2GYQA

Ycfi, a putative structural protein from rhodopseudomonas palustris.
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
169
structure length
162
Chain Sequence
b'MGFFSRDIQTMEDLLLHGLRDIYYAEQQITKALPKMIEQATNRDLSQGLTSHLEETQKQIERLDQVFKKLGQKPSGVNCPAIDGLIKEADETAGEIADKTVLDAAIVANAQAVEHYEIARYGTLIAWAEELGHDDIVRFLTTNLNEEKAANTKLNTVALRAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ycfI, putative structural protein
publication title X-ray crystal structure of YcfI protein, a putative structural protein from Rhodopseudomonas palustris.
rcsb
source organism Rhodopseudomonas palustris
molecule tags Structural genomics, unknown function
total genus 74
structure length 162
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05974 DUF892 Domain of unknown function (DUF892)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2gyqA00
2IB0A 5D8QA 5HJHA 4TOGA 2VXXA 2V2SA 1L8IA 1UMNA 5D8OA 3IQ1A 4ISMA 2YJKA 2FL0A 3ISFA 4TW3A 3Q4RA 3FSEA 4CY9A 1RYTA 2OC5A 3AF7X 2Z5PA 1F30A 2FFXJ 3PVRA 4XGSA 1ZUJA 2ITBA 3KA4A 4RC6A 3KA3A 4PGKA 1SOFA 2C2UA 1LKPA 1LKMA 2XJOA 4TOCA 3PVTB 4CVRA 4Z3BA 4TOEA 3BKNA 5GN8A 1AEWA 4MUDA 3HIUA 2QF9A 3MPSA 4DYZA 2XGWA 5I4JA 4ZTTA 2GYQA 3IS8A 1MFRA 3F34A 3WNWA 2X170 3RAVA 5LG8A 3Q4QA 1LKOA 3QVDA 4MKUA 5D8YA 3SIDA 1EUMA 3RBCA 4CMYA 2W0OA 4ZLWA 3Q4NA 4LYXA 5HJFA 2BK6A 4AM5A 2CF7A 1YV1A 2Y3QA 5LG2A 3ERZA 1Z6OA 3QZ3A 3RGDA 2QQYA 5FFCA 3PVRB 4MY7A 3E6RA 3BVFA 3WVWA 1TK6A 2V2RA 4R42A 1R03A 2YW6A 4RC6B 1VEIA 4XKUA 4CMYV 3A9QA 1JKVA 1VJXA 1Z4AA 3AK9A 3UOIA 3O7SA 3SE1A 1FHAA 5GN8B 4CYBA 1S2ZA 3R2MA 1O9RA 5E1UA 5CMQA 4LPNA 1RCEA 1DVBA 1S30A 2IY4A 4M34A 4RC5A 1IERA 5GOUA 2V2LA 4ZJKA 2BW1A 3U90A 1LB3A 1XZ1A 4M33A 3PZAA 3FI6A 3FVBA 2F7NA 4ISPA 3R2OA 3TA8A 4XKSA 3E6SA 3F39A 5D8SA 5CZUA 4TO9A 3WVVA 3PWQA 2D5KA 3NP0X 3E1QA 5E2DA 4DI0A 5FEJA 2Z5QA 3SH6A 4M35A 2CN6A 5GU1X 4IWJA 1BG7A 5J9VA 5FFBA 5JKLA 3IS7A 3R2LA 4RC5B 1JIGA 3NP2X 3ISEA 1NFVA 4ZKHA 4EVCA 5JACA 2RBDA 2WLAA 2XJNA 5AXSA 2Z90A 3E2CA 3PW1A 2BKCA 3KA8A 2JD60 4EVEA 2JD70 1RCIA 1QGHA 1UVHA 5ERKA 2XJMA 4LQVA 2WLUA 3KWOA 4QUWA 3AK8A 2UX1A 4M32A 1QYBA 4CVSA 3KA9A 3AJQA 3ES3A 4LYUA 4AM4A 4EVBA 4YKHA 4ZMCA 4ITTA 3QB9A 1JGCA 3BT5A 2V15A 4LQNA 3F36A 5LS9A 3AJPA 2V2NA 4TOBA 1VELA 3PW1B 1BFRA 5JKLG 2C41A 1Z6OM 5J8WA 5FFDA 3QHCA 3F35A 1NNQA 2OH3A 2V2JA 3EZ0A 3RE7A 4TODA 5D8PA 5D8RA 2GS4A 3PW8A 2ZA7A 4RC7A 1VLGA 2Z5RA 3R2SA 4AM2A 3RD0A 4ZL6A 3F38A 4ZKXA 4Z5SA 2HR5A 3Q4OA 5LBHA 5GU3X 3E1JA 2YJJA 1YUXA 2G4HA 2V2IA 4EVDA 4IXKA 4DE6A 3BVIA 2FZFA 4RC8A 4CVPA 4REUA 3PVYA 2C2JA 4LQHA 5C6FA 5JKMA 2C2FA 5J93A 3AF9X 3R2RA 4MJYA 2JD80 3UOFA 1L8HA 3PWQC 3T9JA 4ML5A 1XZ3A 1NF4A 4U3GA 5HQOA 1SQ3A 1IESA 1O9IA 2ZURX 4LPMA 3BVEA 3GHQA 2V2MA 4RC7B 4OYNA 4ITWA 3GE4A 3GVYA 4KVRA 4XKTA 2VXIA 4II4A 3WVUA 3BVLA 3SHXA 2GYDA 4E6KA 4TOFA 2CIHA 2PYBA 1DATA 4ETRA 3VNXA 4ZKWA 1MOJA 5GU2X 3H7GA 3PVYB 3KA6A 2ZG9X 3KXUA 2IU2A 2FG4A 