3BVIA

Structural basis for the iron uptake mechanism of helicobacter pylori ferritin
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
172
structure length
172
Chain Sequence
HHSQDPMLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIIFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ferritin
publication title Structural basis for the iron uptake mechanism of Helicobacter pylori ferritin
rcsb
source organism Helicobacter pylori
total genus 77
structure length 172
sequence length 172
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.16.3.2: Bacterial non-heme ferritin.
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3bviA00
2VXXA 5HQOA 2WTLA 3E1PA 1JYBA 2IB0A 4U3GA 4RC5B 2VZBA 1LKMA 1L8HA 4ISPA 4IXKA 2BKCA 4MUDA 2Z5PA 4DZ0A 1YUZA 4LQHA 3BVKA 3GVYA 4TOEA 1Z6OM 4DYZA 5GU3X 5CMRA 5I4JA 5D8PA 1DATA 1XZ3A 4IWKA 2G4HA 1R03A 3NP2X 3AF9X 3R2HA 4QUWA 4TW3A 3R2MA 5FEJA 1RCGA 3RD0A 4LQJA 5J8WA 4A25A 2V2MA 2CEIA 2QQYA 2WLUA 3Q4OA 1YV1A 1DPSA 2JD80 3SIDA 4ZL5A 2XJMA 3GHQA 1O9RA 5JKLA 1XZ1A 4XKUA 3BVLA 2CF7A 1QYBA 4CYAA 5D8OA 2FFXJ 5AXSA 3ES3A 4KVRA 3MPSA 2ZA7A 4RC7B 1KRQA 2CLBA 4R42A 3BVFA 3AF7X 2Z6MA 3F34A 3F39A 4ML5A 3U90A 1LKPA 1NFVA 2Y3QA 1VEIA 2YW6A 4DYUA 3WVWA 3ISFA 3IS8A 5GU1X 3SHXA 2XGWA 1S3QA 3IQ1A 3KA6A 2XJOA 5FFDA 1OTKA 4Z5SA 3KA4A 5HJHA 2FKZA 2VXIA 3HIUA 1JIGA 5D8QA 4LPNA 2CLUA 3E6SA 3F32A 1TKPA 3F33A 4LQVA 3NP0X 2XJNA 1UMNA 2OC5A 2FZFA 4PGIA 3F36A 3Q4NA 3FSEA 5E2DA 4TOHA 4REUA 5GN8B 1VELA 2IU2A 4P18A 4Z3BA 3IS7A 3E6RA 3Q4RA 4PGKA 5JKLG 1AEWA 1JTSA 4ISMA 3PW8C 1VLGA 2C2UA 3HL1A 4OYNA 3AF8X 3R2OA 4M33A 3PVTB 4AM2A 4YKHA 3R2LA 3RGDA 4XKTA 1IESA 3A9QA 5C6FA 5D8SA 5JKMA 5CMQA 4TODA 3AJQA 2JD70 3KWOA 2ZG7X 4LYXA 4MN9A 4CMYV 5FFBA 3ISEA 3PZAA 3E1OA 3E1MA 3PVYB 4DYXA 5LS9A 3F35A 2BW1A 4MJYA 1EUMA 3E1JA 1SQ3A 3VNXA 5K53A 1LB3A 3PWQC 4RC8A 4ZL6A 4CVSA 4TOCA 5ERKA 1RCIA 3R2KA 1ZS3A 3AK9A 1BFRA 1B71A 4TOBA 3SH6A 1J30A 3PW1B 3Q4QA 2UX1A 4EVBA 4RC6A 1F30A 2C2FA 3QHBA 3PVRB 5JACA 4M34A 5D8YA 4XKSA 2V2NA 2GS4A 1VJXA 3QVDA 3QHCA 2F7NA 1NF4A 1NNQA 5GU2X 3PWQA 5GU0X 4RC5A 3WNWA 1BCFA 1RCCA 2GYDA 3BVEA 2FHAA 2JD60 3AK8A 3E1LA 3PWFA 2ZURX 4E6KA 3OGHA 5E1UA 3FVBA 4ZTTA 3AJOA 3E2CA 2BK6A 4DI0A 1GWGA 3GE4A 4M32A 3KXUA 3UNOA 2W0OA 3KA3A 4ZKHA 4EVCA 3O7SA 5JKMG 4II4B 3BT5A 5J8SA 2V2JA 3BKNA 2X170 4CVPA 3NOZX 3F37A 5J9VA 3PVYA 1RCDA 2V2OA 1TK6A 3A68A 1TKOA 1Z6OA 1YUXA 5HJFA 4EVEA 1MOJA 5CZUA 4MKUA 4M35A 1JKVA 4RC7A 1O9IA 3KA9A 3R2SA 4PG0A 4ZLWA 4CVTA 3BVIA 4ZMCA 1IERA 4ZKWA 4ZKXA 4EVDA 4PG1A 3PW1A 3KA8A 5D8RA 2V2SA 2C41A 4AM5A 3E1NA 3ERZA 1FHAA 3PVRA 5FFAA 1H96A 1RYTA 1Z4AA 2ZG9X 3E1QA 4MY7A 4TOAA 2FG4A 2Z5RA 3WVVA 4CY9A 2RBDA 3WVUA 4ETRA 3PW8A 3EZ0A 3KX9A 2QF9A 5LG2A 2V2IA 4DASA 4LPJA 5LG8A 2V2PA 1QGHA 5J93A 2IY4A 4KVQA 2CN6A 5LBHA 2Z5QA 2FL0A 4DE6A 4KVSA 3EZUA 2V2LA 5FFCA 4CMYA 2FG8A 4II4A 4XGSA 1HRSA 2ZA8A 4ZJKA 4CVRA 4TOFA 