2V15A

Terbium binding in streptococcus suis dpr protein
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
151
structure length
151
Chain Sequence
LADSKAVLNQAVADLSVAHSILHQVHWYMRGRGFMIWHPKMDEYMEEIDGYLDEMSERLITLGGAPFSTLKEFSENSQLKEVLGDYNVTIEEQLARVVEVFRYLAALFQKGFDVSDEEGDSVTNDIFNVAKASIEKHIWMLQAELGQAPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DNA PROTECTION DURING STARVATION PROTEIN
publication title Structural basis of the zinc- and terbium-mediated inhibition of ferroxidase activity in Dps ferritin-like proteins.
pubmed doi rcsb
source organism Streptococcus suis
total genus 68
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.16.-.-:
pdb deposition date 2007-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2v15A00
2C6RA 2C2FA 5GOUA 3E1NA 3E1PA 4ITWA 1EUMA 5JACA 5FFEA 5D8OA 3AF8X 1RCIA 1BG7A 3BVIA 3UOIA 1JIGA 2XJOA 4MUDA 2BKCA 5CMQA 1KRQA 4II4A 2HTNA 4IXKA 5JKMA 3RD0A 1RCGA 2ZG8X 3PVRA 1ZS3A 4TOFA 5HJFA 4TOAA 2FJCA 4ZKWA 5GU0X 5D8RA 4EVEA 4LPJA 2X170 3KA6A 4RC8A 2V15A 3PVYB 1NF4A 5JKMG 1BFRA 2Z5QA 3F36A 4XKUA 5LS9A 2ITBA 4Y08A 3PWQC 3IS8A 2FHAA 3IQ1A 4IWKA 4OYNA 2QQYA 4ZKXA 3T9JA 5LG8A 2CHIA 4LYXA 1JI4A 4CYAA 2W0OA 2WLAA 3PZAA 2VXIA 4RC5B 2CIHA 4RC6A 3WVWA 3F35A 4LQVA 5D8YA 3BVKA 2ZA8A 4AM4A 2VZBA 3IS7A 3E6RA 4EVBA 4DYYA 4CVTA 3RE7A 3QHBA 4KVSA 3HIUA 2GS4A 1JKUA 1O9IA 1IESA 5IX6A 4CMYV 3PVTA 1TKPA 4II4B 4ITTA 4DYXA 1H96A 3KXUA 1R03A 3PVRB 1HRSA 3KA3A 1Z6OA 1N1QA 2IY4A 5FEJA 4ZMCA 3SIDA 3QB9A 1OTKA 2ZG7X 3QHCA 4YKHA 2HR5A 3WVVA 4DYZA 3AK9A 1SOFA 5J8WA 2XKQA 3VNXA 4A25A 1UVHA 3Q4QA 3ERZA 3EZUA 3PW8C 5LBHA 5D8SA 2OH3A 2BJYA 2WTLA 1RCDA 1LKPA 1DPSA 5ERKA 3KA4A 1RCCA 3FI6A 2CHPA 3O7SA 3H7GA 3NP2X 4RC6B 2XJMA 4IWJA 1XZ1A 4MY7A 5GU2X 3TA8A 3O7RA 1VELA 4M35A 3WVUA 5GN8A 1MOJA 2CF7A 3F37A 3OGHA 2PYBA 