3E1MA 4A25A 4CVTA 4KVQA 4LQJA 1JKUA 3R2KA 4PG1A 5JKMG 1GWGA 4PG0A 5IX6A 4MN9A 2CEIA 3EGMA 2ZA6A 1F33A 1BCFA 3F37A 2FG8A 3R2HA 1RCDA 3F32A 3HL1A 3OJ5A 1JREA 4II4B 4ERUA 2VZBA 5GU0X 2FHAA 1DPSA 2CLBA 3F33A 3QD8A 4DYUA 3UNOA 3EZUA 5CMRA 3O7RA 4DZ0A 2ZA8A 2XKQA 1TJOA 1NF6A 5K53A 1H96A 4Y08A 4LPJA 1S3QA 3PW8C 1ZS3A 4PGIA 2C6RA 1RCCA 3AJOA 2ZG8X 2YW7A 4TOHA 2CLUA 3A68A 4CYAA 4KVSA 5FFAA 1N1QA 2CHPA 3E1LA 2HTNA 4TOAA 3QHBA 1J30A 5ERJA 1YUZA 1TKPA 1KRQA 2FJCA 3OGHA 1OTKA 5D8XA 1JYBA 1RCGA 5K52A 1B71A 1JI4A 2CHIA 1JI5A 5FFEA 3E1NA 3NOZX 4DYYA 2ZG7X 2V2OA 3E1PA 3E1OA 2V2PA 4IWKA 3KX9A 3BVKA 2Z6MA 4P18A 4ZL5A 3PWFA 3AF8X 1TKOA 1JTSA 3PVTA 2CN7A 2FKZA 4DASA 4DYXA 1VEQA 2WTLA 5J8SA 1HRSA 2BJYA
chains in the Genus database with same CATH superfamily
2IB0A 5D8QA 5HJHA 4TOGA 2MGYA 2VXXA 2V2SA 4E40A 1L8IA 1UMNA 5D8OA 3IQ1A 4ISMA 3FRSA 2YJKA 4YXJA 2V8TA 2FL0A 3ISFA 4TW3A 3Q4RA 3FSEA 4CY9A 1RYTA 2OC5A 3AF7X 3FRRA 2Z5PA 1F30A 2FFXJ 3PVRA 4XGSA 1ZUJA 2ITBA 3KA4A 4RC6A 3KA3A 4PGKA 1SOFA 2C2UA 1LKPA 3GGZA 1LKMA 2XJOA 4TOCA 3PVTB 4CVRA 4Z3BA 4TOEA 3VV9A 3BKNA 5GN8A 1AEWA 4MUDA 3HIUA 2QF9A 3MPSA 4DYZA 2XGWA 5I4JA 4ZTTA 2GYQA 3IS8A 1MFRA 3F34A 3WNWA 2X170 3RAVA 5LG8A 3Q4QA 1LKOA 3C1YA 3QVDA 4MKUA 5D8YA 3SIDA 1EUMA 3RBCA 4CMYA 2W0OA 4ZLWA 3Q4NA 4LYXA 5HJFA 2BK6A 4AM5A 2CF7A 1YV1A 2Y3QA 5LG2A 3ERZA 1Z6OA 3QZ3A 3RGDA 2QQYA 5FFCA 3PVRB 4MY7A 2OKCA 3E6RA 3BVFA 3WVWA 1TK6A 2V2RA 4R42A 1R03A 2YW6A 4RC6B 1VEIA 4XKUA 4CMYV 3A9QA 1JKVA 1VJXA 1Z4AA 3AK9A 3UOIA 3O7SA 3SE1A 1FHAA 5GN8B 4CYBA 1S2ZA 3R2MA 1O9RA 5E1UA 5CMQA 4LPNA 1RCEA 1DVBA 1S30A 2IY4A 4M34A 4RC5A 1IERA 5JDOA 2G38B 5GOUA 2V2LA 4ZJKA 2BW1A 3U90A 1LB3A 1XZ1A 4M33A 3PZAA 3FI6A 3FVBA 2F7NA 4ISPA 3R2OA 2Y44A 3TA8A 4XKSA 3LKDA 3E6SA 3F39A 5D8SA 5CZUA 4TO9A 3WVVA 3PWQA 2D5KA 3NP0X 3E1QA 5E2DA 4DI0A 5FEJA 2Z5QA 3SH6A 4M35A 2CN6A 5GU1X 4IWJA 1BG7A 5J9VA 5FFBA 5JKLA 3IS7A 3R2LA 4RC5B 1JIGA 3NP2X 3ISEA 1NFVA 4ZKHA 5JDOB 4EVCA 5JACA 2RBDA 2WLAA 2XJNA 5AXSA 2Z90A 3E2CA 3PW1A 2BKCA 3KA8A 2JD60 4EVEA 2JD70 1RCIA 1QGHA 3GGYA 1UVHA 3KHKA 5ERKA 2XJMA 4LQVA 2WLUA 3KWOA 4QUWA 3AK8A 2UX1A 4M32A 1QYBA 4CVSA 3KA9A 3AJQA 3ES3A 4LYUA 4AM4A 4EVBA 3DBYA 4YKHA 2AR0A 4ZMCA 4ITTA 3QB9A 1JGCA 3BT5A 4WJG4 2V15A 4LQNA 3F36A 2WWXB 5LS9A 3AJPA 2V2NA 3L0MA 4TOBA 1VELA 3PW1B 1BFRA 5JKLG 2C41A 1Z6OM 5J8WA 3C23A 5FFDA 2V8UA 3QHCA 3F35A 1NNQA 2OH3A 2V2JA 3EZ0A 3RE7A 4TODA 5D8PA 5D8RA 5HU6D 2GS4A 3PW8A 2ZA7A 3KDQA 4RC7A 1VLGA 2Z5RA 3R2SA 4AM2A 3RD0A 4ZL6A 3F38A 4ZKXA 4Z5SA 2HR5A 3Q4OA 5LBHA 3M6JA 5GU3X 3E1JA 2YJJA 1YUXA 2G4HA 2V2IA 4EVDA 4IXKA 4DE6A 3BVIA 2FZFA 4RC8A 4CVPA 4REUA 3PVYA 2C2JA 4LQHA 5C6FA 5JKMA 3VVAA 2C2FA 5J93A 3AF9X 3R2RA 4MJYA 2JD80 3UOFA 1L8HA 3PWQC 3T9JA 4ML5A 3C1ZA 1XZ3A 1NF4A 4U3GA 5HQOA 1SQ3A 1IESA 1O9IA 2ZURX 4LPMA 3BVEA 3GHQA 3D19A 2CWLA 2V2MA 4RC7B 4OYNA 4ITWA 3GE4A 3GVYA 4KXRB 4KVRA 4XKTA 2VXIA 4II4A 3WVUA 3BVLA 3SHXA 2GYDA 4E6KA 