2GYQA

Ycfi, a putative structural protein from rhodopseudomonas palustris.
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
169
structure length
162
Chain Sequence
MGFFSRDIQTMEDLLLHGLRDIYYAEQQITKALPKMIEQATNRDLSQGLTSHLEETQKQIERLDQVFKKLGQKPSGVNCPAIDGLIKEADETAGEIADKTVLDAAIVANAQAVEHYEIARYGTLIAWAEELGHDDIVRFLTTNLNEEKAANTKLNTVALRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords ycfI, putative structural protein
publication title X-ray crystal structure of YcfI protein, a putative structural protein from Rhodopseudomonas palustris.
rcsb
source organism Rhodopseudomonas palustris
total genus 74
structure length 162
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05974 DUF892 Domain of unknown function (DUF892)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2gyqA00
4LPNA 4LQVA 3E1PA 1SOFA 4AM2A 2WLAA 2WTLA 1F33A 3AF8X 1XZ1A 1DVBA 4LYXA 3BVLA 4ZKWA 2YW6A 3Q4OA 3BVFA 4KVSA 1LB3A 3ISEA 3QHCA 1RCEA 2CLUA 2FKZA 4M32A 4TOGA 5D8YA 2C2JA 4ZKHA 3AF9X 2UX1A 5D8QA 3PVRA 1UMNA 1OTKA 4CVTA 1L8HA 3KA8A 4LPMA 3OGHA 3SHXA 4ZMCA 1TJOA 1O9RA 3F34A 2Y3QA 3BVKA 4LQJA 1TK6A 3NOZX 3PW8C 5K53A 3NP0X 5D8OA 3E1LA 3O7SA 4CVRA 3A9QA 4LQNA 1RCDA 2ZA7A 3PVRB 3F39A 2XJNA 2HR5A 1ZUJA 2V2NA 2QQYA 2BK6A 1B71A 5HJHA 1UVHA 2ZG7X 3R2KA 1S2ZA 5FFBA 3QVDA 1N1QA 1NNQA 1JREA 3E1MA 3H7GA 3KA4A 3QHBA 4II4A 4CY9A 3EGMA 1BCFA 1VJXA 4ITTA 3FI6A 4ITWA 2V2LA 1LKMA 5FFAA 3IS7A 3IS8A 3F38A 3BVIA 4ERUA 5HJFA 1VEIA 2C2UA 3PWQA 3R2RA 2HTNA 3E1OA 4PG0A 1YUXA 4CMYV 3PVTA 4II4B 3RAVA 4IWKA 1QGHA 4TOBA 3PVYA 2FG4A 1AEWA 4XKUA 3SIDA 2OC5A 2JD80 4EVEA 3Q4NA 4RC8A 2CIHA 4DYZA 2CN6A 2BW1A 3U90A 3RE7A 1KRQA 3TA8A 5D8PA 1Z6OA 3BT5A 3PWFA 2VXXA 3GVYA 4EVBA 2D5KA 1XZ3A 1RYTA 3EZ0A 5I4JA 3Q4RA 4ZLWA 4CYBA 4TOEA 1R03A 4QUWA 4TODA 5C6FA 4LPJA 2FL0A 3F32A 3QB9A 4ZL6A 2FFXJ 3PVYB 5CZUA 3IQ1A 4KVRA 4AM4A 5J8SA 2X170 1JI4A 2V15A 1LKPA 4CYAA 2BJYA 3HIUA 5JKMG 4DASA 3UNOA 3FVBA 2IU2A 2ITBA 4REUA 4KVQA 3Q4QA 2CHPA 4IXKA 2Z6MA 4YKHA 5E2DA 2G4HA 1SQ3A 4ZTTA 1VLGA 5LS9A 1ZS3A 1YV1A 3SE1A 5ERJA 2OH3A 2PYBA 5JKMA 3F36A 4XKTA 5D8SA 2CF7A 3RD0A 2F7NA 5FEJA 1JGCA 3PW8A 1TKPA 3MPSA 5GOUA 1JKVA 3KA9A 3RBCA 3SH6A 4TO9A 4TOCA 2V2JA 2C6RA 3PW1A 5GU2X 3WVUA 1JKUA 4RC5A 2YW7A 4DYXA 1NFVA 3EZUA 1NF4A 2QF9A 3E1QA 4M35A 5GU1X 4RC7A 2FHAA 4DZ0A 1MOJA 4M34A 5GN8A 4MKUA 5J93A 1S3QA 4ZKXA 1IERA 5D8RA 4CMYA 3WNWA 3AJPA 5D8XA 1Z6OM 2ZA6A 4DYYA 4RC5B 1GWGA 4XGSA 2RBDA 2VXIA 5J9VA 3QZ3A 4RC7B 2JD70 2Z5RA 2CN7A 5HQOA 1RCGA 5JKLA 5CMRA 5GN8B 3T9JA 5FFCA 2GYQA 1DATA 2Z5PA 5JACA 3WVWA 4ETRA 4ISMA 3KA3A 4MJYA 5LG8A 4LYUA 2FZFA 3R2SA 4ML5A 2CEIA 2Z90A 4CVSA 2ZG9X 3PVTB 5GU0X 5IX6A 2GS4A 3VNXA 5GU3X 2JD60 3KX9A 1RCIA 2YJJA 3E6RA 3HL1A 3UOFA 2IY4A 3R2MA 2W0OA 4MUDA 3BKNA 4PG1A 2V2OA 4TOFA 2V2MA 4AM5A 4OYNA 4MY7A 1JYBA 1JI5A 4PGKA 3NP2X 1L8IA 3AF7X 1DPSA 2GYDA 2ZA8A 2VZBA 1VELA 3F33A 2BKCA 2IB0A 3AK9A 1VEQA 3O7RA 4XKSA 4P18A 4ISPA 