1RCEA 5HQOA 1IERA 3R2KA 4TODA 1DVBA 2YW7A 2V2IA 3KWOA 3E2CA 3E1JA 4QUWA 3R2HA 1JTSA 4M33A 3PVTB 3QVDA 4PG0A 3PW1A 1GWGA 4ZJKA 2V2OA 1TK6A 1NFVA 2WLUA 1YUZA 5K53A 4E6KA 3GE4A 3NP0X 2RBDA 2YJKA 4LYUA 3GHQA 4ETRA 1FHAA 3MPSA 2C2UA 4CVRA 3GVYA 4Z3BA 1JKVA 2V2PA 2UX1A 1TJOA 2GYQA 3FVBA 3F39A 3E1OA 3E1QA 3R2MA 2BK6A 2CN7A 4ZL5A 3Q4NA 4TOHA 3Q4OA 1JGCA 5FFDA 3RGDA 1ZUJA 3ISFA 1UMNA 4PG1A 5D8PA 2IB0A 5HJHA 4RC7A 4LPNA 3U90A 4DYUA 4ZKHA 3AJQA 4ERUA 2V2NA 2QF9A 1LKMA 4TOCA 3QZ3A 3EGMA 3E1LA 1L8IA 3QD8A 3AJOA 4TOBA 1VEQA 4ZTTA 5GN8B 2FG8A 3WNWA 1QYBA 2CN6A 3FSEA 3SH6A 4XKSA 3AF7X 1L8HA 1QGHA 2CLUA 4CYBA 3A68A 1BCFA 2C41A 3F34A 1JREA 3PWQA 4KVQA 3SHXA 4ZLWA 3PW1B 4AM2A 1VEIA 3E6SA 3F32A 4TOGA 4TO9A 3AK8A 5ERJA 4XKTA 1NF6A 3A9QA 2ZA6A 1F30A 3RBCA 3E1MA 5J8SA 5CMRA 4LQNA 1VLGA 4CMYA 4DI0A 3HL1A 1DATA 3AF9X 4ISPA 4EVDA 1LKOA 1JI5A 2FL0A 3KA9A 4R42A 4MJYA 4LQJA 4XGSA 2ZURX 4M34A 2V2MA 3F38A 5D8XA 3BVLA 2V2SA 1MFRA 1VJXA 2V2LA 4U3GA 4CVSA 2C2JA 4CVPA 4MN9A 3KX9A 1S2ZA 4EVCA 1NNQA 3OJ5A 4LPMA 4ML5A 4RC7B 2FKZA 4TW3A 2Z5RA 2FFXJ 2Z90A 4PGKA 2G4HA 5J9VA 4KVRA 5E1UA 4DE6A 4AM5A 2D5KA 1B71A 2JD70 3NOZX 2IU2A 2CEIA 3Q4RA 5CZUA 3BVEA 5FFBA 2JD80 1YUXA 2Z5PA 1RYTA 5D8QA 1YV1A 5JKLA 2FG4A 2V2JA 5FFCA 3PW8A 5GU3X 3R2LA 2GYDA 4PGIA 3EZ0A 4Z5SA 2Z6MA 5E2DA 1S30A 1F33A 2V2RA 3ES3A 3F33A 5C6FA 3R2RA 4TOEA 3RAVA 3UNOA 3BKNA 2OC5A 2ZA7A 3PWFA 4M32A 2ZG9X 1JYBA 3KA8A 5JKLG 4ISMA 2F7NA 1AEWA 4DASA 2CLBA 5LG2A 3R2SA 3BVFA 4LQHA 1Z6OM 5I4JA 3ISEA 4P18A 4DZ0A 1S3QA 2BW1A 3PVYA 3R2OA 1O9RA 4MKUA 5FFAA 5K52A 1LB3A 2FZFA 4CY9A 3UOFA 1XZ3A 3SE1A 2YJJA 3AJPA 1J30A 2JD60 2VXXA 5J93A 5GU1X 4RC5A 4REUA 5AXSA 1TKOA 1SQ3A 2XGWA 1Z4AA 2YW6A 2XJNA 4ZL6A 2Y3QA 3BT5A
chains in the Genus database with same CATH superfamily