4TOFA 2CIHA 2PYBA 4W4KB 1DATA 4ETRA 3VNXA 4ZKWA 1MOJA 5GU2X 3H7GA 4YVZA 3PVYB 3KA6A 2ZG9X 3KXUA 2IU2A 2FG4A 3UFBA 3E1MA 4A25A 4CVTA 4KVQA 4LQJA 1JKUA 3C21A 3R2KA 4PG1A 5JKMG 1GWGA 4PG0A 5IX6A 4MN9A 4X0JA 2CEIA 3EGMA 2ZA6A 1F33A 1BCFA 3F37A 2FG8A 3R2HA 1RCDA 3F32A 3HL1A 3OJ5A 1JREA 4II4B 4ERUA 2VZBA 5GU0X 2FHAA 1DPSA 2CLBA 3F33A 3QD8A 4DYUA 3UNOA 3EZUA 5CMRA 4W4LB 3O7RA 4DZ0A 2ZA8A 2XKQA 1TJOA 1NF6A 5K53A 1H96A 4Y08A 4LPJA 1S3QA 3PW8C 1ZS3A 3JZ9A 4PGIA 3N6OA 2C6RA 1RCCA 3AJOA 2ZG8X 2YW7A 4TOHA 2CLUA 3A68A 4CYAA 4KVSA 5FFAA 1N1QA 2CHPA 3E1LA 2HTNA 4TOAA 3QHBA 1J30A 3V3KB 5ERJA 1YUZA 1TKPA 1KRQA 2FJCA 3OGHA 1OTKA 5D8XA 1JYBA 1RCGA 5K52A 1B71A 1JI4A 2CHIA 1JI5A 5FFEA 3E1NA 3NOZX 4DYYA 4YXMA 2ZG7X 2N02A 2V2OA 3E1PA 3E1OA 2V2PA 4IWKA 3KX9A 3BVKA 2Z6MA 4P18A 4ZL5A 3PWFA 3AF8X 1TKOA 1JTSA 3W54A 3PVTA 2CN7A 2FKZA 4DASA 4MXPA 4DYXA 1VEQA 2WTLA 3JZAB 5J8SA 1HRSA 2BJYA
chains in the Genus database with same CATH topology
2IB0A 5D8QA 5HJHA 4TOGA 2MGYA 2VXXA 2V2SA 4E40A 1L8IA 1UMNA 5D8OA 3IQ1A 4ISMA 3FRSA 2YJKA 4YXJA 2V8TA 2FL0A 3ISFA 4TW3A 3Q4RA 3FSEA 4CY9A 1RYTA 2OC5A 3AF7X 3FRRA 2Z5PA 1F30A 2FFXJ 3PVRA 4XGSA 1ZUJA 2ITBA 3KA4A 4RC6A 3KA3A 4PGKA 1SOFA 2C2UA 1LKPA 3GGZA 1LKMA 2XJOA 4TOCA 3PVTB 4CVRA 4Z3BA 4TOEA 3VV9A 3BKNA 5GN8A 1AEWA 4MUDA 3HIUA 2QF9A 3MPSA 4DYZA 2XGWA 5I4JA 4ZTTA 2GYQA 3IS8A 1MFRA 3F34A 3WNWA 2X170 3RAVA 5LG8A 3Q4QA 1LKOA 3C1YA 3QVDA 4MKUA 5D8YA 3SIDA 1EUMA 3RBCA 4CMYA 2W0OA 4ZLWA 3Q4NA 4LYXA 5HJFA 2BK6A 4AM5A 2CF7A 1YV1A 2Y3QA 5LG2A 3ERZA 1Z6OA 3QZ3A 3RGDA 2QQYA 5FFCA 3PVRB 4MY7A 2OKCA 3E6RA 3BVFA 3WVWA 1TK6A 2V2RA 4R42A 1R03A 2YW6A 4RC6B 1VEIA 4XKUA 4CMYV 3A9QA 1JKVA 1VJXA 1Z4AA 3AK9A 3UOIA 3O7SA 3SE1A 1FHAA 5GN8B 4CYBA 1S2ZA 3R2MA 1O9RA 5E1UA 5CMQA 4LPNA 1RCEA 1DVBA 1S30A 2IY4A 4M34A 4RC5A 1IERA 5JDOA 2G38B 5GOUA 2V2LA 4ZJKA 2BW1A 3U90A 1LB3A 1XZ1A 4M33A 3PZAA 3FI6A 3FVBA 2F7NA 4ISPA 3R2OA 2Y44A 3TA8A 4XKSA 3LKDA 3E6SA 3F39A 5D8SA 5CZUA 4TO9A 3WVVA 3PWQA 2D5KA 3NP0X 3E1QA 5E2DA 4DI0A 5FEJA 2Z5QA 3SH6A 4M35A 2CN6A 5GU1X 4IWJA 1BG7A 5J9VA 5FFBA 5JKLA 3IS7A 3R2LA 4RC5B 1JIGA 3NP2X 3ISEA 1NFVA 4ZKHA 5JDOB 4EVCA 5JACA 2RBDA 2WLAA 2XJNA 5AXSA 2Z90A 3E2CA 3PW1A 2BKCA 3KA8A 2JD60 4EVEA 2JD70 1RCIA 1QGHA 3GGYA 1UVHA 3KHKA 5ERKA 2XJMA 4LQVA 2WLUA 3KWOA 4QUWA 3AK8A 2UX1A 4M32A 1QYBA 4CVSA 3KA9A 3AJQA 3ES3A 4LYUA 4AM4A 4EVBA 3DBYA 4YKHA 2AR0A 4ZMCA 4ITTA 3QB9A 1JGCA 3BT5A 4WJG4 2V15A 4LQNA 3F36A 2WWXB 5LS9A 3AJPA 2V2NA 3L0MA 4TOBA 1VELA 3PW1B 1BFRA 5JKLG 2C41A 1Z6OM 5J8WA 3C23A 5FFDA 2V8UA 3QHCA 3F35A 1NNQA 2OH3A 2V2JA 3EZ0A 3RE7A 4TODA 5D8PA 5D8RA 5HU6D 2GS4A 3PW8A 2ZA7A 3KDQA 4RC7A 1VLGA 2Z5RA 3R2SA 4AM2A 3RD0A 4ZL6A 3F38A 4ZKXA 4Z5SA 2HR5A 3Q4OA 5LBHA 3M6JA 5GU3X 3E1JA 2YJJA 1YUXA 2G4HA 2V2IA 4EVDA 4IXKA 4DE6A 3BVIA 2FZFA 4RC8A 4CVPA 4REUA 3PVYA 2C2JA 4LQHA 5C6FA 5JKMA 3VVAA 2C2FA 5J93A 3AF9X 3R2RA 4MJYA 2JD80 3UOFA 1L8HA 3PWQC 3T9JA 4ML5A 3C1ZA 