3FSEA 3PZAA 4DE6A 3KWOA 3A68A 5ERKA 4TW3A 4DI0A 1IESA 4M33A 4DYUA 1BG7A 1YUZA 4Z3BA 1RCCA 3OJ5A 3E2CA 2FJCA 4LQHA 4TOAA 4MN9A 4EVDA 1EUMA 3GE4A 3RGDA 4IWJA 3R2LA 4Z5SA 2V2SA 2YJKA 4PGIA 1JTSA 1LKOA 2CLBA 2XJMA 1J30A 1O9IA 2V2PA 1NF6A 5K52A 4TOHA 1MFRA 4CVPA 2WLUA 3R2HA 1QYBA 3PWQC 4ZJKA 3BVEA 2V2IA 2XKQA 4A25A 5JKLG 4RC6A 3ES3A 3E6SA 3KXUA 5AXSA 1JIGA 2CHIA 5LG2A 3E1NA 1BFRA 1S30A 4ZL5A 3ISFA 3F37A 3KA6A 5FFEA 1F30A 3PW1B 5CMQA 2FG8A 2ZG8X 2C41A 3WVVA 4E6KA 1Z4AA 1HRSA 1H96A 3UOIA 2XJOA 3GHQA 4Y08A 5LBHA 3AJQA 5E1UA 5FFDA 5J8WA 2Z5QA 3QD8A 4RC6B 2C2FA 3AK8A 1TKOA 4R42A 3F35A 3ERZA 1FHAA 3R2OA 4U3GA 2ZURX 2XGWA 4EVCA 2V2RA 3E1JA 3AJOA
chains in the Genus database with same CATH superfamily
4LPNA 4LQVA 3E1PA 1SOFA 4MXPA 4AM2A 2WLAA 2WTLA 1F33A 3AF8X 1XZ1A 1DVBA 4LYXA 3BVLA 3W54A 4ZKWA 2YW6A 3KDQA 3Q4OA 2AR0A 3BVFA 4KVSA 1LB3A 3ISEA 3QHCA 1RCEA 3UFBA 2CLUA 2FKZA 4M32A 4TOGA 5D8YA 2C2JA 4ZKHA 3AF9X 2UX1A 5D8QA 3PVRA 1UMNA 1OTKA 4CVTA 1L8HA 3KA8A 4LPMA 3OGHA 3SHXA 4ZMCA 1TJOA 1O9RA 3F34A 2Y3QA 3BVKA 4LQJA 1TK6A 3NOZX 3PW8C 5K53A 3NP0X 3GGYA 5D8OA 3E1LA 3O7SA 4CVRA 3A9QA 4LQNA 1RCDA 2ZA7A 3PVRB 3F39A 3C21A 2XJNA 2HR5A 1ZUJA 2V2NA 2QQYA 2BK6A 1B71A 4WJG4 2CWLA 5HJHA 1UVHA 2ZG7X 3R2KA 1S2ZA 5FFBA 3QVDA 1N1QA 1NNQA 1JREA 3E1MA 3H7GA 3KA4A 4YVZA 3QHBA 4II4A 4CY9A 5JDOB 3EGMA 1BCFA 3FRRA 1VJXA 4ITTA 3FI6A 4W4LB 4ITWA 3N6OA 2V2LA 1LKMA 5FFAA 3IS7A 3IS8A 3F38A 3BVIA 4ERUA 5HJFA 1VEIA 2C2UA 3PWQA 3R2RA 2HTNA 3E1OA 4PG0A 1YUXA 4CMYV 3PVTA 4II4B 3RAVA 4IWKA 1QGHA 4TOBA 3PVYA 2FG4A 1AEWA 4XKUA 3SIDA 2OC5A 2JD80 4EVEA 3Q4NA 4RC8A 2CIHA 4DYZA 2CN6A 2BW1A 3U90A 3RE7A 1KRQA 3TA8A 5D8PA 1Z6OA 3BT5A 3PWFA 2VXXA 3GVYA 4EVBA 2D5KA 1XZ3A 1RYTA 3EZ0A 5I4JA 3Q4RA 4ZLWA 4CYBA 4YXMA 4TOEA 1R03A 4QUWA 4TODA 5C6FA 4LPJA 2FL0A 3F32A 3QB9A 3C23A 4ZL6A 2FFXJ 3PVYB 5CZUA 3IQ1A 4KVRA 4AM4A 5J8SA 3FRSA 2X170 1JI4A 2V15A 2MGYA 1LKPA 4CYAA 2BJYA 3HIUA 5JKMG 4DASA 2N02A 3UNOA 3FVBA 2IU2A 2ITBA 4REUA 4KVQA 3Q4QA 2CHPA 4IXKA 2Z6MA 4YKHA 5E2DA 2G4HA 1SQ3A 4ZTTA 1VLGA 3C1ZA 5LS9A 1ZS3A 1YV1A 3SE1A 5ERJA 2OH3A 2PYBA 5JKMA 3F36A 4XKTA 5D8SA 2CF7A 3RD0A 2F7NA 5FEJA 3D19A 1JGCA 3PW8A 1TKPA 3MPSA 5GOUA 1JKVA 3KA9A 3RBCA 3SH6A 4TO9A 4TOCA 2V2JA 2C6RA 3PW1A 5GU2X 3WVUA 1JKUA 4RC5A 2YW7A 4DYXA 1NFVA 3EZUA 1NF4A 2QF9A 3E1QA 4M35A 5GU1X 4RC7A 2FHAA 4DZ0A 1MOJA 4E40A 4M34A 5GN8A 4MKUA 5J93A 1S3QA 4ZKXA 3VVAA 3C1YA 2V8UA 1IERA 5D8RA 4CMYA 3WNWA 3AJPA 5D8XA 1Z6OM 2ZA6A 4DYYA 4RC5B 1GWGA 4XGSA 2RBDA 2VXIA 2Y44A 5J9VA 3QZ3A 4RC7B 3DBYA 2JD70 2Z5RA 2CN7A 5HQOA 1RCGA 5JKLA 5CMRA 5GN8B 3T9JA 5FFCA 2GYQA 2G38B 1DATA 2Z5PA 5JACA 3WVWA 4ETRA 4ISMA 3KA3A 3L0MA 4MJYA 5LG8A 4LYUA 2FZFA 3R2SA 4ML5A 2CEIA 2Z90A 4CVSA 2ZG9X 3PVTB 5GU0X 5IX6A 2GS4A 3VNXA 5GU3X 2JD60 3KX9A 1RCIA 2YJJA 3E6RA 3HL1A 3UOFA 2IY4A 3R2MA 2W0OA 4MUDA 3JZAB 3BKNA 4PG1A 2V2OA 4TOFA 2V2MA 4X0JA 4AM5A 4OYNA 4MY7A 2V8TA 1JYBA 1JI5A 4YXJA 