2C6RA 2C2FA 5GOUA 3E1NA 3E1PA 4ITWA 3M6JA 1EUMA 5JACA 3JZAB 5FFEA 5D8OA 3AF8X 1RCIA 1BG7A 3BVIA 3UOIA 1JIGA 2XJOA 4MUDA 2BKCA 5CMQA 1KRQA 2N02A 4II4A 2HTNA 4IXKA 5JKMA 4KXRB 3RD0A 1RCGA 2ZG8X 3PVRA 1ZS3A 4TOFA 5HJFA 4TOAA 2FJCA 4ZKWA 5GU0X 5D8RA 4EVEA 4LPJA 2X170 3KA6A 4RC8A 2V15A 3PVYB 1NF4A 5JKMG 1BFRA 2Z5QA 3F36A 4XKUA 3W54A 5LS9A 2ITBA 4Y08A 3PWQC 3IS8A 2FHAA 3IQ1A 4IWKA 4OYNA 2QQYA 4ZKXA 3T9JA 5LG8A 2CHIA 4LYXA 1JI4A 4CYAA 4YXMA 2W0OA 2WLAA 3PZAA 5HU6D 3GGYA 2VXIA 4RC5B 2CIHA 4RC6A 3WVWA 3F35A 4LQVA 5D8YA 3BVKA 2ZA8A 4AM4A 2VZBA 3IS7A 3E6RA 4EVBA 4DYYA 4CVTA 2MGYA 3RE7A 3QHBA 4KVSA 3HIUA 2GS4A 1JKUA 1O9IA 1IESA 5IX6A 4CMYV 3PVTA 1TKPA 3C1YA 4II4B 4ITTA 4DYXA 1H96A 2V8TA 3KXUA 1R03A 3PVRB 1HRSA 3KA3A 1Z6OA 1N1QA 4W4LB 2IY4A 5FEJA 4ZMCA 3SIDA 3QB9A 1OTKA 2ZG7X 3QHCA 4YKHA 2HR5A 3C1ZA 2OKCA 3WVVA 4DYZA 3AK9A 1SOFA 5J8WA 2XKQA 3FRSA 3VNXA 4A25A 1UVHA 3Q4QA 3ERZA 3EZUA 3PW8C 5LBHA 5D8SA 2OH3A 2BJYA 2WTLA 2Y44A 1RCDA 1LKPA 1DPSA 5ERKA 3KA4A 1RCCA 3FI6A 3C21A 2CHPA 3O7SA 3H7GA 3NP2X 4RC6B 2XJMA 4IWJA 1XZ1A 4MY7A 5GU2X 3TA8A 3O7RA 1VELA 4M35A 3WVUA 5GN8A 1MOJA 2CF7A 3F37A 3OGHA 2PYBA 4X0JA 1RCEA 5HQOA 1IERA 3R2KA 4TODA 1DVBA 2YW7A 2V2IA 3KWOA 3E2CA 3E1JA 4QUWA 3R2HA 1JTSA 4M33A 3UFBA 3PVTB 3QVDA 4PG0A 3PW1A 1GWGA 4ZJKA 2V2OA 3LKDA 1TK6A 1NFVA 2WLUA 1YUZA 5K53A 4E6KA 3GE4A 3NP0X 2RBDA 2YJKA 4LYUA 3GHQA 4ETRA 1FHAA 4E40A 3MPSA 2C2UA 4CVRA 3GVYA 4Z3BA 1JKVA 2V2PA 2UX1A 1TJOA 2GYQA 3FVBA 4WJG4 3F39A 3E1OA 3E1QA 3R2MA 2BK6A 2CN7A 4ZL5A 3Q4NA 4TOHA 3Q4OA 1JGCA 3KDQA 5FFDA 3RGDA 1ZUJA 3ISFA 1UMNA 4PG1A 5D8PA 2IB0A 5HJHA 4RC7A 4LPNA 3U90A 4DYUA 4ZKHA 3AJQA 4ERUA 2V2NA 2QF9A 1LKMA 4TOCA 5JDOA 3QZ3A 2CWLA 3FRRA 3EGMA 3E1LA 1L8IA 3QD8A 2G38B 4W4KB 3AJOA 4TOBA 1VEQA 4ZTTA 5GN8B 2FG8A 3WNWA 1QYBA 2CN6A 3FSEA 3SH6A 4XKSA 3AF7X 1L8HA 1QGHA 2CLUA 4CYBA 3A68A 1BCFA 2C41A 