1XZ3A 1NF4A 4U3GA 5HQOA 1SQ3A 1IESA 1O9IA 2ZURX 4LPMA 3BVEA 3GHQA 3D19A 2CWLA 2V2MA 4RC7B 4OYNA 4ITWA 3GE4A 3GVYA 4KXRB 4KVRA 4XKTA 2VXIA 4II4A 3WVUA 3BVLA 3SHXA 2GYDA 4E6KA 4TOFA 2CIHA 2PYBA 4W4KB 1DATA 4ETRA 3VNXA 4ZKWA 1MOJA 5GU2X 3H7GA 4YVZA 3PVYB 3KA6A 2ZG9X 3KXUA 2IU2A 2FG4A 3UFBA 3E1MA 4A25A 4CVTA 4KVQA 4LQJA 1JKUA 3C21A 3R2KA 4PG1A 5JKMG 1GWGA 4PG0A 5IX6A 4MN9A 4X0JA 2CEIA 3EGMA 2ZA6A 1F33A 1BCFA 3F37A 2FG8A 3R2HA 1RCDA 3F32A 3HL1A 3OJ5A 1JREA 4II4B 4ERUA 2VZBA 5GU0X 2FHAA 1DPSA 2CLBA 3F33A 3QD8A 4DYUA 3UNOA 3EZUA 5CMRA 4W4LB 3O7RA 4DZ0A 2ZA8A 2XKQA 1TJOA 1NF6A 5K53A 1H96A 4Y08A 4LPJA 1S3QA 3PW8C 1ZS3A 3JZ9A 4PGIA 3N6OA 2C6RA 1RCCA 3AJOA 2ZG8X 2YW7A 4TOHA 2CLUA 3A68A 4CYAA 4KVSA 5FFAA 1N1QA 2CHPA 3E1LA 2HTNA 4TOAA 3QHBA 1J30A 3V3KB 5ERJA 1YUZA 1TKPA 1KRQA 2FJCA 3OGHA 1OTKA 5D8XA 1JYBA 1RCGA 5K52A 1B71A 1JI4A 2CHIA 1JI5A 5FFEA 3E1NA 3NOZX 4DYYA 4YXMA 2ZG7X 2N02A 2V2OA 3E1PA 3E1OA 2V2PA 4IWKA 3KX9A 3BVKA 2Z6MA 4P18A 4ZL5A 3PWFA 3AF8X 1TKOA 1JTSA 3W54A 3PVTA 2CN7A 2FKZA 4DASA 4MXPA 4DYXA 1VEQA 2WTLA 3JZAB 5J8SA 1HRSA 2BJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IB0 A;  5D8Q A;  5HJH A;  4TOG A;  2VXX A;  2V2S A;  1L8I A;  1UMN A;  5D8O A;  3IQ1 A;  4ISM A;  2YJK A;  2FL0 A;  3ISF A;  4TW3 A;  3Q4R A;  3FSE A;  4CY9 A;  1RYT A;  2OC5 A;  3AF7 X;  2Z5P A;  1F30 A;  2FFX J;  3PVR A;  4XGS A;  1ZUJ A;  2ITB A;  3KA4 A;  4RC6 A;  3KA3 A;  4PGK A;  1SOF A;  2C2U A;  1LKP A;  1LKM A;  2XJO A;  4TOC A;  3PVT B;  4CVR A;  4Z3B A;  4TOE A;  3BKN A;  5GN8 A;  1AEW A;  4MUD A;  3HIU A;  2QF9 A;  3MPS A;  4DYZ A;  2XGW A;  5I4J A;  4ZTT A;  2GYQ A;  3IS8 A;  1MFR A;  3F34 A;  3WNW A;  2X17 0;  3RAV A;  5LG8 A;  3Q4Q A;  1LKO A;  3QVD A;  4MKU A;  5D8Y A;  3SID A;  1EUM A;  3RBC A;  4CMY A;  2W0O A;  4ZLW A;  3Q4N A;  4LYX A;  5HJF A;  2BK6 A;  4AM5 A;  2CF7 A;  1YV1 A;  2Y3Q A;  5LG2 A;  3ERZ A;  1Z6O A;  3QZ3 A;  3RGD A;  2QQY A;  5FFC A;  3PVR B;  4MY7 A;  3E6R A;  3BVF A;  3WVW A;  1TK6 A;  2V2R A;  4R42 A;  1R03 A;  2YW6 A;  4RC6 B;  1VEI A;  4XKU A;  4CMY V;  3A9Q A;  1JKV A;  1VJX A;  1Z4A A;  3AK9 A;  3UOI A;  3O7S A;  3SE1 A;  1FHA A;  5GN8 B;  4CYB A;  1S2Z A;  3R2M A;  1O9R A;  5E1U A;  5CMQ A;  4LPN A;  1RCE A;  1DVB A;  1S30 A;  2IY4 A;  4M34 A;  4RC5 A;  1IER A;  5GOU A;  2V2L A;  4ZJK A;  2BW1 A;  3U90 A;  1LB3 A;  1XZ1 A;  4M33 A;  3PZA A;  3FI6 A;  3FVB A;  2F7N A;  4ISP A;  3R2O A;  3TA8 A;  4XKS A;  3E6S A;  3F39 A;  5D8S A;  5CZU A;  4TO9 A;  3WVV A;  3PWQ A;  2D5K A;  3NP0 X;  3E1Q A;  5E2D A;  4DI0 A;  5FEJ A;  2Z5Q A;  3SH6 A;  4M35 A;  2CN6 A;  5GU1 X;  4IWJ A;  1BG7 A;  5J9V A;  5FFB A;  5JKL A;  3IS7 A;  3R2L A;  4RC5 B;  1JIG A;  3NP2 X;  3ISE A;  1NFV A;  4ZKH A;  4EVC A;  5JAC A;  2RBD A;  2WLA A;  2XJN A;  5AXS A;  2Z90 A;  3E2C A;  3PW1 A;  2BKC A;  3KA8 A;  2JD6 0;  4EVE A;  2JD7 0;  1RCI A;  1QGH A;  1UVH