3M6JA 4PGKA 3NP2X 1L8IA 3AF7X 1DPSA 2OKCA 2GYDA 2ZA8A 2VZBA 1VELA 3F33A 3LKDA 3KHKA 2BKCA 2IB0A 3AK9A 1VEQA 3O7RA 4XKSA 4P18A 4ISPA 3FSEA 3PZAA 4DE6A 3VV9A 3KWOA 3A68A 5ERKA 4TW3A 4DI0A 1IESA 4M33A 2WWXB 4DYUA 1BG7A 1YUZA 4Z3BA 1RCCA 3OJ5A 3E2CA 2FJCA 4LQHA 4TOAA 4MN9A 4EVDA 1EUMA 3GE4A 3RGDA 5JDOA 4IWJA 3R2LA 4Z5SA 2V2SA 2YJKA 4PGIA 1JTSA 1LKOA 2CLBA 2XJMA 1J30A 1O9IA 2V2PA 1NF6A 5K52A 3V3KB 4TOHA 1MFRA 4CVPA 2WLUA 3GGZA 3R2HA 1QYBA 3PWQC 3JZ9A 4ZJKA 3BVEA 2V2IA 2XKQA 4A25A 5JKLG 4RC6A 3ES3A 3E6SA 3KXUA 5AXSA 1JIGA 2CHIA 5LG2A 3E1NA 1BFRA 1S30A 4ZL5A 3ISFA 3F37A 3KA6A 5FFEA 1F30A 3PW1B 5CMQA 2FG8A 2ZG8X 2C41A 3WVVA 4E6KA 1Z4AA 1HRSA 1H96A 3UOIA 5HU6D 2XJOA 3GHQA 4KXRB 4Y08A 4W4KB 5LBHA 3AJQA 5E1UA 5FFDA 5J8WA 2Z5QA 3QD8A 4RC6B 2C2FA 3AK8A 1TKOA 4R42A 3F35A 3ERZA 1FHAA 3R2OA 4U3GA 2ZURX 2XGWA 4EVCA 2V2RA 3E1JA 3AJOA
chains in the Genus database with same CATH topology
4LPNA 4LQVA 3E1PA 1SOFA 4MXPA 4AM2A 2WLAA 2WTLA 1F33A 3AF8X 1XZ1A 1DVBA 4LYXA 3BVLA 3W54A 4ZKWA 2YW6A 3KDQA 3Q4OA 2AR0A 3BVFA 4KVSA 1LB3A 3ISEA 3QHCA 1RCEA 3UFBA 2CLUA 2FKZA 4M32A 4TOGA 5D8YA 2C2JA 4ZKHA 3AF9X 2UX1A 5D8QA 3PVRA 1UMNA 1OTKA 4CVTA 1L8HA 3KA8A 4LPMA 3OGHA 3SHXA 4ZMCA 1TJOA 1O9RA 3F34A 2Y3QA 3BVKA 4LQJA 1TK6A 3NOZX 3PW8C 5K53A 3NP0X 3GGYA 5D8OA 3E1LA 3O7SA 4CVRA 3A9QA 4LQNA 1RCDA 2ZA7A 3PVRB 3F39A 3C21A 2XJNA 2HR5A 1ZUJA 2V2NA 2QQYA 2BK6A 1B71A 4WJG4 2CWLA 5HJHA 1UVHA 2ZG7X 3R2KA 1S2ZA 5FFBA 3QVDA 1N1QA 1NNQA 1JREA 3E1MA 3H7GA 3KA4A 4YVZA 3QHBA 4II4A 4CY9A 5JDOB 3EGMA 1BCFA 3FRRA 1VJXA 4ITTA 3FI6A 4W4LB 4ITWA 3N6OA 2V2LA 1LKMA 5FFAA 3IS7A 3IS8A 3F38A 3BVIA 4ERUA 5HJFA 1VEIA 2C2UA 3PWQA 3R2RA 2HTNA 3E1OA 4PG0A 1YUXA 4CMYV 3PVTA 4II4B 3RAVA 4IWKA 1QGHA 4TOBA 3PVYA 2FG4A 1AEWA 4XKUA 3SIDA 2OC5A 2JD80 4EVEA 3Q4NA 4RC8A 2CIHA 4DYZA 2CN6A 2BW1A 3U90A 3RE7A 1KRQA 3TA8A 5D8PA 1Z6OA 3BT5A 3PWFA 2VXXA 3GVYA 4EVBA 2D5KA 1XZ3A 1RYTA 3EZ0A 5I4JA 3Q4RA 4ZLWA 4CYBA 4YXMA 4TOEA 1R03A 4QUWA 4TODA 5C6FA 4LPJA 2FL0A 3F32A 3QB9A 3C23A 4ZL6A 2FFXJ 3PVYB 5CZUA 3IQ1A 4KVRA 4AM4A 5J8SA 3FRSA 2X170 1JI4A 2V15A 2MGYA 1LKPA 4CYAA 2BJYA 3HIUA 5JKMG 4DASA 2N02A 3UNOA 3FVBA 2IU2A 2ITBA 4REUA 4KVQA 3Q4QA 2CHPA 4IXKA 2Z6MA 4YKHA 5E2DA 2G4HA 1SQ3A 4ZTTA 1VLGA 3C1ZA 5LS9A 1ZS3A 1YV1A 3SE1A 5ERJA 2OH3A 2PYBA 5JKMA 3F36A 4XKTA 5D8SA 2CF7A 3RD0A 2F7NA 5FEJA 3D19A 1JGCA 3PW8A 1TKPA 3MPSA 5GOUA 1JKVA 3KA9A 3RBCA 3SH6A 4TO9A 4TOCA 2V2JA 2C6RA 3PW1A 5GU2X 3WVUA 1JKUA 4RC5A 2YW7A 4DYXA 1NFVA 3EZUA 1NF4A 2QF9A 3E1QA 4M35A 5GU1X 4RC7A 2FHAA 4DZ0A 1MOJA 4E40A 4M34A 5GN8A 4MKUA 5J93A 1S3QA 4ZKXA 3VVAA 3C1YA 2V8UA 1IERA 5D8RA 4CMYA 3WNWA 3AJPA 5D8XA 1Z6OM 2ZA6A 4DYYA 4RC5B 1GWGA 4XGSA 2RBDA 2VXIA 2Y44A 5J9VA 3QZ3A 4RC7B 3DBYA 2JD70 2Z5RA 2CN7A 5HQOA 1RCGA 5JKLA 5CMRA 5GN8B 3T9JA 5FFCA 2GYQA 2G38B 1DATA 2Z5PA 5JACA 3WVWA 4ETRA 4ISMA 3KA3A 3L0MA 4MJYA 5LG8A 4LYUA 2FZFA 3R2SA 4ML5A 2CEIA 2Z90A 4CVSA 2ZG9X 