1VLG A;  3BT5 A;  5CMR A;  4ITW A;  4CYB A;  5K53 A;  3E1M A;  5E2D A;  2BK6 A;  3TA8 A;  2ITB A;  2CEI A;  3E1P A;  4CY9 A;  3PVR A;  4XKS A;  2ZG7 X;  5JKL G;  3KXU A;  4ZKX A;  4EVB A;  5IX6 A;  4CVS A;  2XJM A;  4TOH A;  4LPM A;  4LYU A;  4RC7 B;  1UMN A;  3AK8 A;  4TW3 A;  5GU1 X;  2V2J A;  1RCC A;  3A9Q A;  1NF4 A;  1JI4 A;  4AM2 A;  3E2C A;  5FFE A;  1L8H A;  2RBD A;  3F36 A;  2CLU A;  3HIU A;  4PG0 A;  3PW1 B;  3T9J A;  3HL1 A;  4KVS A;  4DYU A;  2FKZ A;  3AF9 X;  3H7G A;  4ITT A;  4RC6 A;  3Q4O A;  3PWF A;  3SID A;  3E1O A;  3UOF A;  3F35 A;  3F38 A;  2V2P A;  1S3Q A;  3OJ5 A;  4LQN A;  2FG4 A;  4P18 A;  2ZA8 A;  1O9I A;  1RCD A;  3PVT B;  4MJY A;  5ERJ A;  2V2S A;  1JKU A;  3QB9 A;  2HR5 A;  5FFC A;  2IU2 A;  3AJQ A;  3PVY B;  5I4J A;  3SH6 A;  2Z6M A;  1BG7 A;  4ZTT A;  5D8O A;  1F30 A;  4DYY A;  5HJF A;  4DYX A;  1O9R A;  2FZF A;  1ZS3 A;  4E6K A;  4TOG A;  1QGH A;  1TK6 A;  1TKO A;  3R2H A;  1YV1 A;  3PVR B;  2YW6 A;  4RC8 A;  1B71 A;  3R2K A;  3KA4 A;  4LYX A;  5LG2 A;  2W0O A;  5GU2 X;  1JIG A;  4PGK A;  3FI6 A;  1OTK A;  1DAT A;  2IY4 A;  2BJY A;  2G4H A;  3KA8 A;  4XGS A;  1XZ3 A;  3AF8 X;  1HRS A;  1RCE A;  1JTS A;  1LKP A;  3E6R A;  2QQY A;  2WTL A;  1LKM A;  4DZ0 A;  5D8R A;  4RC6 B;  2JD7 0;  1S30 A;  4II4 A;  4LQH A;  4U3G A;  1NFV A;  2V2N A;  2V2L A;  2CN6 A;  4ZKW A;  1R03 A;  2V15 A;  2F7N A;  3QVD A;  3ERZ A;  3PW8 A;  3UOI A;  2Z5R A;  2D5K A;  2XGW A;  3VNX A;  2C2F A;  3QZ3 A;  2VXX A;  2V2R A;  3BVI A;  4DE6 A;  5GOU A;  4Z5S A;  2IB0 A;  1GWG A;  4TOF A;  2JD8 0;  2Z90 A;  2XKQ A;  5J93 A;  3R2O A;  1YUX A;  1RYT A;  1IES A;  3PZA A;  3RD0 A;  4LQJ A;  5D8S A;  2XJN A;  3WVV A;  2GS4 A;  3KX9 A;  2C2U A;  1AEW A;  5LBH A;  1JGC A;  2Z5P A;  2C2J A;  3O7S A;  4CMY V;  4CMY A;  2YJK A;  1F33 A;  2CHI A;  2ZG9 X;  4IWJ A;  1BFR A;  4TOE A;  1LB3 A;  3AJO A;  4RC5 A;  5FFD A;  3KA6 A;  4TOA A;  5E1U A;  3ISF A;  1VEL A;  3QHB A;  1MOJ A;  5GN8 A;  3A68 A;  4AM5 A;  3SE1 A;  4PGI A;  1QYB A;  1VEI A;  4EVD A;  5D8P A;  2WLU A;  2ZA7 A;  1JKV A;  1Z6O M;  4II4 B;  2XJO A;  5JKM