A;  5ERK A;  2XJM A;  4LQV A;  2WLU A;  3KWO A;  4QUW A;  3AK8 A;  2UX1 A;  4M32 A;  1QYB A;  4CVS A;  3KA9 A;  3AJQ A;  3ES3 A;  4LYU A;  4AM4 A;  4EVB A;  4YKH A;  4ZMC A;  4ITT A;  3QB9 A;  1JGC A;  3BT5 A;  2V15 A;  4LQN A;  3F36 A;  5LS9 A;  3AJP A;  2V2N A;  4TOB A;  1VEL A;  3PW1 B;  1BFR A;  5JKL G;  2C41 A;  1Z6O M;  5J8W A;  5FFD A;  3QHC A;  3F35 A;  1NNQ A;  2OH3 A;  2V2J A;  3EZ0 A;  3RE7 A;  4TOD A;  5D8P A;  5D8R A;  2GS4 A;  3PW8 A;  2ZA7 A;  4RC7 A;  1VLG A;  2Z5R A;  3R2S A;  4AM2 A;  3RD0 A;  4ZL6 A;  3F38 A;  4ZKX A;  4Z5S A;  2HR5 A;  3Q4O A;  5LBH A;  5GU3 X;  3E1J A;  2YJJ A;  1YUX A;  2G4H A;  2V2I A;  4EVD A;  4IXK A;  4DE6 A;  3BVI A;  2FZF A;  4RC8 A;  4CVP A;  4REU A;  3PVY A;  2C2J A;  4LQH A;  5C6F A;  5JKM A;  2C2F A;  5J93 A;  3AF9 X;  3R2R A;  4MJY A;  2JD8 0;  3UOF A;  1L8H A;  3PWQ C;  3T9J A;  4ML5 A;  1XZ3 A;  1NF4 A;  4U3G A;  5HQO A;  1SQ3 A;  1IES A;  1O9I A;  2ZUR X;  4LPM A;  3BVE A;  3GHQ A;  2V2M A;  4RC7 B;  4OYN A;  4ITW A;  3GE4 A;  3GVY A;  4KVR A;  4XKT A;  2VXI A;  4II4 A;  3WVU A;  3BVL A;  3SHX A;  2GYD A;  4E6K A;  4TOF A;  2CIH A;  2PYB A;  1DAT A;  4ETR A;  3VNX A;  4ZKW A;  1MOJ A;  5GU2 X;  3H7G A;  3PVY B;  3KA6 A;  2ZG9 X;  3KXU A;  2IU2 A;  2FG4 A;  3E1M A;  4A25 A;  4CVT A;  4KVQ A;  4LQJ A;  1JKU A;  3R2K A;  4PG1 A;  5JKM G;  1GWG A;  4PG0 A;  5IX6 A;  4MN9 A;  2CEI A;  3EGM A;  2ZA6 A;  1F33 A;  1BCF A;  3F37 A;  2FG8 A;  3R2H A;  1RCD A;  3F32 A;  3HL1 A;  3OJ5 A;  1JRE A;  4II4 B;  4ERU A;  2VZB A;  5GU0 X;  2FHA A;  1DPS A;  2CLB A;  3F33 A;  3QD8 A;  4DYU A;  3UNO A;  3EZU A;  5CMR A;  3O7R A;  4DZ0 A;  2ZA8 A;  2XKQ A;  1TJO A;  1NF6 A;  5K53 A;  1H96 A;  4Y08 A;  4LPJ A;  1S3Q A;  3PW8 C;  1ZS3 A;  4PGI A;  2C6R A;  1RCC A;  3AJO A;  2ZG8 X;  2YW7 A;  4TOH A;  2CLU A;  3A68 A;  4CYA A;  4KVS A;  5FFA A;  1N1Q A;  2CHP A;  3E1L A;  2HTN A;  4TOA A;  3QHB A;  1J30 A;  5ERJ A;  1YUZ A;  1TKP A;  1KRQ A;  2FJC A;  3OGH A;  1OTK A;  5D8X A;  1JYB A;  1RCG A;  5K52 A;  1B71 A;  1JI4 A;  2CHI A;  1JI5 A;  5FFE A;  3E1N A;  3NOZ X;  4DYY A;  2ZG7 X;  2V2O A;  3E1P A;  3E1O A;  2V2P A;  4IWK A;  3KX9 A;  3BVK A;  2Z6M A;  4P18 A;  4ZL5 A;  3PWF A;  3AF8 X;  1TKO A;  1JTS A;  3PVT A;  2CN7 A;  2FKZ A;  4DAS A;  4DYX A;  1VEQ A;  2WTL A;  5J8S A;  1HRS A;  2BJY A; 
#chains in the Genus database with same CATH topology
 2IB0 A;  5D8Q A;  5HJH A;  4TOG A;  2MGY A;  2VXX A;  2V2S A;  4E40 A;  1L8I A;  1UMN A;  5D8O A;  3IQ1 A;  4ISM A;  3FRS A;  2YJK A;  4YXJ A;  2V8T A;  2FL0 A;  3ISF A;  4TW3 A;  3Q4R A;  3FSE A;  4CY9 A;  1RYT A;  2OC5 A;  3AF7 X;  3FRR A;  2Z5P A;  1F30 A;  2FFX J;  3PVR A;  4XGS A;  1ZUJ A;  2ITB A;  3KA4 A;  4RC6 A;  3KA3 A;  4PGK A;  1SOF A;  2C2U A;  1LKP A;  3GGZ A;  1LKM A;  2XJO A;  4TOC A;  3PVT B;  4CVR A;  4Z3B A;  4TOE A;  3VV9 A;  3BKN A;  5GN8 A;  1AEW A;  