2ITBA 1ZUJA 2YJJA 5IX6A 4TOGA 5GN8A 3QZ3A 3RE7A 2XKQA 1SOFA 3UOFA 4ITWA 2YW7A 1N1QA 2OH3A 3RAVA 1LKOA 5K52A 3UOIA 3H7GA 3RBCA 3OJ5A 2PYBA 1JI5A 1NF6A 4ITTA 3PVTA 3T9JA 2CHPA 5D8XA 2C6RA 4AM4A 2ZG8X 4TO9A 5ERJA 3AJPA 2HTNA 1DVBA 1TJOA 2Z90A 3F38A 4CYBA 3SE1A 1VEQA 2D5KA 3FI6A 3QD8A 2CIHA 5FFEA 2WLAA 1UVHA 2CN7A 2V15A 1S30A 4Y08A 3EGMA 3O7RA 2GYQA 4LYUA 4DYYA 2BJYA 2V2RA 2HR5A 1L8IA 2FJCA 4LPMA 1BG7A 4IWJA 1F33A 1S2ZA 4ERUA 1JKUA 1RCEA 4LQNA 2C2JA 1JGCA 2CHIA 3R2RA 3QB9A 2YJKA 4RC6B 5GOUA 1JREA 1JI4A 1MFRA 2ZA6A 3TA8A
chains in the Genus database with same CATH superfamily
2VXXA 5HQOA 2WTLA 3N6OA 3E1PA 1JYBA 2IB0A 4U3GA 4RC5B 2VZBA 1LKMA 1L8HA 4ISPA 4IXKA 2BKCA 4MUDA 2Z5PA 4DZ0A 1YUZA 4LQHA 3BVKA 3GVYA 4TOEA 1Z6OM 4DYZA 5GU3X 5CMRA 5I4JA 5D8PA 1DATA 1XZ3A 2G38B 4IWKA 2G4HA 2V8TA 1R03A 3NP2X 3AF9X 3R2HA 4QUWA 4TW3A 3R2MA 5FEJA 1RCGA 3RD0A 4LQJA 5J8WA 4A25A 2V2MA 2CEIA 2QQYA 2Y44A 2WLUA 3Q4OA 1YV1A 1DPSA 2JD80 3SIDA 4ZL5A 2XJMA 3GHQA 1O9RA 2V8UA 5JKLA 1XZ1A 4XKUA 3BVLA 4KXRB 2CF7A 1QYBA 4CYAA 5D8OA 2FFXJ 5AXSA 3ES3A 4YXJA 4KVRA 3MPSA 2ZA7A 4RC7B 1KRQA 2CLBA 4R42A 3BVFA 3AF7X 2Z6MA 3F34A 3F39A 2MGYA 4ML5A 3U90A 1LKPA 1NFVA 2Y3QA 3VVAA 1VEIA 2YW6A 4DYUA 3DBYA 4WJG4 5JDOA 3WVWA 3ISFA 3IS8A 5GU1X 3SHXA 2XGWA 1S3QA 3IQ1A 3KA6A 2XJOA 5FFDA 1OTKA 4Z5SA 3KA4A 5HJHA 2FKZA 2VXIA 3HIUA 3FRRA 4YVZA 1JIGA 5D8QA 4LPNA 2CLUA 3E6SA 3F32A 1TKPA 3F33A 4LQVA 3NP0X 2XJNA 3JZAB 1UMNA 2OC5A 2FZFA 4PGIA 3F36A 3Q4NA 3FSEA 5E2DA 4TOHA 4W4LB 3VV9A 4REUA 5GN8B 1VELA 2IU2A 4P18A 4Z3BA 3IS7A 3E6RA 3Q4RA 4PGKA 5JKLG 1AEWA 1JTSA 4ISMA 3PW8C 1VLGA 2C2UA 3HL1A 4OYNA 3AF8X 3R2OA 4M33A 3PVTB 3W54A 4AM2A 4YKHA 2N02A 3R2LA 3RGDA 3FRSA 4XKTA 1IESA 3A9QA 5C6FA 2AR0A 5D8SA 5JKMA 5CMQA 3KHKA 4TODA 3AJQA 2JD70 3KWOA 4MXPA 4W4KB 2ZG7X 4LYXA 4MN9A 4CMYV 5FFBA 3ISEA 3PZAA 3E1OA 3E1MA 3PVYB 3LKDA 4DYXA 5LS9A 3F35A 2BW1A 3D19A 4MJYA 1EUMA 3E1JA 1SQ3A 3VNXA 5K53A 1LB3A 3PWQC 4RC8A 4ZL6A 3GGZA 4CVSA 4TOCA 5ERKA 1RCIA 4X0JA 3R2KA 1ZS3A 3AK9A 1BFRA 1B71A 4TOBA 3SH6A 1J30A 3PW1B 3Q4QA 2UX1A 4EVBA 4RC6A 1F30A 2C2FA 3QHBA 3PVRB 5JACA 4M34A 5D8YA 4XKSA 2V2NA 2GS4A 1VJXA 3QVDA 3QHCA 2F7NA 1NF4A 1NNQA 5GU2X 3PWQA 5GU0X 4RC5A 3WNWA 1BCFA 1RCCA 2GYDA 3BVEA 2FHAA 2JD60 3AK8A 3E1LA 3PWFA 2ZURX 4E6KA 3OGHA 5E1UA 4E40A 3FVBA 4ZTTA 3AJOA 3E2CA 2BK6A 4DI0A 1GWGA 4YXMA 3GE4A 3V3KB 4M32A 3KXUA 3UNOA 2W0OA 3KA3A 4ZKHA 4EVCA 3O7SA 5JKMG 4II4B 3BT5A 5J8SA 2V2JA 3BKNA 2X170 4CVPA 3NOZX 3F37A 5J9VA 3PVYA 1RCDA 2V2OA 1TK6A 3A68A 1TKOA 1Z6OA 1YUXA 5HJFA 4EVEA 1MOJA 5CZUA 4MKUA 3KDQA 4M35A 3C21A 1JKVA 4RC7A 1O9IA 3KA9A 3M6JA 3R2SA 4PG0A 4ZLWA 4CVTA 3BVIA 4ZMCA 1IERA 4ZKWA 2OKCA 4ZKXA 4EVDA 4PG1A 3PW1A 3KA8A 5D8RA 2V2SA 2C41A 4AM5A 3E1NA 3ERZA 1FHAA 3PVRA 5FFAA 3E1QA 1H96A 1RYTA 1Z4AA 2ZG9X 4MY7A 4TOAA 5JDOB 2FG4A 2Z5RA 3WVVA 4CY9A 2RBDA 3WVUA 4ETRA 3PW8A 3EZ0A 3KX9A 2QF9A 5LG2A 2V2IA 4DASA 4LPJA 