G;  1VEQ A;  2CF7 A;  2UX1 A;  4YKH A;  4CYA A;  2ZUR X;  2YW7 A;  4CVT A;  3Q4Q A;  1RCI A;  1FHA A;  4DAS A;  1UVH A;  4R42 A;  5JAC A;  3F37 A;  2OH3 A;  4TOB A;  5D8Q A;  3ES3 A;  4MKU A;  4PG1 A;  5CZU A;  4AM4 A;  2C6R A;  1TKP A;  3PW8 C;  3Q4N A;  2FL0 A;  3RBC A;  5LS9 A;  3PWQ A;  4CVP A;  1DVB A;  2YJJ A;  4ZLW A;  4KVR A;  1EUM A;  4M35 A;  3OGH A;  5LG8 A;  2FG8 A;  3F39 A;  1RCG A;  3WVU A;  3RE7 A;  1BCF A;  3IS8 A;  3ISE A;  1LKO A;  1N1Q A;  4A25 A;  4RC5 B;  5ERK A;  1MFR A;  3O7R A;  2Z5Q A;  5GN8 B;  4MN9 A;  3F33 A;  4REU A;  3NOZ X;  3UNO A;  3F32 A;  4IWK A;  3NP2 X;  2BKC A;  3RGD A;  3WVW A;  5JKL A;  1JRE A;  3E1L A;  3FVB A;  3MPS A;  4ZL5 A;  2V2I A;  5GU0 X;  2X17 0;  1Z4A A;  3R2L A;  3E1Q A;  4XKT A;  4Z3B A;  4M32 A;  4ISP A;  4LPJ A;  2ZA6 A;  3EZU A;  3GHQ A;  2HTN A;  4DI0 A;  3BKN A;  4LPN A;  2VXI A;  3GE4 A;  3IS7 A;  5D8Y A;  4ISM A;  4M34 A;  3FSE A;  1SOF A;  2CHP A;  1XZ1 A;  4DYZ A;  1SQ3 A;  3EZ0 A;  2V2O A;  4Y08 A;  4TO9 A;  2V2M A;  3QHC A;  1ZUJ A;  3QD8 A;  5GU3 X;  1H96 A;  2QF9 A;  4MY7 A;  5CMQ A;  3Q4R A;  3U90 A;  2FHA A;  5JKM A;  3E1J A;  1JI5 A;  1Z6O A;  4CVR A;  3RAV A;  3BVE A;  3PWQ C;  3BVF A;  1J30 A;  5J8S A;  2GYQ A;  4M33 A;  5J8W A;  2JD6 0;  5AXS A;  5C6F A;  4ZJK A;  3KWO A;  5HQO A;  1NNQ A; 
#chains in the Genus database with same CATH topology
 1YUZ A;  4KVQ A;  4TOC A;  2GYD A;  3SHX A;  3KA3 A;  2CWL A;  4ERU A;  4LQV A;  2CLB A;  4EVE A;  3C21 A;  3IQ1 A;  5FFA A;  3F34 A;  2FFX J;  2C41 A;  5D8X A;  4OYN A;  2CN7 A;  3KHK A;  4E40 A;  3WNW A;  4RC7 A;  3AJP A;  3V3K B;  4MUD A;  4QUW A;  5J9V A;  3R2M A;  2CIH A;  2Y3Q A;  4EVC A;  5JDO B;  3AF7 X;  3BVK A;  4ETR A;  3PW1 A;  4MXP A;  4ZMC A;  4IXK A;  4ML5 A;  3AK9 A;  1IER A;  1S2Z A;  3E6S A;  2FJC A;  3JZ9 A;  4XKU A;  1TJO A;  1JYB A;  1DPS A;  4ZL6 A;  3W54 A;  1NF6 A;  1KRQ A;  2PYB A;  3E1N A;  4ZKH A;  3GVY A;  4TOD A;  3PVT A;  3BVL A;  1VJX A;  3EGM A;  3KA9 A;  2VZB A;  2WLA A;  5K52 A;  2BW1 A;  2OC5 A;  2ZG8 X;  3NP0 X;  5HJH A;  3R2R A;  2AR0 A;  5FEJ A;  5FFB A;  