4MUD A;  3HIU A;  2QF9 A;  3MPS A;  4DYZ A;  2XGW A;  5I4J A;  4ZTT A;  2GYQ A;  3IS8 A;  1MFR A;  3F34 A;  3WNW A;  2X17 0;  3RAV A;  5LG8 A;  3Q4Q A;  1LKO A;  3C1Y A;  3QVD A;  4MKU A;  5D8Y A;  3SID A;  1EUM A;  3RBC A;  4CMY A;  2W0O A;  4ZLW A;  3Q4N A;  4LYX A;  5HJF A;  2BK6 A;  4AM5 A;  2CF7 A;  1YV1 A;  2Y3Q A;  5LG2 A;  3ERZ A;  1Z6O A;  3QZ3 A;  3RGD A;  2QQY A;  5FFC A;  3PVR B;  4MY7 A;  2OKC A;  3E6R A;  3BVF A;  3WVW A;  1TK6 A;  2V2R A;  4R42 A;  1R03 A;  2YW6 A;  4RC6 B;  1VEI A;  4XKU A;  4CMY V;  3A9Q A;  1JKV A;  1VJX A;  1Z4A A;  3AK9 A;  3UOI A;  3O7S A;  3SE1 A;  1FHA A;  5GN8 B;  4CYB A;  1S2Z A;  3R2M A;  1O9R A;  5E1U A;  5CMQ A;  4LPN A;  1RCE A;  1DVB A;  1S30 A;  2IY4 A;  4M34 A;  4RC5 A;  1IER A;  5JDO A;  2G38 B;  5GOU A;  2V2L A;  4ZJK A;  2BW1 A;  3U90 A;  1LB3 A;  1XZ1 A;  4M33 A;  3PZA A;  3FI6 A;  3FVB A;  2F7N A;  4ISP A;  3R2O A;  2Y44 A;  3TA8 A;  4XKS A;  3LKD A;  3E6S A;  3F39 A;  5D8S A;  5CZU A;  4TO9 A;  3WVV A;  3PWQ A;  2D5K A;  3NP0 X;  3E1Q A;  5E2D A;  4DI0 A;  5FEJ A;  2Z5Q A;  3SH6 A;  4M35 A;  2CN6 A;  5GU1 X;  4IWJ A;  1BG7 A;  5J9V A;  5FFB A;  5JKL A;  3IS7 A;  3R2L A;  4RC5 B;  1JIG A;  3NP2 X;  3ISE A;  1NFV A;  4ZKH A;  5JDO B;  4EVC A;  5JAC A;  2RBD A;  2WLA A;  2XJN A;  5AXS A;  2Z90 A;  3E2C A;  3PW1 A;  2BKC A;  3KA8 A;  2JD6 0;  4EVE A;  2JD7 0;  1RCI A;  1QGH A;  3GGY A;  1UVH A;  3KHK A;  5ERK A;  2XJM A;  4LQV A;  2WLU A;  3KWO A;  4QUW A;  3AK8 A;  2UX1 A;  4M32 A;  1QYB A;  4CVS A;  3KA9 A;  3AJQ A;  3ES3 A;  4LYU A;  4AM4 A;  4EVB A;  3DBY A;  4YKH A;  2AR0 A;  4ZMC A;  4ITT A;  3QB9 A;  1JGC A;  3BT5 A;  4WJG 4;  2V15 A;  4LQN A;  3F36 A;  2WWX B;  5LS9 A;  3AJP A;  2V2N A;  3L0M A;  4TOB A;  1VEL A;  3PW1 B;  1BFR A;  5JKL G;  2C41 A;  1Z6O M;  5J8W A;  3C23 A;  5FFD A;  2V8U A;  3QHC A;  3F35 A;  1NNQ A;  2OH3 A;  2V2J A;  3EZ0 A;  3RE7 A;  4TOD A;  5D8P A;  5D8R A;  5HU6 D;  2GS4 A;  3PW8 A;  2ZA7 A;  3KDQ A;  4RC7 A;  1VLG A;  2Z5R A;  3R2S A;  4AM2 A;  3RD0 A;  4ZL6 A;  3F38 A;  4ZKX A;  4Z5S A;  2HR5 A;  3Q4O A;  5LBH A;  3M6J A;  5GU3 X;  3E1J A;  2YJJ A;  1YUX A;  2G4H A;  2V2I A;  4EVD A;  4IXK A;  4DE6 A;  3BVI A;  2FZF A;  4RC8 A;  4CVP A;  4REU A;  3PVY A;  2C2J A;  4LQH A;  5C6F A;  5JKM A;  3VVA A;  2C2F A;  5J93 A;  3AF9 X;  3R2R A;  4MJY A;  2JD8 0;  3UOF A;  1L8H A;  3PWQ C;  3T9J A;  4ML5 A;  3C1Z A;  1XZ3 A;  1NF4 A;  4U3G A;  5HQO A;  1SQ3 A;  1IES A;  1O9I A;  2ZUR X;  4LPM A;  3BVE A;  3GHQ A;  3D19 A;  2CWL A;  2V2M A;  4RC7 B;  4OYN A;  4ITW A;  3GE4 A;  3GVY A;  4KXR B;  4KVR A;  4XKT A;  2VXI A;  4II4 A;  3WVU A;  3BVL A;  3SHX A;  2GYD A;  4E6K A;  4TOF A;  2CIH A;  2PYB A;  4W4K B;  1DAT A;  4ETR A;  3VNX A;  4ZKW A;  1MOJ A;  5GU2 X;  3H7G A;  4YVZ A;  3PVY B;  3KA6 A;  2ZG9 X;  3KXU A;  2IU2 A;  2FG4 A;  3UFB A;  3E1M A;  4A25 A;  4CVT A;  