5LG8A 2V2PA 1QGHA 5HU6D 5J93A 2IY4A 4KVQA 2CN6A 5LBHA 2Z5QA 2FL0A 4DE6A 3C1YA 4KVSA 3EZUA 2V2LA 5FFCA 4CMYA 2FG8A 4II4A 4XGSA 1HRSA 2ZA8A 4ZJKA 4CVRA 4TOFA 2ITBA 1ZUJA 2YJJA 5IX6A 4TOGA 5GN8A 3QZ3A 3RE7A 2XKQA 1SOFA 3UOFA 3C1ZA 4ITWA 2YW7A 1N1QA 3JZ9A 2OH3A 3RAVA 1LKOA 5K52A 3UOIA 3H7GA 2WWXB 3RBCA 3OJ5A 2PYBA 1JI5A 1NF6A 4ITTA 3PVTA 3T9JA 3C23A 2CHPA 5D8XA 2C6RA 4AM4A 2ZG8X 4TO9A 5ERJA 3AJPA 2HTNA 1DVBA 1TJOA 2Z90A 3F38A 4CYBA 3SE1A 1VEQA 2D5KA 3L0MA 3FI6A 3UFBA 3QD8A 2CIHA 5FFEA 2WLAA 1UVHA 2CN7A 2V15A 1S30A 4Y08A 3EGMA 3O7RA 2GYQA 4LYUA 4DYYA 2BJYA 2V2RA 2HR5A 3GGYA 2CWLA 1L8IA 2FJCA 4LPMA 1BG7A 4IWJA 1F33A 1S2ZA 4ERUA 1JKUA 1RCEA 4LQNA 2C2JA 1JGCA 2CHIA 3R2RA 3QB9A 2YJKA 4RC6B 5GOUA 1JREA 1JI4A 1MFRA 2ZA6A 3TA8A
chains in the Genus database with same CATH topology
2VXXA 5HQOA 2WTLA 3N6OA 3E1PA 1JYBA 2IB0A 4U3GA 4RC5B 2VZBA 1LKMA 1L8HA 4ISPA 4IXKA 2BKCA 4MUDA 2Z5PA 4DZ0A 1YUZA 4LQHA 3BVKA 3GVYA 4TOEA 1Z6OM 4DYZA 5GU3X 5CMRA 5I4JA 5D8PA 1DATA 1XZ3A 2G38B 4IWKA 2G4HA 2V8TA 1R03A 3NP2X 3AF9X 3R2HA 4QUWA 4TW3A 3R2MA 5FEJA 1RCGA 3RD0A 4LQJA 5J8WA 4A25A 2V2MA 2CEIA 2QQYA 2Y44A 2WLUA 3Q4OA 1YV1A 1DPSA 2JD80 3SIDA 4ZL5A 2XJMA 3GHQA 1O9RA 2V8UA 5JKLA 1XZ1A 4XKUA 3BVLA 4KXRB 2CF7A 1QYBA 4CYAA 5D8OA 2FFXJ 5AXSA 3ES3A 4YXJA 4KVRA 3MPSA 2ZA7A 4RC7B 1KRQA 2CLBA 4R42A 3BVFA 3AF7X 2Z6MA 3F34A 3F39A 2MGYA 4ML5A 3U90A 1LKPA 1NFVA 2Y3QA 3VVAA 1VEIA 2YW6A 4DYUA 3DBYA 4WJG4 5JDOA 3WVWA 3ISFA 3IS8A 5GU1X 3SHXA 2XGWA 1S3QA 3IQ1A 3KA6A 2XJOA 5FFDA 1OTKA 4Z5SA 3KA4A 5HJHA 2FKZA 2VXIA 3HIUA 3FRRA 4YVZA 1JIGA 5D8QA 4LPNA 2CLUA 3E6SA 3F32A 1TKPA 3F33A 4LQVA 3NP0X 2XJNA 3JZAB 1UMNA 2OC5A 2FZFA 4PGIA 3F36A 3Q4NA 3FSEA 5E2DA 4TOHA 4W4LB 3VV9A 4REUA 5GN8B 1VELA 2IU2A 4P18A 4Z3BA 3IS7A 3E6RA 3Q4RA 4PGKA 5JKLG 1AEWA 1JTSA 4ISMA 3PW8C 1VLGA 2C2UA 3HL1A 4OYNA 3AF8X 3R2OA 4M33A 3PVTB 3W54A 4AM2A 4YKHA 2N02A 3R2LA 3RGDA 3FRSA 4XKTA 1IESA 3A9QA 5C6FA 2AR0A 5D8SA 5JKMA 5CMQA 3KHKA 4TODA 3AJQA 2JD70 3KWOA 4MXPA 4W4KB 2ZG7X 4LYXA 4MN9A 4CMYV 5FFBA 3ISEA 3PZAA 3E1OA 3E1MA 3PVYB 3LKDA 4DYXA 5LS9A 3F35A 2BW1A 3D19A 4MJYA 1EUMA 3E1JA 1SQ3A 3VNXA 5K53A 1LB3A 3PWQC 4RC8A 4ZL6A 3GGZA 4CVSA 4TOCA 5ERKA 1RCIA 4X0JA 3R2KA 1ZS3A 3AK9A 1BFRA 1B71A 4TOBA 3SH6A 1J30A 3PW1B 3Q4QA 2UX1A 4EVBA 4RC6A 1F30A 2C2FA 3QHBA 3PVRB 5JACA 4M34A 5D8YA 4XKSA 2V2NA 2GS4A 1VJXA 3QVDA 3QHCA 2F7NA 1NF4A 1NNQA 5GU2X 3PWQA 5GU0X 4RC5A 3WNWA 1BCFA 1RCCA 2GYDA 3BVEA 2FHAA 2JD60 3AK8A 3E1LA 3PWFA 2ZURX 4E6KA 3OGHA 5E1UA 4E40A 3FVBA 4ZTTA 3AJOA 3E2CA 2BK6A 4DI0A 1GWGA 4YXMA 3GE4A 3V3KB 4M32A 3KXUA 3UNOA 2W0OA 3KA3A 4ZKHA 4EVCA 3O7SA 5JKMG 4II4B 3BT5A 5J8SA 2V2JA 3BKNA 2X170 4CVPA 3NOZX 3F37A 5J9VA 3PVYA 1RCDA 2V2OA 1TK6A 3A68A 1TKOA 1Z6OA 1YUXA 5HJFA 4EVEA 1MOJA 5CZUA 4MKUA 3KDQA 4M35A 3C21A 1JKVA 4RC7A 1O9IA 3KA9A 3M6JA 3R2SA 4PG0A 4ZLWA 4CVTA 3BVIA 4ZMCA 1IERA 4ZKWA 2OKCA 4ZKXA 4EVDA 4PG1A 3PW1A 