3F34A 1JREA 3PWQA 4KVQA 3SHXA 4ZLWA 3PW1B 4AM2A 1VEIA 3E6SA 3F32A 4TOGA 4TO9A 3AK8A 5ERJA 2V8UA 4XKTA 1NF6A 3A9QA 2ZA6A 1F30A 3RBCA 3E1MA 5J8SA 5CMRA 3JZ9A 4LQNA 1VLGA 4CMYA 4DI0A 3HL1A 1DATA 3AF9X 4ISPA 4EVDA 1LKOA 1JI5A 2FL0A 3KA9A 2AR0A 4R42A 3D19A 3N6OA 4MJYA 4LQJA 4XGSA 2ZURX 4M34A 2V2MA 3F38A 5D8XA 3BVLA 2V2SA 1MFRA 1VJXA 2V2LA 4U3GA 4CVSA 2C2JA 4CVPA 4MN9A 3KX9A 1S2ZA 4EVCA 1NNQA 3OJ5A 4LPMA 4ML5A 4RC7B 2FKZA 3VV9A 4TW3A 4YVZA 2Z5RA 2FFXJ 2Z90A 4PGKA 2G4HA 5J9VA 5JDOB 4KVRA 5E1UA 4DE6A 4AM5A 2D5KA 1B71A 2JD70 3NOZX 2IU2A 2CEIA 3Q4RA 5CZUA 4YXJA 3BVEA 5FFBA 2JD80 1YUXA 2Z5PA 1RYTA 5D8QA 1YV1A 5JKLA 3DBYA 2FG4A 2V2JA 5FFCA 3PW8A 5GU3X 3R2LA 2GYDA 4PGIA 3EZ0A 4Z5SA 2Z6MA 5E2DA 1S30A 1F33A 2V2RA 3ES3A 3F33A 2WWXB 5C6FA 3R2RA 4TOEA 3RAVA 3UNOA 3BKNA 2OC5A 3L0MA 2ZA7A 3PWFA 4M32A 2ZG9X 1JYBA 3KA8A 5JKLG 4ISMA 2F7NA 1AEWA 4DASA 2CLBA 5LG2A 3R2SA 3BVFA 4LQHA 1Z6OM 5I4JA 3ISEA 4P18A 4DZ0A 1S3QA 2BW1A 3PVYA 3R2OA 3VVAA 1O9RA 4MKUA 3C23A 5FFAA 5K52A 1LB3A 2FZFA 4CY9A 3UOFA 1XZ3A 3SE1A 2YJJA 3AJPA 1J30A 2JD60 2VXXA 3V3KB 5J93A 3KHKA 3GGZA 5GU1X 4RC5A 4REUA 5AXSA 1TKOA 1SQ3A 2XGWA 1Z4AA 2YW6A 2XJNA 4ZL6A 4MXPA 2Y3QA 3BT5A
chains in the Genus database with same CATH topology
2C6RA 2C2FA 5GOUA 3E1NA 3E1PA 4ITWA 3M6JA 1EUMA 5JACA 3JZAB 5FFEA 5D8OA 3AF8X 1RCIA 1BG7A 3BVIA 3UOIA 1JIGA 2XJOA 4MUDA 2BKCA 5CMQA 1KRQA 2N02A 4II4A 2HTNA 4IXKA 5JKMA 4KXRB 3RD0A 1RCGA 2ZG8X 3PVRA 1ZS3A 4TOFA 5HJFA 4TOAA 2FJCA 4ZKWA 5GU0X 5D8RA 4EVEA 4LPJA 2X170 3KA6A 4RC8A 2V15A 3PVYB 1NF4A 5JKMG 1BFRA 2Z5QA 3F36A 4XKUA 3W54A 5LS9A 2ITBA 4Y08A 3PWQC 3IS8A 2FHAA 3IQ1A 4IWKA 4OYNA 2QQYA 4ZKXA 3T9JA 5LG8A 2CHIA 4LYXA 1JI4A 4CYAA 4YXMA 2W0OA 2WLAA 3PZAA 5HU6D 3GGYA 2VXIA 4RC5B 2CIHA 4RC6A 3WVWA 3F35A 4LQVA 5D8YA 3BVKA 2ZA8A 4AM4A 2VZBA 3IS7A 3E6RA 