3PVY A;  1L8I A;  3R2S A;  1VLG A;  3BT5 A;  5CMR A;  4ITW A;  4CYB A;  5K53 A;  3E1M A;  5E2D A;  2BK6 A;  3TA8 A;  2ITB A;  2CEI A;  3E1P A;  4CY9 A;  3PVR A;  4XKS A;  2ZG7 X;  5JKL G;  3KXU A;  4ZKX A;  4EVB A;  5IX6 A;  4CVS A;  2XJM A;  4TOH A;  4LPM A;  4LYU A;  4RC7 B;  1UMN A;  3AK8 A;  4TW3 A;  5GU1 X;  2V2J A;  1RCC A;  3A9Q A;  1NF4 A;  1JI4 A;  3M6J A;  4AM2 A;  3E2C A;  5FFE A;  1L8H A;  2RBD A;  3F36 A;  2CLU A;  3HIU A;  4PG0 A;  3PW1 B;  3T9J A;  3HL1 A;  4KVS A;  4DYU A;  2FKZ A;  3AF9 X;  3H7G A;  4ITT A;  4RC6 A;  3Q4O A;  3PWF A;  4KXR B;  3SID A;  3E1O A;  4X0J A;  3UOF A;  3F35 A;  3C1Z A;  3F38 A;  2V2P A;  1S3Q A;  3OJ5 A;  4LQN A;  2FG4 A;  4P18 A;  2ZA8 A;  1O9I A;  1RCD A;  3PVT B;  4MJY A;  5ERJ A;  2V2S A;  1JKU A;  3QB9 A;  2HR5 A;  5FFC A;  2IU2 A;  3AJQ A;  3PVY B;  5I4J A;  3SH6 A;  2Z6M A;  1BG7 A;  4ZTT A;  5D8O A;  1F30 A;  4DYY A;  5HJF A;  4DYX A;  3C1Y A;  1O9R A;  3VVA A;  2FZF A;  1ZS3 A;  4E6K A;  4TOG A;  1QGH A;  1TK6 A;  1TKO A;  3R2H A;  1YV1 A;  3PVR B;  2YW6 A;  4RC8 A;  1B71 A;  3R2K A;  3KA4 A;  4LYX A;  5LG2 A;  2W0O A;  5GU2 X;  1JIG A;  4PGK A;  3FI6 A;  1OTK A;  1DAT A;  2IY4 A;  2BJY A;  2G4H A;  3KA8 A;  4XGS A;  1XZ3 A;  3AF8 X;  1HRS A;  1RCE A;  2N02 A;  1JTS A;  1LKP A;  3E6R A;  2QQY A;  2WTL A;  1LKM A;  2MGY A;  4DZ0 A;  5D8R A;  4RC6 B;  2JD7 0;  1S30 A;  4II4 A;  4LQH A;  4U3G A;  1NFV A;  2V2N A;  2V2L A;  2CN6 A;  4ZKW A;  1R03 A;  2V15 A;  2F7N A;  3QVD A;  3ERZ A;  3PW8 A;  3UOI A;  2Z5R A;  2D5K A;  2XGW A;  3VNX A;  2C2F A;  3QZ3 A;  2VXX A;  4YVZ A;  2V2R A;  3BVI A;  4DE6 A;  3N6O A;  5GOU A;  4Z5S A;  2IB0 A;  1GWG A;  4TOF A;  2JD8 0;  2Z90 A;  2XKQ A;  2V8T A;  2Y44 A;  3R2O A;  5J93 A;  4W4L B;  1YUX A;  1RYT A;  1IES A;  3PZA A;  3RD0 A;  4LQJ A;  5D8S A;  3UFB A;  2XJN A;  3WVV A;  2GS4 A;  3KX9 A;  2C2U A;  1AEW A;  5LBH A;  1JGC A;  2Z5P A;  2C2J A;  3O7S A;  4CMY V;  4CMY A;  2YJK A;  1F33 A;  2CHI A;  2ZG9 X;  4IWJ A;  1BFR A;  4TOE A;  3JZA B;  1LB3 A;  3AJO A;  4RC5 A;  5FFD A;  3KA6 A;  4TOA A;  5E1U A;  3ISF A;  