3KA8A 5D8RA 2V2SA 2C41A 4AM5A 3E1NA 3ERZA 1FHAA 3PVRA 5FFAA 3E1QA 1H96A 1RYTA 1Z4AA 2ZG9X 4MY7A 4TOAA 5JDOB 2FG4A 2Z5RA 3WVVA 4CY9A 2RBDA 3WVUA 4ETRA 3PW8A 3EZ0A 3KX9A 2QF9A 5LG2A 2V2IA 4DASA 4LPJA 5LG8A 2V2PA 1QGHA 5HU6D 5J93A 2IY4A 4KVQA 2CN6A 5LBHA 2Z5QA 2FL0A 4DE6A 3C1YA 4KVSA 3EZUA 2V2LA 5FFCA 4CMYA 2FG8A 4II4A 4XGSA 1HRSA 2ZA8A 4ZJKA 4CVRA 4TOFA 2ITBA 1ZUJA 2YJJA 5IX6A 4TOGA 5GN8A 3QZ3A 3RE7A 2XKQA 1SOFA 3UOFA 3C1ZA 4ITWA 2YW7A 1N1QA 3JZ9A 2OH3A 3RAVA 1LKOA 5K52A 3UOIA 3H7GA 2WWXB 3RBCA 3OJ5A 2PYBA 1JI5A 1NF6A 4ITTA 3PVTA 3T9JA 3C23A 2CHPA 5D8XA 2C6RA 4AM4A 2ZG8X 4TO9A 5ERJA 3AJPA 2HTNA 1DVBA 1TJOA 2Z90A 3F38A 4CYBA 3SE1A 1VEQA 2D5KA 3L0MA 3FI6A 3UFBA 3QD8A 2CIHA 5FFEA 2WLAA 1UVHA 2CN7A 2V15A 1S30A 4Y08A 3EGMA 3O7RA 2GYQA 4LYUA 4DYYA 2BJYA 2V2RA 2HR5A 3GGYA 2CWLA 1L8IA 2FJCA 4LPMA 1BG7A 4IWJA 1F33A 1S2ZA 4ERUA 1JKUA 1RCEA 4LQNA 2C2JA 1JGCA 2CHIA 3R2RA 3QB9A 2YJKA 4RC6B 5GOUA 1JREA 1JI4A 1MFRA 2ZA6A 3TA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VXX A;  5HQO A;  2WTL A;  3E1P A;  1JYB A;  2IB0 A;  4U3G A;  4RC5 B;  2VZB A;  1LKM A;  1L8H A;  4ISP A;  4IXK A;  2BKC A;  4MUD A;  2Z5P A;  4DZ0 A;  1YUZ A;  4LQH A;  3BVK A;  3GVY A;  4TOE A;  1Z6O M;  4DYZ A;  5GU3 X;  5CMR A;  5I4J A;  5D8P A;  1DAT A;  1XZ3 A;  4IWK A;  2G4H A;  1R03 A;  3NP2 X;  3AF9 X;  3R2H A;  4QUW A;  4TW3 A;  3R2M A;  5FEJ A;  1RCG A;  3RD0 A;  4LQJ A;  5J8W A;  4A25 A;  2V2M A;  2CEI A;  2QQY A;  2WLU A;  3Q4O A;  1YV1 A;  1DPS A;  2JD8 0;  3SID A;  4ZL5 A;  2XJM A;  3GHQ A;  1O9R A;  5JKL A;  1XZ1 A;  4XKU A;  3BVL A;  2CF7 A;  1QYB A;  4CYA A;  5D8O A;  2FFX J;  5AXS A;  3ES3 A;  4KVR A;  3MPS A;  2ZA7 A;  4RC7 B;  1KRQ A;  2CLB A;  4R42 A;  3BVF A;  3AF7 X;  2Z6M A;  3F34 A;  3F39 A;  4ML5 A;  3U90 A;  1LKP A;  1NFV A;  2Y3Q A;  1VEI A;  2YW6 A;  4DYU A;  3WVW A;  3ISF A;  3IS8 A;  5GU1 X;  3SHX A;  2XGW A;  1S3Q A;  3IQ1 A;  3KA6 A;  2XJO A;  5FFD A;  1OTK A;  4Z5S A;  3KA4 A;  5HJH A;  2FKZ A;  2VXI A;  3HIU A;  1JIG A;  5D8Q A;  4LPN A;  2CLU A;  3E6S A;  3F32 A;  1TKP A;  3F33 A;  4LQV A;  3NP0 X;  2XJN A;  1UMN A;  2OC5 A;  2FZF A;  4PGI A;  3F36 A;  3Q4N A;  3FSE A;  5E2D A;  4TOH A;  4REU A;  5GN8 B;  1VEL A;  2IU2 A;  4P18 A;  4Z3B A;  3IS7 A;  3E6R A;  3Q4R A;  4PGK A;  5JKL G;  1AEW A;  1JTS A;  4ISM A;  3PW8 C;  1VLG A;  2C2U A;  3HL1 A;  4OYN A;  3AF8 X;  3R2O A;  4M33 A;  3PVT B;  4AM2 A;  4YKH A;  3R2L A;  3RGD A;  4XKT A;  1IES A;  3A9Q A;  5C6F A;  5D8S A;  5JKM A;  5CMQ A;  4TOD A;  3AJQ A;  2JD7 0;  3KWO A;  2ZG7 X;  4LYX A;  4MN9 A;  4CMY V;  5FFB A;  3ISE A;  3PZA A;  3E1O A;  3E1M A;  3PVY B;  4DYX A;  5LS9 A;  3F35 A;  2BW1 A;  4MJY A;  1EUM A;  3E1J A;  1SQ3 A;  3VNX A;  5K53 A;  1LB3 A;  3PWQ C;  4RC8 A;  4ZL6 A;  4CVS A;  4TOC A;  5ERK A;  1RCI A;  3R2K A;  1ZS3 A;  3AK9 A;  1BFR A;  1B71 A;  4TOB A;  