4EVBA 4DYYA 4CVTA 2MGYA 3RE7A 3QHBA 4KVSA 3HIUA 2GS4A 1JKUA 1O9IA 1IESA 5IX6A 4CMYV 3PVTA 1TKPA 3C1YA 4II4B 4ITTA 4DYXA 1H96A 2V8TA 3KXUA 1R03A 3PVRB 1HRSA 3KA3A 1Z6OA 1N1QA 4W4LB 2IY4A 5FEJA 4ZMCA 3SIDA 3QB9A 1OTKA 2ZG7X 3QHCA 4YKHA 2HR5A 3C1ZA 2OKCA 3WVVA 4DYZA 3AK9A 1SOFA 5J8WA 2XKQA 3FRSA 3VNXA 4A25A 1UVHA 3Q4QA 3ERZA 3EZUA 3PW8C 5LBHA 5D8SA 2OH3A 2BJYA 2WTLA 2Y44A 1RCDA 1LKPA 1DPSA 5ERKA 3KA4A 1RCCA 3FI6A 3C21A 2CHPA 3O7SA 3H7GA 3NP2X 4RC6B 2XJMA 4IWJA 1XZ1A 4MY7A 5GU2X 3TA8A 3O7RA 1VELA 4M35A 3WVUA 5GN8A 1MOJA 2CF7A 3F37A 3OGHA 2PYBA 4X0JA 1RCEA 5HQOA 1IERA 3R2KA 4TODA 1DVBA 2YW7A 2V2IA 3KWOA 3E2CA 3E1JA 4QUWA 3R2HA 1JTSA 4M33A 3UFBA 3PVTB 3QVDA 4PG0A 3PW1A 1GWGA 4ZJKA 2V2OA 3LKDA 1TK6A 1NFVA 2WLUA 1YUZA 5K53A 4E6KA 3GE4A 3NP0X 2RBDA 2YJKA 4LYUA 3GHQA 4ETRA 1FHAA 4E40A 3MPSA 2C2UA 4CVRA 3GVYA 4Z3BA 1JKVA 2V2PA 2UX1A 1TJOA 2GYQA 3FVBA 4WJG4 3F39A 3E1OA 3E1QA 3R2MA 2BK6A 2CN7A 4ZL5A 3Q4NA 4TOHA 3Q4OA 1JGCA 3KDQA 5FFDA 3RGDA 1ZUJA 3ISFA 1UMNA 4PG1A 5D8PA 2IB0A 5HJHA 4RC7A 4LPNA 3U90A 4DYUA 4ZKHA 3AJQA 4ERUA 2V2NA 2QF9A 1LKMA 4TOCA 5JDOA 3QZ3A 2CWLA 3FRRA 3EGMA 3E1LA 1L8IA 3QD8A 2G38B 4W4KB 3AJOA 4TOBA 1VEQA 4ZTTA 5GN8B 2FG8A 3WNWA 1QYBA 2CN6A 3FSEA 3SH6A 4XKSA 3AF7X 1L8HA 1QGHA 2CLUA 4CYBA 3A68A 1BCFA 2C41A 3F34A 1JREA 3PWQA 4KVQA 3SHXA 4ZLWA 3PW1B 4AM2A 1VEIA 3E6SA 3F32A 4TOGA 4TO9A 3AK8A 5ERJA 2V8UA 4XKTA 1NF6A 3A9QA 2ZA6A 1F30A 3RBCA 3E1MA 5J8SA 5CMRA 3JZ9A 4LQNA 1VLGA 4CMYA 4DI0A 3HL1A 1DATA 3AF9X 4ISPA 4EVDA 1LKOA 1JI5A 2FL0A 3KA9A 2AR0A 4R42A 3D19A 3N6OA 4MJYA 4LQJA 4XGSA 2ZURX 4M34A 2V2MA 3F38A 5D8XA 3BVLA 2V2SA 1MFRA 1VJXA 2V2LA 4U3GA 4CVSA 2C2JA 4CVPA 4MN9A 3KX9A 1S2ZA 4EVCA 1NNQA 3OJ5A 4LPMA 4ML5A 4RC7B 2FKZA 3VV9A 4TW3A 4YVZA 2Z5RA 2FFXJ 2Z90A 4PGKA 2G4HA 5J9VA 5JDOB 4KVRA 5E1UA 4DE6A 4AM5A 2D5KA 