3PVTB 5GU0X 5IX6A 2GS4A 3VNXA 5GU3X 2JD60 3KX9A 1RCIA 2YJJA 3E6RA 3HL1A 3UOFA 2IY4A 3R2MA 2W0OA 4MUDA 3JZAB 3BKNA 4PG1A 2V2OA 4TOFA 2V2MA 4X0JA 4AM5A 4OYNA 4MY7A 2V8TA 1JYBA 1JI5A 4YXJA 3M6JA 4PGKA 3NP2X 1L8IA 3AF7X 1DPSA 2OKCA 2GYDA 2ZA8A 2VZBA 1VELA 3F33A 3LKDA 3KHKA 2BKCA 2IB0A 3AK9A 1VEQA 3O7RA 4XKSA 4P18A 4ISPA 3FSEA 3PZAA 4DE6A 3VV9A 3KWOA 3A68A 5ERKA 4TW3A 4DI0A 1IESA 4M33A 2WWXB 4DYUA 1BG7A 1YUZA 4Z3BA 1RCCA 3OJ5A 3E2CA 2FJCA 4LQHA 4TOAA 4MN9A 4EVDA 1EUMA 3GE4A 3RGDA 5JDOA 4IWJA 3R2LA 4Z5SA 2V2SA 2YJKA 4PGIA 1JTSA 1LKOA 2CLBA 2XJMA 1J30A 1O9IA 2V2PA 1NF6A 5K52A 3V3KB 4TOHA 1MFRA 4CVPA 2WLUA 3GGZA 3R2HA 1QYBA 3PWQC 3JZ9A 4ZJKA 3BVEA 2V2IA 2XKQA 4A25A 5JKLG 4RC6A 3ES3A 3E6SA 3KXUA 5AXSA 1JIGA 2CHIA 5LG2A 3E1NA 1BFRA 1S30A 4ZL5A 3ISFA 3F37A 3KA6A 5FFEA 1F30A 3PW1B 5CMQA 2FG8A 2ZG8X 2C41A 3WVVA 4E6KA 1Z4AA 1HRSA 1H96A 3UOIA 5HU6D 2XJOA 3GHQA 4KXRB 4Y08A 4W4KB 5LBHA 3AJQA 5E1UA 5FFDA 5J8WA 2Z5QA 3QD8A 4RC6B 2C2FA 3AK8A 1TKOA 4R42A 3F35A 3ERZA 1FHAA 3R2OA 4U3GA 2ZURX 2XGWA 4EVCA 2V2RA 3E1JA 3AJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LPN A;  4LQV A;  3E1P A;  1SOF A;  4AM2 A;  2WLA A;  2WTL A;  1F33 A;  3AF8 X;  1XZ1 A;  1DVB A;  4LYX A;  3BVL A;  4ZKW A;  2YW6 A;  3Q4O A;  3BVF A;  4KVS A;  1LB3 A;  3ISE A;  3QHC A;  1RCE A;  2CLU A;  2FKZ A;  4M32 A;  4TOG A;  5D8Y A;  2C2J A;  4ZKH A;  3AF9 X;  2UX1 A;  5D8Q A;  3PVR A;  1UMN A;  1OTK A;  4CVT A;  1L8H A;  3KA8 A;  4LPM A;  3OGH A;  3SHX A;  4ZMC A;  1TJO A;  1O9R A;  3F34 A;  2Y3Q A;  3BVK A;  4LQJ A;  1TK6 A;  3NOZ X;  3PW8 C;  5K53 A;  3NP0 X;  5D8O A;  3E1L A;  3O7S A;  4CVR A;  3A9Q A;  4LQN A;  1RCD A;  2ZA7 A;  3PVR B;  3F39 A;  2XJN A;  2HR5 A;  1ZUJ A;  2V2N A;  2QQY A;  2BK6 A;  1B71 A;  5HJH A;  1UVH A;  2ZG7 X;  3R2K A;  1S2Z A;  5FFB A;  3QVD A;  1N1Q A;  1NNQ A;  1JRE A;  3E1M A;  3H7G A;  3KA4 A;  3QHB A;  4II4 A;  4CY9 A;  3EGM A;  1BCF A;  1VJX A;  4ITT A;  3FI6 A;  4ITW A;  2V2L A;  1LKM A;  5FFA A;  3IS7 A;  3IS8 A;  3F38 A;  3BVI A;  4ERU A;  5HJF A;  1VEI A;  2C2U A;  3PWQ A;  3R2R A;  2HTN A;  3E1O A;  4PG0 A;  1YUX A;  4CMY V;  3PVT A;  4II4 B;  3RAV A;  4IWK A;  1QGH A;  4TOB A;  3PVY A;  2FG4 A;  1AEW A;  4XKU A;  3SID A;  2OC5 A;  2JD8 0;  4EVE A;  3Q4N A;  4RC8 A;  2CIH A;  4DYZ A;  2CN6 A;  2BW1 A;  3U90 A;  3RE7 A;  1KRQ A;  3TA8 A;  5D8P A;  1Z6O A;  3BT5 A;  3PWF A;  2VXX A;  3GVY A;  4EVB A;  2D5K A;  1XZ3 A;  1RYT A;  3EZ0 A;  5I4J A;  3Q4R A;  4ZLW A;  4CYB A;  4TOE A;  1R03 A;  4QUW A;  4TOD A;  5C6F A;  4LPJ A;  2FL0 A;  3F32 A;  3QB9 A;  4ZL6 A;  2FFX J;  3PVY B;  5CZU A;  3IQ1 A;  4KVR A;  4AM4 A;  5J8S A;  2X17 0;  1JI4 A;  2V15 A;  1LKP A;  4CYA A;  2BJY A;  3HIU A;  5JKM G;  4DAS A;  3UNO A;  3FVB A;  2IU2 A;  2ITB A;  4REU A;  4KVQ A;  3Q4Q A;  2CHP A;  4IXK A;  2Z6M A;  4YKH A;  5E2D A;  2G4H A;  1SQ3 A;  4ZTT A;  1VLG A;  5LS9 