4KVQ A;  4LQJ A;  1JKU A;  3C21 A;  3R2K A;  4PG1 A;  5JKM G;  1GWG A;  4PG0 A;  5IX6 A;  4MN9 A;  4X0J A;  2CEI A;  3EGM A;  2ZA6 A;  1F33 A;  1BCF A;  3F37 A;  2FG8 A;  3R2H A;  1RCD A;  3F32 A;  3HL1 A;  3OJ5 A;  1JRE A;  4II4 B;  4ERU A;  2VZB A;  5GU0 X;  2FHA A;  1DPS A;  2CLB A;  3F33 A;  3QD8 A;  4DYU A;  3UNO A;  3EZU A;  5CMR A;  4W4L B;  3O7R A;  4DZ0 A;  2ZA8 A;  2XKQ A;  1TJO A;  1NF6 A;  5K53 A;  1H96 A;  4Y08 A;  4LPJ A;  1S3Q A;  3PW8 C;  1ZS3 A;  3JZ9 A;  4PGI A;  3N6O A;  2C6R A;  1RCC A;  3AJO A;  2ZG8 X;  2YW7 A;  4TOH A;  2CLU A;  3A68 A;  4CYA A;  4KVS A;  5FFA A;  1N1Q A;  2CHP A;  3E1L A;  2HTN A;  4TOA A;  3QHB A;  1J30 A;  3V3K B;  5ERJ A;  1YUZ A;  1TKP A;  1KRQ A;  2FJC A;  3OGH A;  1OTK A;  5D8X A;  1JYB A;  1RCG A;  5K52 A;  1B71 A;  1JI4 A;  2CHI A;  1JI5 A;  5FFE A;  3E1N A;  3NOZ X;  4DYY A;  4YXM A;  2ZG7 X;  2N02 A;  2V2O A;  3E1P A;  3E1O A;  2V2P A;  4IWK A;  3KX9 A;  3BVK A;  2Z6M A;  4P18 A;  4ZL5 A;  3PWF A;  3AF8 X;  1TKO A;  1JTS A;  3W54 A;  3PVT A;  2CN7 A;  2FKZ A;  4DAS A;  4MXP A;  4DYX A;  1VEQ A;  2WTL A;  3JZA B;  5J8S A;  1HRS A;  2BJY A; 
#chains in the Genus database with same CATH homology
 2IB0 A;  5D8Q A;  5HJH A;  4TOG A;  2MGY A;  2VXX A;  2V2S A;  4E40 A;  1L8I A;  1UMN A;  5D8O A;  3IQ1 A;  4ISM A;  3FRS A;  2YJK A;  4YXJ A;  2V8T A;  2FL0 A;  3ISF A;  4TW3 A;  3Q4R A;  3FSE A;  4CY9 A;  1RYT A;  2OC5 A;  3AF7 X;  3FRR A;  2Z5P A;  1F30 A;  2FFX J;  3PVR A;  4XGS A;  1ZUJ A;  2ITB A;  3KA4 A;  4RC6 A;  3KA3 A;  4PGK A;  1SOF A;  2C2U A;  1LKP A;  3GGZ A;  1LKM A;  2XJO A;  4TOC A;  3PVT B;  4CVR A;  4Z3B A;  4TOE A;  3VV9 A;  3BKN A;  5GN8 A;  1AEW A;  4MUD A;  3HIU A;  2QF9 A;  3MPS A;  4DYZ A;  2XGW A;  5I4J A;  4ZTT A;  2GYQ A;  3IS8 A;  1MFR A;  3F34 A;  3WNW A;  2X17 0;  3RAV A;  5LG8 A;  3Q4Q A;  1LKO A;  3C1Y A;  3QVD A;  4MKU A;  5D8Y A;  3SID A;  1EUM A;  3RBC A;  4CMY A;  2W0O A;  4ZLW A;  3Q4N A;  4LYX A;  5HJF A;  2BK6 A;  4AM5 A;  2CF7 A;  1YV1 A;  2Y3Q A;  5LG2 A;  3ERZ A;  1Z6O A;  3QZ3 A;  3RGD A;  2QQY A;  5FFC A;  3PVR B;  4MY7 A;  2OKC A;  3E6R A;  3BVF A;  3WVW A;  1TK6 A;  2V2R A;  4R42 A;  1R03 A;  2YW6 A;  4RC6 B;  1VEI A;  4XKU A;  4CMY V;  3A9Q A;  1JKV A;  1VJX A;  1Z4A A;  3AK9 A;  3UOI A;  3O7S A;  3SE1 A;  1FHA A;  5GN8 B;  4CYB A;  1S2Z A;  3R2M A;  1O9R A;  5E1U A;  5CMQ A;  4LPN A;  1RCE A;  1DVB A;  1S30 A;  2IY4 A;  4M34 A;  4RC5 A;  1IER A;  5JDO A;  2G38 B;  5GOU A;  2V2L A;  4ZJK A;  2BW1 A;  3U90 A;  1LB3 A;  1XZ1 A;  4M33 A;  3PZA A;  3FI6 A;  3FVB A;  2F7N A;  4ISP A;  3R2O A;  2Y44 A;  3TA8 A;  4XKS A;  3LKD A;  3E6S A;  3F39 A;  5D8S A;  5CZU A;  4TO9 A;  3WVV A;  3PWQ A;  2D5K A;  3NP0 X;  3E1Q A;  5E2D A;  4DI0 A;  5FEJ A;  2Z5Q A;  3SH6 A;  4M35 A;  2CN6 A;  5GU1 X;  4IWJ A;  1BG7 A;  5J9V A;  5FFB A;  5JKL A;  3IS7 A;  3R2L A;  4RC5 B;  1JIG A;  3NP2 X;  3ISE A;  1NFV A;  4ZKH A;  5JDO B;  4EVC A;  5JAC A;  2RBD A;  2WLA A;  2XJN A;  5AXS A;  2Z90 A;  3E2C A;  3PW1 A;  2BKC A;  3KA8 A;  2JD6 0;  4EVE A;  2JD7 0;  1RCI A;  1QGH A;  3GGY A;  1UVH A;  3KHK A;  5ERK A;  2XJM A;  4LQV A;  2WLU A;  3KWO A;  4QUW A;  3AK8 A;  2UX1 A;  4M32 A;  1QYB A;  4CVS A;  3KA9 A;  3AJQ A;  3ES3 A;  4LYU A;  4AM4 A;  4EVB A;  3DBY A;  4YKH A;  2AR0 A;  4ZMC A;  4ITT A;  3QB9 A;  1JGC A;  3BT5 A;  4WJG 4;  2V15 A;  4LQN A;  3F36 A;  2WWX B;  5LS9 A;  3AJP A;  2V2N A;  3L0M A;  4TOB A;  1VEL A;  3PW1 B;  1BFR A;  5JKL G;  2C41 A;  1Z6O M;  5J8W A;  3C23 A;  5FFD A;  2V8U A;  3QHC A;  3F35 A;  1NNQ A;  2OH3 A;  2V2J A;  3EZ0 A;  3RE7 A;  4TOD A;  5D8P A;  5D8R A;  5HU6 D;  2GS4 A;  3PW8 A;  2ZA7 A;  3KDQ A;  4RC7 A;  1VLG A;  2Z5R A;  3R2S A;  4AM2 A;  3RD0 A;  4ZL6 A;  3F38 A;  4ZKX A;  4Z5S A;  2HR5 A;  3Q4O A;  5LBH A;  3M6J A;  5GU3 X;  3E1J A;  2YJJ A;  1YUX A;  2G4H A;  2V2I A;  4EVD A;  4IXK A;  4DE6 A;  3BVI A;  2FZF A;  4RC8 A;  4CVP A;  4REU A;  3PVY A;  2C2J A;  4LQH A;  5C6F A;  5JKM A;  3VVA A;  2C2F A;  5J93 A;  3AF9 X;  3R2R A;  4MJY A;  2JD8 0;  3UOF A;  1L8H A;  3PWQ C;  3T9J A;  4ML5 A;  3C1Z A;  1XZ3 A;  1NF4 A;  4U3G A;  5HQO A;  1SQ3 A;  1IES A;  1O9I A;  2ZUR X;  4LPM A;  3BVE A;  3GHQ A;  3D19 A;  2CWL A;  2V2M A;  4RC7 B;  4OYN A;  4ITW A;  3GE4 A;  3GVY A;  4KXR B;  4KVR A;  4XKT A;  2VXI A;  4II4 A;  3WVU A;  3BVL A;  3SHX A;  2GYD A;  4E6K A;  4TOF A;  2CIH A;  2PYB A;  4W4K B;  1DAT A;  4ETR A;  3VNX A;  4ZKW A;  1MOJ A;  5GU2 X;  3H7G A;  4YVZ A;  3PVY B;  3KA6 A;  2ZG9 X;  3KXU A;  2IU2 A;  2FG4 A;  3UFB A;  3E1M A;  4A25 A;  4CVT A;  4KVQ A;  4LQJ A;  1JKU A;  3C21 A;  3R2K A;  4PG1 A;  5JKM G;  1GWG A;  4PG0 A;  5IX6 A;  4MN9 A;  4X0J A;  2CEI A;  3EGM A;  2ZA6 A;  1F33 A;  1BCF A;  3F37 A;  2FG8 A;  3R2H A;  1RCD A;  3F32 A;  3HL1 A;  3OJ5 A;  1JRE A;  4II4 B;  4ERU A;  2VZB A;  5GU0 X;  2FHA A;  1DPS A;  2CLB A;  3F33 A;  3QD8 A;  4DYU A;  3UNO A;  3EZU A;  5CMR A;  4W4L B;  3O7R A;  4DZ0 A;  2ZA8 A;  2XKQ A;  1TJO A;  1NF6 A;  5K53 A;  1H96 A;  4Y08 A;  4LPJ A;  1S3Q A;  3PW8 C;  1ZS3 A;  3JZ9 A;  4PGI A;  3N6O A;  2C6R A;  1RCC A;  3AJO A;  2ZG8 X;  2YW7 A;  4TOH A;  2CLU A;  3A68 A;  4CYA A;  4KVS A;  5FFA A;  1N1Q A;  2CHP A;  3E1L A;  2HTN A;  4TOA A;  3QHB A;  1J30 A;  3V3K B;  5ERJ A;  1YUZ A;  1TKP A;  1KRQ A;  2FJC A;  3OGH A;  1OTK A;  5D8X A;  1JYB A;  1RCG A;  5K52 A;  1B71 A;  1JI4 A;  2CHI A;  1JI5 A;  5FFE A;  3E1N A;  3NOZ X;  4DYY A;  4YXM A;  2ZG7 X;  2N02 A;  2V2O A;  3E1P A;  3E1O A;  2V2P A;  4IWK A;  3KX9 A;  3BVK A;  2Z6M A;  4P18 A;  4ZL5 A;  3PWF A;  3AF8 X;  1TKO A;  1JTS A;  3W54 A;  3PVT A;  2CN7 A;  2FKZ A;  4DAS A;  4MXP A;  4DYX A;  1VEQ A;  2WTL A;  3JZA B;  5J8S A;  1HRS A;  2BJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...