1VEL A;  3QHB A;  1MOJ A;  5GN8 A;  3A68 A;  4AM5 A;  3SE1 A;  4PGI A;  1QYB A;  1VEI A;  4EVD A;  5D8P A;  2WLU A;  2ZA7 A;  1JKV A;  1Z6O M;  4II4 B;  2XJO A;  5JKM G;  1VEQ A;  2CF7 A;  2UX1 A;  4YKH A;  4CYA A;  2ZUR X;  2WWX B;  2YW7 A;  4CVT A;  3Q4Q A;  1RCI A;  1FHA A;  4DAS A;  1UVH A;  4R42 A;  5JAC A;  3F37 A;  2OH3 A;  4TOB A;  5D8Q A;  3C23 A;  3ES3 A;  4MKU A;  4PG1 A;  5CZU A;  4AM4 A;  2C6R A;  3FRR A;  1TKP A;  3PW8 C;  3Q4N A;  2FL0 A;  3RBC A;  5LS9 A;  3PWQ A;  4CVP A;  1DVB A;  2YJJ A;  4ZLW A;  4KVR A;  3VV9 A;  1EUM A;  4M35 A;  3OGH A;  5LG8 A;  2FG8 A;  3F39 A;  1RCG A;  3WVU A;  3RE7 A;  1BCF A;  3IS8 A;  2V8U A;  3ISE A;  1LKO A;  1N1Q A;  4A25 A;  4RC5 B;  5ERK A;  1MFR A;  3O7R A;  2Z5Q A;  5GN8 B;  4YXM A;  4MN9 A;  3F33 A;  3L0M A;  4YXJ A;  3LKD A;  4REU A;  3NOZ X;  3UNO A;  3F32 A;  3KDQ A;  3NP2 X;  2BKC A;  4IWK A;  3GGY A;  3RGD A;  3WVW A;  5JKL A;  1JRE A;  3E1L A;  3FVB A;  3MPS A;  4ZL5 A;  2V2I A;  5GU0 X;  2X17 0;  3FRS A;  1Z4A A;  3R2L A;  3E1Q A;  4XKT A;  4Z3B A;  4ISP A;  4LPJ A;  4M32 A;  2ZA6 A;  3EZU A;  3GHQ A;  2HTN A;  2G38 B;  4DI0 A;  3BKN A;  4LPN A;  2VXI A;  3GE4 A;  3GGZ A;  3IS7 A;  5D8Y A;  4ISM A;  4M34 A;  3FSE A;  5JDO A;  1SOF A;  3D19 A;  4WJG 4;  4W4K B;  2CHP A;  1XZ1 A;  4DYZ A;  1SQ3 A;  3EZ0 A;  2V2O A;  4Y08 A;  5HU6 D;  4TO9 A;  2V2M A;  3QHC A;  1ZUJ A;  3QD8 A;  5GU3 X;  1H96 A;  2QF9 A;  4MY7 A;  5CMQ A;  3Q4R A;  3U90 A;  2FHA A;  5JKM A;  3E1J A;  1JI5 A;  1Z6O A;  4CVR A;  3RAV A;  3BVE A;  3PWQ C;  3BVF A;  1J30 A;  3DBY A;  5J8S A;  2GYQ A;  2OKC A;  4M33 A;  5J8W A;  2JD6 0;  5AXS A;  5C6F A;  4ZJK A;  3KWO A;  5HQO A;  1NNQ A; 
#chains in the Genus database with same CATH homology
 1YUZ A;  4KVQ A;  4TOC A;  2GYD A;  3SHX A;  3KA3 A;  2CWL A;  4ERU A;  4LQV A;  2CLB A;  4EVE A;  3C21 A;  3IQ1 A;  5FFA A;  3F34 A;  2FFX J;  2C41 A;  5D8X A;  4OYN A;  2CN7 A;  3KHK A;  4E40 A;  3WNW A;  4RC7 A;  3AJP A;  3V3K B;  4MUD A;  4QUW A;  5J9V A;  3R2M A;  2CIH A;  2Y3Q A;  4EVC A;  5JDO B;  3AF7 X;  3BVK A;  4ETR A;  3PW1 A;  4MXP