A;  1ZS3 A;  1YV1 A;  3SE1 A;  5ERJ A;  2OH3 A;  2PYB A;  5JKM A;  3F36 A;  4XKT A;  5D8S A;  2CF7 A;  3RD0 A;  2F7N A;  5FEJ A;  1JGC A;  3PW8 A;  1TKP A;  3MPS A;  5GOU A;  1JKV A;  3KA9 A;  3RBC A;  3SH6 A;  4TO9 A;  4TOC A;  2V2J A;  2C6R A;  3PW1 A;  5GU2 X;  3WVU A;  1JKU A;  4RC5 A;  2YW7 A;  4DYX A;  1NFV A;  3EZU A;  1NF4 A;  2QF9 A;  3E1Q A;  4M35 A;  5GU1 X;  4RC7 A;  2FHA A;  4DZ0 A;  1MOJ A;  4M34 A;  5GN8 A;  4MKU A;  5J93 A;  1S3Q A;  4ZKX A;  1IER A;  5D8R A;  4CMY A;  3WNW A;  3AJP A;  5D8X A;  1Z6O M;  2ZA6 A;  4DYY A;  4RC5 B;  1GWG A;  4XGS A;  2RBD A;  2VXI A;  5J9V A;  3QZ3 A;  4RC7 B;  2JD7 0;  2Z5R A;  2CN7 A;  5HQO A;  1RCG A;  5JKL A;  5CMR A;  5GN8 B;  3T9J A;  5FFC A;  2GYQ A;  1DAT A;  2Z5P A;  5JAC A;  3WVW A;  4ETR A;  4ISM A;  3KA3 A;  4MJY A;  5LG8 A;  4LYU A;  2FZF A;  3R2S A;  4ML5 A;  2CEI A;  2Z90 A;  4CVS A;  2ZG9 X;  3PVT B;  5GU0 X;  5IX6 A;  2GS4 A;  3VNX A;  5GU3 X;  2JD6 0;  3KX9 A;  1RCI A;  2YJJ A;  3E6R A;  3HL1 A;  3UOF A;  2IY4 A;  3R2M A;  2W0O A;  4MUD A;  3BKN A;  4PG1 A;  2V2O A;  4TOF A;  2V2M A;  4AM5 A;  4OYN A;  4MY7 A;  1JYB A;  1JI5 A;  4PGK A;  3NP2 X;  1L8I A;  3AF7 X;  1DPS A;  2GYD A;  2ZA8 A;  2VZB A;  1VEL A;  3F33 A;  2BKC A;  2IB0 A;  3AK9 A;  1VEQ A;  3O7R A;  4XKS A;  4P18 A;  4ISP A;  3FSE A;  3PZA A;  4DE6 A;  3KWO A;  3A68 A;  5ERK A;  4TW3 A;  4DI0 A;  1IES A;  4M33 A;  4DYU A;  1BG7 A;  1YUZ A;  4Z3B A;  1RCC A;  3OJ5 A;  3E2C A;  2FJC A;  4LQH A;  4TOA A;  4MN9 A;  4EVD A;  1EUM A;  3GE4 A;  3RGD A;  4IWJ A;  3R2L A;  4Z5S A;  2V2S A;  2YJK A;  4PGI A;  1JTS A;  1LKO A;  2CLB A;  2XJM A;  1J30 A;  1O9I A;  2V2P A;  1NF6 A;  5K52 A;  4TOH A;  1MFR A;  4CVP A;  2WLU A;  3R2H A;  1QYB A;  3PWQ C;  4ZJK A;  3BVE A;  2V2I A;  2XKQ A;  4A25 A;  5JKL G;  4RC6 A;  3ES3 A;  3E6S A;  3KXU A;  5AXS A;  1JIG A;  2CHI A;  5LG2 A;  3E1N A;  1BFR A;  1S30 A;  4ZL5 A;  3ISF A;  3F37 A;  3KA6 A;  5FFE A;  1F30 A;  3PW1 B;  5CMQ A;  2FG8 A;  2ZG8 X;  2C41 A;  3WVV A;  4E6K A;  1Z4A A;  1HRS A;  1H96 A;  3UOI A;  2XJO A;  3GHQ A;  4Y08 A;  5LBH A;  3AJQ A;  5E1U A;  5FFD A;  5J8W A;  2Z5Q A;  3QD8 A;  4RC6 B;  2C2F A;  3AK8 A;  1TKO A;  4R42 A;  3F35 A;  3ERZ A;  1FHA A;  3R2O A;  4U3G A;  2ZUR X;  2XGW A;  4EVC A;  2V2R A;  3E1J A;  3AJO A; 
#chains in the Genus database with same CATH topology
 4LPN A;  4LQV A;  3E1P A;  1SOF A;  4MXP A;  4AM2 A;  2WLA A;  2WTL A;  1F33 A;  3AF8 X;  1XZ1 A;  1DVB A;  4LYX A;  3BVL A;  3W54 A;  4ZKW A;  2YW6 A;  3KDQ A;  3Q4O A;  2AR0 A;  3BVF A;  4KVS A;  1LB3 A;  3ISE A;  3QHC A;  1RCE A;  3UFB A;  2CLU A;  2FKZ A;  4M32 A;  4TOG A;  5D8Y A;  2C2J A;  4ZKH A;  3AF9 X;  2UX1 A;  5D8Q A;  3PVR A;  1UMN A;  1OTK A;  4CVT A;  1L8H A;  3KA8 A;  4LPM A;  3OGH A;  3SHX A;  4ZMC A;  1TJO A;  1O9R A;  3F34 A;  2Y3Q A;  3BVK A;  4LQJ A;  1TK6 A;  3NOZ X;  