3SH6 A;  1J30 A;  3PW1 B;  3Q4Q A;  2UX1 A;  4EVB A;  4RC6 A;  1F30 A;  2C2F A;  3QHB A;  3PVR B;  5JAC A;  4M34 A;  5D8Y A;  4XKS A;  2V2N A;  2GS4 A;  1VJX A;  3QVD A;  3QHC A;  2F7N A;  1NF4 A;  1NNQ A;  5GU2 X;  3PWQ A;  5GU0 X;  4RC5 A;  3WNW A;  1BCF A;  1RCC A;  2GYD A;  3BVE A;  2FHA A;  2JD6 0;  3AK8 A;  3E1L A;  3PWF A;  2ZUR X;  4E6K A;  3OGH A;  5E1U A;  3FVB A;  4ZTT A;  3AJO A;  3E2C A;  2BK6 A;  4DI0 A;  1GWG A;  3GE4 A;  4M32 A;  3KXU A;  3UNO A;  2W0O A;  3KA3 A;  4ZKH A;  4EVC A;  3O7S A;  5JKM G;  4II4 B;  3BT5 A;  5J8S A;  2V2J A;  3BKN A;  2X17 0;  4CVP A;  3NOZ X;  3F37 A;  5J9V A;  3PVY A;  1RCD A;  2V2O A;  1TK6 A;  3A68 A;  1TKO A;  1Z6O A;  1YUX A;  5HJF A;  4EVE A;  1MOJ A;  5CZU A;  4MKU A;  4M35 A;  1JKV A;  4RC7 A;  1O9I A;  3KA9 A;  3R2S A;  4PG0 A;  4ZLW A;  4CVT A;  3BVI A;  4ZMC A;  1IER A;  4ZKW A;  4ZKX A;  4EVD A;  4PG1 A;  3PW1 A;  3KA8 A;  5D8R A;  2V2S A;  2C41 A;  4AM5 A;  3E1N A;  3ERZ A;  1FHA A;  3PVR A;  5FFA A;  1H96 A;  1RYT A;  1Z4A A;  2ZG9 X;  3E1Q A;  4MY7 A;  4TOA A;  2FG4 A;  2Z5R A;  3WVV A;  4CY9 A;  2RBD A;  3WVU A;  4ETR A;  3PW8 A;  3EZ0 A;  3KX9 A;  2QF9 A;  5LG2 A;  2V2I A;  4DAS A;  4LPJ A;  5LG8 A;  2V2P A;  1QGH A;  5J93 A;  2IY4 A;  4KVQ A;  2CN6 A;  5LBH A;  2Z5Q A;  2FL0 A;  4DE6 A;  4KVS A;  3EZU A;  2V2L A;  5FFC A;  4CMY A;  2FG8 A;  4II4 A;  4XGS A;  1HRS A;  2ZA8 A;  4ZJK A;  4CVR A;  4TOF A;  2ITB A;  1ZUJ A;  2YJJ A;  5IX6 A;  4TOG A;  5GN8 A;  3QZ3 A;  3RE7 A;  2XKQ A;  1SOF A;  3UOF A;  4ITW A;  2YW7 A;  1N1Q A;  2OH3 A;  3RAV A;  1LKO A;  5K52 A;  3UOI A;  3H7G A;  3RBC A;  3OJ5 A;  2PYB A;  1JI5 A;  1NF6 A;  4ITT A;  3PVT A;  3T9J A;  2CHP A;  5D8X A;  2C6R A;  4AM4 A;  2ZG8 X;  4TO9 A;  5ERJ A;  3AJP A;  2HTN A;  1DVB A;  1TJO A;  2Z90 A;  3F38 A;  4CYB A;  3SE1 A;  1VEQ A;  2D5K A;  3FI6 A;  3QD8 A;  2CIH A;  5FFE A;  2WLA A;  1UVH A;  2CN7 A;  2V15 A;  1S30 A;  4Y08 A;  3EGM A;  3O7R A;  2GYQ A;  4LYU A;  4DYY A;  2BJY A;  2V2R A;  2HR5 A;  1L8I A;  2FJC A;  4LPM A;  1BG7 A;  4IWJ A;  1F33 A;  1S2Z A;  4ERU A;  1JKU A;  1RCE A;  4LQN A;  2C2J A;  1JGC A;  2CHI A;  3R2R A;  3QB9 A;  2YJK A;  4RC6 B;  5GOU A;  1JRE A;  1JI4 A;  1MFR A;  2ZA6 A;  3TA8 A; 
#chains in the Genus database with same CATH topology
 2VXX A;  5HQO A;  2WTL A;  3N6O A;  3E1P A;  1JYB A;  2IB0 A;  4U3G A;  4RC5 B;  2VZB A;  1LKM A;  1L8H A;  4ISP A;  4IXK A;  2BKC A;  4MUD A;  2Z5P A;  4DZ0 A;  1YUZ A;  4LQH A;  3BVK A;  3GVY A;  4TOE A;  1Z6O M;  4DYZ A;  5GU3 X;  5CMR A;  5I4J A;  5D8P A;  1DAT A;  1XZ3 A;  2G38 B;  4IWK A;  2G4H A;  2V8T A;  1R03 A;  3NP2 X;  3AF9 X;  3R2H A;  4QUW A;  4TW3 A;  3R2M A;  5FEJ A;  1RCG A;  3RD0 A;  4LQJ A;  5J8W A;  4A25 A;  2V2M A;  2CEI A;  2QQY A;  2Y44 A;  2WLU A;  3Q4O A;  1YV1 A;  1DPS A;  2JD8 0;  3SID A;  4ZL5 A;  2XJM A;  3GHQ A;  1O9R A;  2V8U A;  5JKL A;  1XZ1 A;  4XKU A;  3BVL A;  4KXR B;  2CF7 A;  1QYB A;  4CYA A;  5D8O A;  2FFX J;  5AXS A;  3ES3 A;  4YXJ A;  4KVR A;  3MPS A;  2ZA7 A;  4RC7 B;  1KRQ A;  2CLB A;  4R42 A;  3BVF A;  3AF7 X;  2Z6M A;  3F34 A;  3F39 A;  2MGY A;  4ML5 A;  3U90 A;  1LKP A;  1NFV A;  2Y3Q A;  3VVA A;  1VEI A;  2YW6 A;  4DYU A;  3DBY A;  4WJG 4;  5JDO A;  3WVW A;  3ISF A;  3IS8 A;  5GU1 X;  3SHX A;  2XGW A;  1S3Q A;  3IQ1 A;  3KA6 A;  2XJO A;  5FFD A;  1OTK A;  4Z5S A;  3KA4 A;  5HJH A;  2FKZ A;  2VXI A;  3HIU A;  3FRR A;  4YVZ A;  1JIG A;  5D8Q A;  4LPN A;  2CLU A;  3E6S A;  3F32 A;  1TKP A;  3F33 A;  4LQV A;  3NP0 X;  2XJN A;  3JZA B;  1UMN A;  2OC5 A;  2FZF A;  4PGI A;  3F36 A;  3Q4N A;  3FSE A;  5E2D A;  4TOH A;  4W4L B;  3VV9 A;  4REU A;  5GN8 B;  1VEL A;  2IU2 A;  4P18 A;  4Z3B A;  3IS7 A;  3E6R A;  3Q4R A;  4PGK A;  5JKL G;  1AEW A;  1JTS A;  4ISM A;  3PW8 C;  1VLG A;  2C2U A;  3HL1 A;  4OYN A;  3AF8 X;  3R2O A;  4M33 A;  3PVT B;  3W54 A;  4AM2 A;  4YKH A;  2N02 A;  3R2L A;  3RGD A;  3FRS A;  4XKT A;  1IES A;  3A9Q A;  5C6F A;  2AR0 A;  5D8S A;  5JKM A;  5CMQ A;  3KHK A;  4TOD A;  3AJQ A;  2JD7 0;  3KWO A;  4MXP A;  4W4K B;  2ZG7 X;  4LYX A;  4MN9 A;  4CMY V;  5FFB A;  3ISE A;  3PZA A;  3E1O A;  3E1M A;  3PVY B;  3LKD A;  4DYX A;  5LS9 A;  3F35 A;  2BW1 A;  3D19 A;  4MJY A;  1EUM A;  3E1J A;  1SQ3 A;  3VNX A;  5K53 A;  1LB3 A;  3PWQ C;  4RC8 A;  4ZL6 A;  3GGZ A;  4CVS A;  4TOC A;  5ERK A;  1RCI A;  4X0J A;  3R2K A;  1ZS3 A;  3AK9 A;  1BFR A;  1B71 A;  4TOB A;  3SH6 A;  1J30 A;  3PW1 B;  3Q4Q A;  2UX1 A;  4EVB A;  4RC6 A;  1F30 A;  2C2F A;  3QHB A;  3PVR B;  5JAC A;  4M34 A;  5D8Y A;  4XKS A;  2V2N A;  2GS4 A;  1VJX A;  3QVD A;  3QHC A;  2F7N A;  1NF4 A;  1NNQ A;  5GU2 X;  3PWQ A;  5GU0 X;  4RC5 A;  3WNW A;  1BCF A;  1RCC A;  2GYD A;  3BVE A;  2FHA A;  2JD6 0;  3AK8 A;  3E1L A;  3PWF A;  2ZUR X;  4E6K A;  3OGH A;  5E1U A;  4E40 A;  3FVB A;  4ZTT A;  3AJO A;  3E2C A;  2BK6 A;  4DI0 A;  1GWG A;  4YXM A;  3GE4 A;  3V3K B;  4M32 A;  3KXU A;  3UNO A;  2W0O A;  3KA3 A;  4ZKH A;  4EVC A;  3O7S A;  5JKM G;  4II4 B;  3BT5 A;  5J8S A;  2V2J A;  3BKN A;  2X17 0;  4CVP A;  3NOZ X;  3F37 A;  5J9V A;  3PVY A;  1RCD A;  2V2O A;  1TK6 A;  3A68 A;  1TKO A;  1Z6O A;  1YUX A;  5HJF A;  4EVE A;  1MOJ A;  5CZU A;  4MKU A;  3KDQ A;  4M35 A;  3C21 A;  1JKV A;  4RC7 A;  1O9I A;  3KA9 A;  3M6J A;  3R2S A;  4PG0 A;  4ZLW A;  4CVT A;  3BVI A;  4ZMC A;  1IER A;  4ZKW A;  2OKC A;  4ZKX A;  4EVD A;  4PG1 A;  3PW1 A;  3KA8 A;  5D8R A;  2V2S A;  2C41 A;  4AM5 A;  3E1N A;  3ERZ A;  1FHA A;  3PVR A;  5FFA A;  3E1Q A;  1H96 A;  1RYT A;  1Z4A A;  2ZG9 X;  4MY7 A;  4TOA A;  5JDO B;  2FG4 A;  2Z5R A;  3WVV A;  4CY9 A;  2RBD A;  3WVU A;  4ETR A;  3PW8 A;  3EZ0 A;  3KX9 A;  2QF9 A;  5LG2 A;  2V2I A;  4DAS A;  4LPJ A;  5LG8 A;  2V2P A;  1QGH A;  5HU6 