1B71A 2JD70 3NOZX 2IU2A 2CEIA 3Q4RA 5CZUA 4YXJA 3BVEA 5FFBA 2JD80 1YUXA 2Z5PA 1RYTA 5D8QA 1YV1A 5JKLA 3DBYA 2FG4A 2V2JA 5FFCA 3PW8A 5GU3X 3R2LA 2GYDA 4PGIA 3EZ0A 4Z5SA 2Z6MA 5E2DA 1S30A 1F33A 2V2RA 3ES3A 3F33A 2WWXB 5C6FA 3R2RA 4TOEA 3RAVA 3UNOA 3BKNA 2OC5A 3L0MA 2ZA7A 3PWFA 4M32A 2ZG9X 1JYBA 3KA8A 5JKLG 4ISMA 2F7NA 1AEWA 4DASA 2CLBA 5LG2A 3R2SA 3BVFA 4LQHA 1Z6OM 5I4JA 3ISEA 4P18A 4DZ0A 1S3QA 2BW1A 3PVYA 3R2OA 3VVAA 1O9RA 4MKUA 3C23A 5FFAA 5K52A 1LB3A 2FZFA 4CY9A 3UOFA 1XZ3A 3SE1A 2YJJA 3AJPA 1J30A 2JD60 2VXXA 3V3KB 5J93A 3KHKA 3GGZA 5GU1X 4RC5A 4REUA 5AXSA 1TKOA 1SQ3A 2XGWA 1Z4AA 2YW6A 2XJNA 4ZL6A 4MXPA 2Y3QA 3BT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C6R A;  2C2F A;  5GOU A;  3E1N A;  3E1P A;  4ITW A;  1EUM A;  5JAC A;  5FFE A;  5D8O A;  3AF8 X;  1RCI A;  1BG7 A;  3BVI A;  3UOI A;  1JIG A;  2XJO A;  4MUD A;  2BKC A;  5CMQ A;  1KRQ A;  4II4 A;  2HTN A;  4IXK A;  5JKM A;  3RD0 A;  1RCG A;  2ZG8 X;  3PVR A;  1ZS3 A;  4TOF A;  5HJF A;  4TOA A;  2FJC A;  4ZKW A;  5GU0 X;  5D8R A;  4EVE A;  4LPJ A;  2X17 0;  3KA6 A;  4RC8 A;  2V15 A;  3PVY B;  1NF4 A;  5JKM G;  1BFR A;  2Z5Q A;  3F36 A;  4XKU A;  5LS9 A;  2ITB A;  4Y08 A;  3PWQ C;  3IS8 A;  2FHA A;  3IQ1 A;  4IWK A;  4OYN A;  2QQY A;  4ZKX A;  3T9J A;  5LG8 A;  2CHI A;  4LYX A;  1JI4 A;  4CYA A;  2W0O A;  2WLA A;  3PZA A;  2VXI A;  4RC5 B;  2CIH A;  4RC6 A;  3WVW A;  3F35 A;  4LQV A;  5D8Y A;  3BVK A;  2ZA8 A;  4AM4 A;  2VZB A;  3IS7 A;  3E6R A;  4EVB A;  4DYY A;  4CVT A;  3RE7 A;  3QHB A;  4KVS A;  3HIU A;  2GS4 A;  1JKU A;  1O9I A;  1IES A;  5IX6 A;  4CMY V;  3PVT A;  1TKP A;  4II4 B;  4ITT A;  4DYX A;  1H96 A;  3KXU A;  1R03 A;  3PVR B;  1HRS A;  3KA3 A;  1Z6O A;  1N1Q A;  2IY4 A;  5FEJ A;  4ZMC A;  3SID A;  3QB9 A;  1OTK A;  2ZG7 X;  3QHC A;  