3PW8 C;  5K53 A;  3NP0 X;  3GGY A;  5D8O A;  3E1L A;  3O7S A;  4CVR A;  3A9Q A;  4LQN A;  1RCD A;  2ZA7 A;  3PVR B;  3F39 A;  3C21 A;  2XJN A;  2HR5 A;  1ZUJ A;  2V2N A;  2QQY A;  2BK6 A;  1B71 A;  4WJG 4;  2CWL A;  5HJH A;  1UVH A;  2ZG7 X;  3R2K A;  1S2Z A;  5FFB A;  3QVD A;  1N1Q A;  1NNQ A;  1JRE A;  3E1M A;  3H7G A;  3KA4 A;  4YVZ A;  3QHB A;  4II4 A;  4CY9 A;  5JDO B;  3EGM A;  1BCF A;  3FRR A;  1VJX A;  4ITT A;  3FI6 A;  4W4L B;  4ITW A;  3N6O A;  2V2L A;  1LKM A;  5FFA A;  3IS7 A;  3IS8 A;  3F38 A;  3BVI A;  4ERU A;  5HJF A;  1VEI A;  2C2U A;  3PWQ A;  3R2R A;  2HTN A;  3E1O A;  4PG0 A;  1YUX A;  4CMY V;  3PVT A;  4II4 B;  3RAV A;  4IWK A;  1QGH A;  4TOB A;  3PVY A;  2FG4 A;  1AEW A;  4XKU A;  3SID A;  2OC5 A;  2JD8 0;  4EVE A;  3Q4N A;  4RC8 A;  2CIH A;  4DYZ A;  2CN6 A;  2BW1 A;  3U90 A;  3RE7 A;  1KRQ A;  3TA8 A;  5D8P A;  1Z6O A;  3BT5 A;  3PWF A;  2VXX A;  3GVY A;  4EVB A;  2D5K A;  1XZ3 A;  1RYT A;  3EZ0 A;  5I4J A;  3Q4R A;  4ZLW A;  4CYB A;  4YXM A;  4TOE A;  1R03 A;  4QUW A;  4TOD A;  5C6F A;  4LPJ A;  2FL0 A;  3F32 A;  3QB9 A;  3C23 A;  4ZL6 A;  2FFX J;  3PVY B;  5CZU A;  3IQ1 A;  4KVR A;  4AM4 A;  5J8S A;  3FRS A;  2X17 0;  1JI4 A;  2V15 A;  2MGY A;  1LKP A;  4CYA A;  2BJY A;  3HIU A;  5JKM G;  4DAS A;  2N02 A;  3UNO A;  3FVB A;  2IU2 A;  2ITB A;  4REU A;  4KVQ A;  3Q4Q A;  2CHP A;  4IXK A;  2Z6M A;  4YKH A;  5E2D A;  2G4H A;  1SQ3 A;  4ZTT A;  1VLG A;  3C1Z A;  5LS9 A;  1ZS3 A;  1YV1 A;  3SE1 A;  5ERJ A;  2OH3 A;  2PYB A;  5JKM A;  3F36 A;  4XKT A;  5D8S A;  2CF7 A;  3RD0 A;  2F7N A;  5FEJ A;  3D19 A;  1JGC A;  3PW8 A;  1TKP A;  3MPS A;  5GOU A;  1JKV A;  3KA9 A;  3RBC A;  3SH6 A;  4TO9 A;  4TOC A;  2V2J A;  2C6R A;  3PW1 A;  5GU2 X;  3WVU A;  1JKU A;  4RC5 A;  2YW7 A;  4DYX A;  1NFV A;  3EZU A;  1NF4 A;  2QF9 A;  3E1Q A;  4M35 A;  5GU1 X;  4RC7 A;  2FHA A;  4DZ0 A;  1MOJ A;  4E40 A;  4M34 A;  5GN8 A;  4MKU A;  5J93 A;  1S3Q A;  4ZKX A;  3VVA A;  3C1Y A;  2V8U A;  1IER A;  5D8R A;  4CMY A;  3WNW A;  3AJP A;  5D8X A;  1Z6O M;  2ZA6 A;  4DYY A;  4RC5 B;  1GWG A;  4XGS A;  2RBD A;  2VXI A;  2Y44 A;  5J9V A;  3QZ3 A;  4RC7 B;  3DBY A;  2JD7 0;  2Z5R A;  2CN7 A;  5HQO A;  1RCG A;  5JKL A;  5CMR A;  5GN8 B;  3T9J A;  5FFC A;  2GYQ A;  2G38 B;  1DAT A;  2Z5P A;  5JAC A;  3WVW A;  4ETR A;  4ISM A;  3KA3 A;  3L0M A;  4MJY A;  5LG8 A;  4LYU A;  2FZF A;  3R2S A;  4ML5 A;  2CEI A;  2Z90 A;  4CVS A;  2ZG9 X;  3PVT B;  5GU0 X;  5IX6 A;  2GS4 A;  3VNX A;  5GU3 X;  2JD6 0;  3KX9 A;  1RCI A;  2YJJ A;  3E6R A;  3HL1 A;  3UOF A;  2IY4 A;  3R2M A;  2W0O A;  4MUD A;  3JZA B;  3BKN A;  4PG1 A;  2V2O A;  4TOF A;  2V2M A;  4X0J A;  4AM5 A;  4OYN A;  4MY7 A;  2V8T A;  1JYB A;  1JI5 A;  4YXJ A;  3M6J A;  4PGK A;  3NP2 X;  1L8I A;  3AF7 X;  1DPS A;  2OKC A;  2GYD A;  2ZA8 A;  2VZB A;  1VEL A;  3F33 A;  3LKD A;  3KHK A;  2BKC A;  2IB0 A;  3AK9 