D;  5J93 A;  2IY4 A;  4KVQ A;  2CN6 A;  5LBH A;  2Z5Q A;  2FL0 A;  4DE6 A;  3C1Y A;  4KVS A;  3EZU A;  2V2L A;  5FFC A;  4CMY A;  2FG8 A;  4II4 A;  4XGS A;  1HRS A;  2ZA8 A;  4ZJK A;  4CVR A;  4TOF A;  2ITB A;  1ZUJ A;  2YJJ A;  5IX6 A;  4TOG A;  5GN8 A;  3QZ3 A;  3RE7 A;  2XKQ A;  1SOF A;  3UOF A;  3C1Z A;  4ITW A;  2YW7 A;  1N1Q A;  3JZ9 A;  2OH3 A;  3RAV A;  1LKO A;  5K52 A;  3UOI A;  3H7G A;  2WWX B;  3RBC A;  3OJ5 A;  2PYB A;  1JI5 A;  1NF6 A;  4ITT A;  3PVT A;  3T9J A;  3C23 A;  2CHP A;  5D8X A;  2C6R A;  4AM4 A;  2ZG8 X;  4TO9 A;  5ERJ A;  3AJP A;  2HTN A;  1DVB A;  1TJO A;  2Z90 A;  3F38 A;  4CYB A;  3SE1 A;  1VEQ A;  2D5K A;  3L0M A;  3FI6 A;  3UFB A;  3QD8 A;  2CIH A;  5FFE A;  2WLA A;  1UVH A;  2CN7 A;  2V15 A;  1S30 A;  4Y08 A;  3EGM A;  3O7R A;  2GYQ A;  4LYU A;  4DYY A;  2BJY A;  2V2R A;  2HR5 A;  3GGY A;  2CWL A;  1L8I A;  2FJC A;  4LPM A;  1BG7 A;  4IWJ A;  1F33 A;  1S2Z A;  4ERU A;  1JKU A;  1RCE A;  4LQN A;  2C2J A;  1JGC A;  2CHI A;  3R2R A;  3QB9 A;  2YJK A;  4RC6 B;  5GOU A;  1JRE A;  1JI4 A;  1MFR A;  2ZA6 A;  3TA8 A; 
#chains in the Genus database with same CATH homology
 2VXX A;  5HQO A;  2WTL A;  3N6O A;  3E1P A;  1JYB A;  2IB0 A;  4U3G A;  4RC5 B;  2VZB A;  1LKM A;  1L8H A;  4ISP A;  4IXK A;  2BKC A;  4MUD A;  2Z5P A;  4DZ0 A;  1YUZ A;  4LQH A;  3BVK A;  3GVY A;  4TOE A;  1Z6O M;  4DYZ A;  5GU3 X;  5CMR A;  5I4J A;  5D8P A;  1DAT A;  1XZ3 A;  2G38 B;  4IWK A;  2G4H A;  2V8T A;  1R03 A;  3NP2 X;  3AF9 X;  3R2H A;  4QUW A;  4TW3 A;  3R2M A;  5FEJ A;  1RCG A;  3RD0 A;  4LQJ A;  5J8W A;  4A25 A;  2V2M A;  2CEI A;  2QQY A;  2Y44 A;  2WLU A;  3Q4O A;  1YV1 A;  1DPS A;  2JD8 0;  3SID A;  4ZL5 A;  2XJM A;  3GHQ A;  1O9R A;  2V8U A;  5JKL A;  1XZ1 A;  4XKU A;  3BVL A;  4KXR B;  2CF7 A;  1QYB A;  4CYA A;  5D8O A;  2FFX J;  5AXS A;  3ES3 A;  4YXJ A;  4KVR A;  3MPS A;  2ZA7 A;  4RC7 B;  1KRQ A;  2CLB A;  4R42 A;  3BVF A;  3AF7 X;  2Z6M A;  3F34 A;  3F39 A;  2MGY A;  4ML5 A;  3U90 A;  1LKP A;  1NFV A;  2Y3Q A;  3VVA A;  1VEI A;  2YW6 A;  4DYU A;  3DBY A;  4WJG 4;  5JDO A;  3WVW A;  3ISF A;  3IS8 A;  5GU1 X;  3SHX A;  2XGW A;  1S3Q A;  3IQ1 A;  3KA6 A;  2XJO A;  5FFD A;  1OTK A;  4Z5S A;  3KA4 A;  5HJH A;  2FKZ A;  2VXI A;  3HIU A;  3FRR A;  4YVZ A;  1JIG A;  5D8Q A;  4LPN A;  2CLU A;  3E6S A;  3F32 A;  1TKP A;  3F33 A;  4LQV A;  3NP0 X;  2XJN A;  3JZA B;  1UMN A;  2OC5 A;  2FZF A;  4PGI A;  3F36 A;  3Q4N A;  3FSE A;  5E2D A;  4TOH A;  4W4L B;  3VV9 A;  4REU A;  5GN8 B;  1VEL A;  2IU2 A;  4P18 A;  4Z3B A;  3IS7 A;  3E6R A;  3Q4R A;  4PGK A;  5JKL G;  1AEW A;  1JTS A;  4ISM A;  3PW8 C;  1VLG A;  2C2U A;  3HL1 A;  4OYN A;  3AF8 X;  3R2O A;  4M33 A;  3PVT B;  3W54 A;  4AM2 A;  4YKH A;  2N02 A;  3R2L A;  3RGD A;  3FRS A;  4XKT A;  1IES A;  3A9Q A;  5C6F A;  2AR0 A;  5D8S A;  5JKM A;  5CMQ A;  3KHK A;  4TOD A;  