4YKH A;  2HR5 A;  3WVV A;  4DYZ A;  3AK9 A;  1SOF A;  5J8W A;  2XKQ A;  3VNX A;  4A25 A;  1UVH A;  3Q4Q A;  3ERZ A;  3EZU A;  3PW8 C;  5LBH A;  5D8S A;  2OH3 A;  2BJY A;  2WTL A;  1RCD A;  1LKP A;  1DPS A;  5ERK A;  3KA4 A;  1RCC A;  3FI6 A;  2CHP A;  3O7S A;  3H7G A;  3NP2 X;  4RC6 B;  2XJM A;  4IWJ A;  1XZ1 A;  4MY7 A;  5GU2 X;  3TA8 A;  3O7R A;  1VEL A;  4M35 A;  3WVU A;  5GN8 A;  1MOJ A;  2CF7 A;  3F37 A;  3OGH A;  2PYB A;  1RCE A;  5HQO A;  1IER A;  3R2K A;  4TOD A;  1DVB A;  2YW7 A;  2V2I A;  3KWO A;  3E2C A;  3E1J A;  4QUW A;  3R2H A;  1JTS A;  4M33 A;  3PVT B;  3QVD A;  4PG0 A;  3PW1 A;  1GWG A;  4ZJK A;  2V2O A;  1TK6 A;  1NFV A;  2WLU A;  1YUZ A;  5K53 A;  4E6K A;  3GE4 A;  3NP0 X;  2RBD A;  2YJK A;  4LYU A;  3GHQ A;  4ETR A;  1FHA A;  3MPS A;  2C2U A;  4CVR A;  3GVY A;  4Z3B A;  1JKV A;  2V2P A;  2UX1 A;  1TJO A;  2GYQ A;  3FVB A;  3F39 A;  3E1O A;  3E1Q A;  3R2M A;  2BK6 A;  2CN7 A;  4ZL5 A;  3Q4N A;  4TOH A;  3Q4O A;  1JGC A;  5FFD A;  3RGD A;  1ZUJ A;  3ISF A;  1UMN A;  4PG1 A;  5D8P A;  2IB0 A;  5HJH A;  4RC7 A;  4LPN A;  3U90 A;  4DYU A;  4ZKH A;  3AJQ A;  4ERU A;  2V2N A;  2QF9 A;  1LKM A;  4TOC A;  3QZ3 A;  3EGM A;  3E1L A;  1L8I A;  3QD8 A;  3AJO A;  4TOB A;  1VEQ A;  4ZTT A;  5GN8 B;  2FG8 A;  3WNW A;  1QYB A;  2CN6 A;  3FSE A;  3SH6 A;  4XKS A;  3AF7 X;  1L8H A;  1QGH A;  2CLU A;  4CYB A;  3A68 A;  1BCF A;  2C41 A;  3F34 A;  1JRE A;  3PWQ A;  4KVQ A;  3SHX A;  4ZLW A;  3PW1 B;  4AM2 A;  1VEI A;  3E6S A;  3F32 A;  4TOG A;  4TO9 A;  3AK8 A;  5ERJ A;  4XKT A;  1NF6 A;  3A9Q A;  2ZA6 A;  1F30 A;  3RBC A;  3E1M A;  5J8S A;  5CMR A;  4LQN A;  1VLG A;  4CMY A;  4DI0 A;  3HL1 A;  1DAT A;  3AF9 X;  4ISP A;  4EVD A;  1LKO A;  1JI5 A;  2FL0 A;  3KA9 A;  4R42 A;  4MJY A;  4LQJ A;  4XGS A;  2ZUR X;  4M34 