A;  4ZMC A;  4IXK A;  4ML5 A;  3AK9 A;  1IER A;  1S2Z A;  3E6S A;  2FJC A;  3JZ9 A;  4XKU A;  1TJO A;  1JYB A;  1DPS A;  4ZL6 A;  3W54 A;  1NF6 A;  1KRQ A;  2PYB A;  3E1N A;  4ZKH A;  3GVY A;  4TOD A;  3PVT A;  3BVL A;  1VJX A;  3EGM A;  3KA9 A;  2VZB A;  2WLA A;  5K52 A;  2BW1 A;  2OC5 A;  2ZG8 X;  3NP0 X;  5HJH A;  3R2R A;  2AR0 A;  5FEJ A;  5FFB A;  3PVY A;  1L8I A;  3R2S A;  1VLG A;  3BT5 A;  5CMR A;  4ITW A;  4CYB A;  5K53 A;  3E1M A;  5E2D A;  2BK6 A;  3TA8 A;  2ITB A;  2CEI A;  3E1P A;  4CY9 A;  3PVR A;  4XKS A;  2ZG7 X;  5JKL G;  3KXU A;  4ZKX A;  4EVB A;  5IX6 A;  4CVS A;  2XJM A;  4TOH A;  4LPM A;  4LYU A;  4RC7 B;  1UMN A;  3AK8 A;  4TW3 A;  5GU1 X;  2V2J A;  1RCC A;  3A9Q A;  1NF4 A;  1JI4 A;  3M6J A;  4AM2 A;  3E2C A;  5FFE A;  1L8H A;  2RBD A;  3F36 A;  2CLU A;  3HIU A;  4PG0 A;  3PW1 B;  3T9J A;  3HL1 A;  4KVS A;  4DYU A;  2FKZ A;  3AF9 X;  3H7G A;  4ITT A;  4RC6 A;  3Q4O A;  3PWF A;  4KXR B;  3SID A;  3E1O A;  4X0J A;  3UOF A;  3F35 A;  3C1Z A;  3F38 A;  2V2P A;  1S3Q A;  3OJ5 A;  4LQN A;  2FG4 A;  4P18 A;  2ZA8 A;  1O9I A;  1RCD A;  3PVT B;  4MJY A;  5ERJ A;  2V2S A;  1JKU A;  3QB9 A;  2HR5 A;  5FFC A;  2IU2 A;  3AJQ A;  3PVY B;  5I4J A;  3SH6 A;  2Z6M A;  1BG7 A;  4ZTT A;  5D8O A;  1F30 A;  4DYY A;  5HJF A;  4DYX A;  3C1Y A;  1O9R A;  3VVA A;  2FZF A;  1ZS3 A;  4E6K A;  4TOG A;  1QGH A;  1TK6 A;  1TKO A;  3R2H A;  1YV1 A;  3PVR B;  2YW6 A;  4RC8 A;  1B71 A;  3R2K A;  3KA4 A;  4LYX A;  5LG2 A;  2W0O A;  5GU2 X;  1JIG A;  4PGK A;  3FI6 A;  1OTK A;  1DAT A;  2IY4 A;  2BJY A;  2G4H A;  3KA8 A;  4XGS A;  1XZ3 A;  3AF8 X;  1HRS A;  1RCE A;  2N02 A;  1JTS A;  1LKP A;  3E6R A;  2QQY A;  2WTL A;  1LKM A;  2MGY A;  4DZ0 A;  5D8R A;  4RC6 B;  2JD7 0;  1S30 A;  4II4 A;  4LQH A;  4U3G A;  1NFV A;  2V2N A;  2V2L A;  2CN6 A;  4ZKW A;  1R03 A;  2V15 A;  2F7N A;  3QVD A;  3ERZ A;  3PW8 A;  3UOI A;  2Z5R A;  2D5K A;  2XGW A;  3VNX A;  2C2F A;  3QZ3 A;  2VXX A;  4YVZ A;  2V2R A;  3BVI A;  4DE6 A;  3N6O A;  5GOU A;  4Z5S A;  2IB0 A;  1GWG A;  4TOF A;  2JD8 0;  2Z90 A;  2XKQ A;  2V8T A;  2Y44 A;  3R2O A;  