3AJQ A;  2JD7 0;  3KWO A;  4MXP A;  4W4K B;  2ZG7 X;  4LYX A;  4MN9 A;  4CMY V;  5FFB A;  3ISE A;  3PZA A;  3E1O A;  3E1M A;  3PVY B;  3LKD A;  4DYX A;  5LS9 A;  3F35 A;  2BW1 A;  3D19 A;  4MJY A;  1EUM A;  3E1J A;  1SQ3 A;  3VNX A;  5K53 A;  1LB3 A;  3PWQ C;  4RC8 A;  4ZL6 A;  3GGZ A;  4CVS A;  4TOC A;  5ERK A;  1RCI A;  4X0J A;  3R2K A;  1ZS3 A;  3AK9 A;  1BFR A;  1B71 A;  4TOB A;  3SH6 A;  1J30 A;  3PW1 B;  3Q4Q A;  2UX1 A;  4EVB A;  4RC6 A;  1F30 A;  2C2F A;  3QHB A;  3PVR B;  5JAC A;  4M34 A;  5D8Y A;  4XKS A;  2V2N A;  2GS4 A;  1VJX A;  3QVD A;  3QHC A;  2F7N A;  1NF4 A;  1NNQ A;  5GU2 X;  3PWQ A;  5GU0 X;  4RC5 A;  3WNW A;  1BCF A;  1RCC A;  2GYD A;  3BVE A;  2FHA A;  2JD6 0;  3AK8 A;  3E1L A;  3PWF A;  2ZUR X;  4E6K A;  3OGH A;  5E1U A;  4E40 A;  3FVB A;  4ZTT A;  3AJO A;  3E2C A;  2BK6 A;  4DI0 A;  1GWG A;  4YXM A;  3GE4 A;  3V3K B;  4M32 A;  3KXU A;  3UNO A;  2W0O A;  3KA3 A;  4ZKH A;  4EVC A;  3O7S A;  5JKM G;  4II4 B;  3BT5 A;  5J8S A;  2V2J A;  3BKN A;  2X17 0;  4CVP A;  3NOZ X;  3F37 A;  5J9V A;  3PVY A;  1RCD A;  2V2O A;  1TK6 A;  3A68 A;  1TKO A;  1Z6O A;  1YUX A;  5HJF A;  4EVE A;  1MOJ A;  5CZU A;  4MKU A;  3KDQ A;  4M35 A;  3C21 A;  1JKV A;  4RC7 A;  1O9I A;  3KA9 A;  3M6J A;  3R2S A;  4PG0 A;  4ZLW A;  4CVT A;  3BVI A;  4ZMC A;  1IER A;  4ZKW A;  2OKC A;  4ZKX A;  4EVD A;  4PG1 A;  3PW1 A;  3KA8 A;  5D8R A;  2V2S A;  2C41 A;  4AM5 A;  3E1N A;  3ERZ A;  1FHA A;  3PVR A;  5FFA A;  3E1Q A;  1H96 A;  1RYT A;  1Z4A A;  2ZG9 X;  4MY7 A;  4TOA A;  5JDO B;  2FG4 A;  2Z5R A;  3WVV A;  4CY9 A;  2RBD A;  3WVU A;  4ETR A;  3PW8 A;  3EZ0 A;  3KX9 A;  2QF9 A;  5LG2 A;  2V2I A;  4DAS A;  4LPJ A;  5LG8 A;  2V2P A;  1QGH A;  5HU6 D;  5J93 A;  2IY4 A;  4KVQ A;  2CN6 A;  5LBH A;  2Z5Q A;  2FL0 A;  4DE6 A;  3C1Y A;  4KVS A;  3EZU A;  2V2L A;  5FFC A;  4CMY A;  2FG8 A;  4II4 A;  4XGS A;  1HRS A;  2ZA8 A;  4ZJK A;  4CVR A;  4TOF A;  2ITB A;  1ZUJ A;  2YJJ A;  5IX6 A;  4TOG A;  5GN8 A;  3QZ3 A;  3RE7 A;  2XKQ A;  1SOF A;  3UOF A;  3C1Z A;  4ITW A;  2YW7 A;  1N1Q A;  3JZ9 A;  2OH3 A;  3RAV A;  1LKO A;  5K52 A;  3UOI A;  3H7G A;  2WWX B;  3RBC A;  3OJ5 A;  2PYB A;  1JI5 A;  1NF6 A;  4ITT A;  3PVT A;  3T9J A;  3C23 A;  2CHP A;  5D8X A;  2C6R A;  4AM4 A;  2ZG8 X;  4TO9 A;  5ERJ A;  3AJP A;  2HTN A;  1DVB A;  1TJO A;  2Z90 A;  3F38 A;  4CYB A;  3SE1 A;  1VEQ A;  2D5K A;  3L0M A;  3FI6 A;  3UFB A;  3QD8 A;  2CIH A;  5FFE A;  2WLA A;  1UVH A;  2CN7 A;  2V15 A;  1S30 A;  4Y08 A;  3EGM A;  3O7R A;  2GYQ A;  4LYU A;  4DYY A;  2BJY A;  2V2R A;  2HR5 A;  3GGY A;  2CWL A;  1L8I A;  2FJC A;  4LPM A;  1BG7 A;  4IWJ A;  1F33 A;  1S2Z A;  4ERU A;  1JKU A;  1RCE A;  4LQN A;  2C2J A;  1JGC A;  2CHI A;  3R2R A;  3QB9 A;  2YJK A;  4RC6 B;  5GOU A;  1JRE A;  1JI4 A;  1MFR A;  2ZA6 A;  3TA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...