A;  1VEQ A;  3O7R A;  4XKS A;  4P18 A;  4ISP A;  3FSE A;  3PZA A;  4DE6 A;  3VV9 A;  3KWO A;  3A68 A;  5ERK A;  4TW3 A;  4DI0 A;  1IES A;  4M33 A;  2WWX B;  4DYU A;  1BG7 A;  1YUZ A;  4Z3B A;  1RCC A;  3OJ5 A;  3E2C A;  2FJC A;  4LQH A;  4TOA A;  4MN9 A;  4EVD A;  1EUM A;  3GE4 A;  3RGD A;  5JDO A;  4IWJ A;  3R2L A;  4Z5S A;  2V2S A;  2YJK A;  4PGI A;  1JTS A;  1LKO A;  2CLB A;  2XJM A;  1J30 A;  1O9I A;  2V2P A;  1NF6 A;  5K52 A;  3V3K B;  4TOH A;  1MFR A;  4CVP A;  2WLU A;  3GGZ A;  3R2H A;  1QYB A;  3PWQ C;  3JZ9 A;  4ZJK A;  3BVE A;  2V2I A;  2XKQ A;  4A25 A;  5JKL G;  4RC6 A;  3ES3 A;  3E6S A;  3KXU A;  5AXS A;  1JIG A;  2CHI A;  5LG2 A;  3E1N A;  1BFR A;  1S30 A;  4ZL5 A;  3ISF A;  3F37 A;  3KA6 A;  5FFE A;  1F30 A;  3PW1 B;  5CMQ A;  2FG8 A;  2ZG8 X;  2C41 A;  3WVV A;  4E6K A;  1Z4A A;  1HRS A;  1H96 A;  3UOI A;  5HU6 D;  2XJO A;  3GHQ A;  4KXR B;  4Y08 A;  4W4K B;  5LBH A;  3AJQ A;  5E1U A;  5FFD A;  5J8W A;  2Z5Q A;  3QD8 A;  4RC6 B;  2C2F A;  3AK8 A;  1TKO A;  4R42 A;  3F35 A;  3ERZ A;  1FHA A;  3R2O A;  4U3G A;  2ZUR X;  2XGW A;  4EVC A;  2V2R A;  3E1J A;  3AJO A; 
#chains in the Genus database with same CATH homology
 4LPN A;  4LQV A;  3E1P A;  1SOF A;  4MXP A;  4AM2 A;  2WLA A;  2WTL A;  1F33 A;  3AF8 X;  1XZ1 A;  1DVB A;  4LYX A;  3BVL A;  3W54 A;  4ZKW A;  2YW6 A;  3KDQ A;  3Q4O A;  2AR0 A;  3BVF A;  4KVS A;  1LB3 A;  3ISE A;  3QHC A;  1RCE A;  3UFB A;  2CLU A;  2FKZ A;  4M32 A;  4TOG A;  5D8Y A;  2C2J A;  4ZKH A;  3AF9 X;  2UX1 A;  5D8Q A;  3PVR A;  1UMN A;  1OTK A;  4CVT A;  1L8H A;  3KA8 A;  4LPM A;  3OGH A;  3SHX A;  4ZMC A;  1TJO A;  1O9R A;  3F34 A;  2Y3Q A;  3BVK A;  4LQJ A;  1TK6 A;  3NOZ X;  3PW8 C;  5K53 A;  3NP0 X;  3GGY A;  5D8O A;  3E1L A;  3O7S A;  4CVR A;  3A9Q A;  4LQN A;  1RCD A;  2ZA7 A;  3PVR B;  3F39 A;  3C21 A;  2XJN A;  2HR5 A;  1ZUJ A;  2V2N A;  2QQY A;  2BK6 A;  1B71 A;  4WJG 4;  2CWL A;  5HJH A;  1UVH A;  2ZG7 X;  3R2K A;  1S2Z A;  5FFB A;  3QVD A;  1N1Q A;  1NNQ A;  1JRE A;  3E1M A;  3H7G A;  3KA4 A;  4YVZ A;  3QHB A;  4II4 A;  4CY9 A;  5JDO B;  3EGM A;  1BCF A;  3FRR A;  1VJX A;  4ITT A;  3FI6 A;  4W4L B;  4ITW A;  3N6O A;  2V2L A;  1LKM A;  5FFA A;  3IS7 A;  3IS8 A;  3F38 A;  3BVI A;  4ERU A;  5HJF A;  1VEI A;  2C2U A;  3PWQ A;  3R2R A;  2HTN A;  3E1O A;  4PG0 A;  1YUX A;  4CMY V;  3PVT A;  4II4 B;  3RAV A;  4IWK A;  1QGH A;  4TOB A;  3PVY A;  2FG4 A;  1AEW A;  4XKU A;  3SID A;  2OC5 A;  2JD8 0;  4EVE A;  3Q4N A;  4RC8 A;  2CIH A;  4DYZ A;  2CN6 A;  2BW1 A;  3U90 A;  3RE7 A;  1KRQ A;  3TA8 A;  5D8P A;  1Z6O A;  3BT5 A;  3PWF A;  2VXX A;  3GVY A;  4EVB A;  2D5K A;  1XZ3 A;  1RYT A;  3EZ0 A;  5I4J A;  3Q4R A;  4ZLW A;  4CYB A;  4YXM A;  4TOE A;  1R03 A;  4QUW A;  4TOD A;  5C6F A;  4LPJ A;  2FL0 A;  3F32 A;  3QB9 A;  3C23 A;  4ZL6 A;  2FFX J;  3PVY B;  5CZU A;  3IQ1 A;  4KVR A;  4AM4 A;  5J8S A;  