5J93 A;  4W4L B;  1YUX A;  1RYT A;  1IES A;  3PZA A;  3RD0 A;  4LQJ A;  5D8S A;  3UFB A;  2XJN A;  3WVV A;  2GS4 A;  3KX9 A;  2C2U A;  1AEW A;  5LBH A;  1JGC A;  2Z5P A;  2C2J A;  3O7S A;  4CMY V;  4CMY A;  2YJK A;  1F33 A;  2CHI A;  2ZG9 X;  4IWJ A;  1BFR A;  4TOE A;  3JZA B;  1LB3 A;  3AJO A;  4RC5 A;  5FFD A;  3KA6 A;  4TOA A;  5E1U A;  3ISF A;  1VEL A;  3QHB A;  1MOJ A;  5GN8 A;  3A68 A;  4AM5 A;  3SE1 A;  4PGI A;  1QYB A;  1VEI A;  4EVD A;  5D8P A;  2WLU A;  2ZA7 A;  1JKV A;  1Z6O M;  4II4 B;  2XJO A;  5JKM G;  1VEQ A;  2CF7 A;  2UX1 A;  4YKH A;  4CYA A;  2ZUR X;  2WWX B;  2YW7 A;  4CVT A;  3Q4Q A;  1RCI A;  1FHA A;  4DAS A;  1UVH A;  4R42 A;  5JAC A;  3F37 A;  2OH3 A;  4TOB A;  5D8Q A;  3C23 A;  3ES3 A;  4MKU A;  4PG1 A;  5CZU A;  4AM4 A;  2C6R A;  3FRR A;  1TKP A;  3PW8 C;  3Q4N A;  2FL0 A;  3RBC A;  5LS9 A;  3PWQ A;  4CVP A;  1DVB A;  2YJJ A;  4ZLW A;  4KVR A;  3VV9 A;  1EUM A;  4M35 A;  3OGH A;  5LG8 A;  2FG8 A;  3F39 A;  1RCG A;  3WVU A;  3RE7 A;  1BCF A;  3IS8 A;  2V8U A;  3ISE A;  1LKO A;  1N1Q A;  4A25 A;  4RC5 B;  5ERK A;  1MFR A;  3O7R A;  2Z5Q A;  5GN8 B;  4YXM A;  4MN9 A;  3F33 A;  3L0M A;  4YXJ A;  3LKD A;  4REU A;  3NOZ X;  3UNO A;  3F32 A;  3KDQ A;  3NP2 X;  2BKC A;  4IWK A;  3GGY A;  3RGD A;  3WVW A;  5JKL A;  1JRE A;  3E1L A;  3FVB A;  3MPS A;  4ZL5 A;  2V2I A;  5GU0 X;  2X17 0;  3FRS A;  1Z4A A;  3R2L A;  3E1Q A;  4XKT A;  4Z3B A;  4ISP A;  4LPJ A;  4M32 A;  2ZA6 A;  3EZU A;  3GHQ A;  2HTN A;  2G38 B;  4DI0 A;  3BKN A;  4LPN A;  2VXI A;  3GE4 A;  3GGZ A;  3IS7 A;  5D8Y A;  4ISM A;  4M34 A;  3FSE A;  5JDO A;  1SOF A;  3D19 A;  4WJG 4;  4W4K B;  2CHP A;  1XZ1 A;  4DYZ A;  1SQ3 A;  3EZ0 A;  2V2O A;  4Y08 A;  5HU6 D;  4TO9 A;  2V2M A;  3QHC A;  1ZUJ A;  3QD8 A;  5GU3 X;  1H96 A;  2QF9 A;  4MY7 A;  5CMQ A;  3Q4R A;  3U90 A;  2FHA A;  5JKM A;  3E1J A;  1JI5 A;  1Z6O A;  4CVR A;  3RAV A;  3BVE A;  3PWQ C;  3BVF A;  1J30 A;  3DBY A;  5J8S A;  2GYQ A;  2OKC A;  4M33 A;  5J8W A;  2JD6 0;  5AXS A;  5C6F A;  4ZJK A;  3KWO A;  5HQO A;  1NNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...