3FRS A;  2X17 0;  1JI4 A;  2V15 A;  2MGY A;  1LKP A;  4CYA A;  2BJY A;  3HIU A;  5JKM G;  4DAS A;  2N02 A;  3UNO A;  3FVB A;  2IU2 A;  2ITB A;  4REU A;  4KVQ A;  3Q4Q A;  2CHP A;  4IXK A;  2Z6M A;  4YKH A;  5E2D A;  2G4H A;  1SQ3 A;  4ZTT A;  1VLG A;  3C1Z A;  5LS9 A;  1ZS3 A;  1YV1 A;  3SE1 A;  5ERJ A;  2OH3 A;  2PYB A;  5JKM A;  3F36 A;  4XKT A;  5D8S A;  2CF7 A;  3RD0 A;  2F7N A;  5FEJ A;  3D19 A;  1JGC A;  3PW8 A;  1TKP A;  3MPS A;  5GOU A;  1JKV A;  3KA9 A;  3RBC A;  3SH6 A;  4TO9 A;  4TOC A;  2V2J A;  2C6R A;  3PW1 A;  5GU2 X;  3WVU A;  1JKU A;  4RC5 A;  2YW7 A;  4DYX A;  1NFV A;  3EZU A;  1NF4 A;  2QF9 A;  3E1Q A;  4M35 A;  5GU1 X;  4RC7 A;  2FHA A;  4DZ0 A;  1MOJ A;  4E40 A;  4M34 A;  5GN8 A;  4MKU A;  5J93 A;  1S3Q A;  4ZKX A;  3VVA A;  3C1Y A;  2V8U A;  1IER A;  5D8R A;  4CMY A;  3WNW A;  3AJP A;  5D8X A;  1Z6O M;  2ZA6 A;  4DYY A;  4RC5 B;  1GWG A;  4XGS A;  2RBD A;  2VXI A;  2Y44 A;  5J9V A;  3QZ3 A;  4RC7 B;  3DBY A;  2JD7 0;  2Z5R A;  2CN7 A;  5HQO A;  1RCG A;  5JKL A;  5CMR A;  5GN8 B;  3T9J A;  5FFC A;  2GYQ A;  2G38 B;  1DAT A;  2Z5P A;  5JAC A;  3WVW A;  4ETR A;  4ISM A;  3KA3 A;  3L0M A;  4MJY A;  5LG8 A;  4LYU A;  2FZF A;  3R2S A;  4ML5 A;  2CEI A;  2Z90 A;  4CVS A;  2ZG9 X;  3PVT B;  5GU0 X;  5IX6 A;  2GS4 A;  3VNX A;  5GU3 X;  2JD6 0;  3KX9 A;  1RCI A;  2YJJ A;  3E6R A;  3HL1 A;  3UOF A;  2IY4 A;  3R2M A;  2W0O A;  4MUD A;  3JZA B;  3BKN A;  4PG1 A;  2V2O A;  4TOF A;  2V2M A;  4X0J A;  4AM5 A;  4OYN A;  4MY7 A;  2V8T A;  1JYB A;  1JI5 A;  4YXJ A;  3M6J A;  4PGK A;  3NP2 X;  1L8I A;  3AF7 X;  1DPS A;  2OKC A;  2GYD A;  2ZA8 A;  2VZB A;  1VEL A;  3F33 A;  3LKD A;  3KHK A;  2BKC A;  2IB0 A;  3AK9 A;  1VEQ A;  3O7R A;  4XKS A;  4P18 A;  4ISP A;  3FSE A;  3PZA A;  4DE6 A;  3VV9 A;  3KWO A;  3A68 A;  5ERK A;  4TW3 A;  4DI0 A;  1IES A;  4M33 A;  2WWX B;  4DYU A;  1BG7 A;  1YUZ A;  4Z3B A;  1RCC A;  3OJ5 A;  3E2C A;  2FJC A;  4LQH A;  4TOA A;  4MN9 A;  4EVD A;  1EUM A;  3GE4 A;  3RGD A;  5JDO A;  4IWJ A;  3R2L A;  4Z5S A;  2V2S A;  2YJK A;  4PGI A;  1JTS A;  1LKO A;  2CLB A;  2XJM A;  1J30 A;  1O9I A;  2V2P A;  1NF6 A;  5K52 A;  3V3K B;  4TOH A;  1MFR A;  4CVP A;  2WLU A;  3GGZ A;  3R2H A;  1QYB A;  3PWQ C;  3JZ9 A;  4ZJK A;  3BVE A;  2V2I A;  2XKQ A;  4A25 A;  5JKL G;  4RC6 A;  3ES3 A;  3E6S A;  3KXU A;  5AXS A;  1JIG A;  2CHI A;  5LG2 A;  3E1N A;  1BFR A;  1S30 A;  4ZL5 A;  3ISF A;  3F37 A;  3KA6 A;  5FFE A;  1F30 A;  3PW1 B;  5CMQ A;  2FG8 A;  2ZG8 X;  2C41 A;  3WVV A;  4E6K A;  1Z4A A;  1HRS A;  1H96 A;  3UOI A;  5HU6 D;  2XJO A;  3GHQ A;  4KXR B;  4Y08 A;  4W4K B;  5LBH A;  3AJQ A;  5E1U A;  5FFD A;  5J8W A;  2Z5Q A;  3QD8 A;  4RC6 B;  2C2F A;  3AK8 A;  1TKO A;  4R42 A;  3F35 A;  3ERZ A;  1FHA A;  3R2O A;  4U3G A;  2ZUR X;  2XGW A;  4EVC A;  2V2R A;  3E1J A;  3AJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...