A;  2V2M A;  3F38 A;  5D8X A;  3BVL A;  2V2S A;  1MFR A;  1VJX A;  2V2L A;  4U3G A;  4CVS A;  2C2J A;  4CVP A;  4MN9 A;  3KX9 A;  1S2Z A;  4EVC A;  1NNQ A;  3OJ5 A;  4LPM A;  4ML5 A;  4RC7 B;  2FKZ A;  4TW3 A;  2Z5R A;  2FFX J;  2Z90 A;  4PGK A;  2G4H A;  5J9V A;  4KVR A;  5E1U A;  4DE6 A;  4AM5 A;  2D5K A;  1B71 A;  2JD7 0;  3NOZ X;  2IU2 A;  2CEI A;  3Q4R A;  5CZU A;  3BVE A;  5FFB A;  2JD8 0;  1YUX A;  2Z5P A;  1RYT A;  5D8Q A;  1YV1 A;  5JKL A;  2FG4 A;  2V2J A;  5FFC A;  3PW8 A;  5GU3 X;  3R2L A;  2GYD A;  4PGI A;  3EZ0 A;  4Z5S A;  2Z6M A;  5E2D A;  1S30 A;  1F33 A;  2V2R A;  3ES3 A;  3F33 A;  5C6F A;  3R2R A;  4TOE A;  3RAV A;  3UNO A;  3BKN A;  2OC5 A;  2ZA7 A;  3PWF A;  4M32 A;  2ZG9 X;  1JYB A;  3KA8 A;  5JKL G;  4ISM A;  2F7N A;  1AEW A;  4DAS A;  2CLB A;  5LG2 A;  3R2S A;  3BVF A;  4LQH A;  1Z6O M;  5I4J A;  3ISE A;  4P18 A;  4DZ0 A;  1S3Q A;  2BW1 A;  3PVY A;  3R2O A;  1O9R A;  4MKU A;  5FFA A;  5K52 A;  1LB3 A;  2FZF A;  4CY9 A;  3UOF A;  1XZ3 A;  3SE1 A;  2YJJ A;  3AJP A;  1J30 A;  2JD6 0;  2VXX A;  5J93 A;  5GU1 X;  4RC5 A;  4REU A;  5AXS A;  1TKO A;  1SQ3 A;  2XGW A;  1Z4A A;  2YW6 A;  2XJN A;  4ZL6 A;  2Y3Q A;  3BT5 A; 
#chains in the Genus database with same CATH topology
 2C6R A;  2C2F A;  5GOU A;  3E1N A;  3E1P A;  4ITW A;  3M6J A;  1EUM A;  5JAC A;  3JZA B;  5FFE A;  5D8O A;  3AF8 X;  1RCI A;  1BG7 A;  3BVI A;  3UOI A;  1JIG A;  2XJO A;  4MUD A;  2BKC A;  5CMQ A;  1KRQ A;  2N02 A;  4II4 A;  2HTN A;  4IXK A;  5JKM A;  4KXR B;  3RD0 A;  1RCG A;  2ZG8 X;  3PVR A;  1ZS3 A;  4TOF A;  5HJF A;  4TOA A;  2FJC A;  4ZKW A;  5GU0 X;  5D8R A;  4EVE A;  4LPJ A;  2X17 0;  3KA6 A;  4RC8 A;  2V15 A;  3PVY B;  1NF4 A;  5JKM G;  1BFR A;  2Z5Q A;  3F36 A;  4XKU A;  3W54 A;  5LS9 A;  2ITB A;  4Y08 A;  3PWQ C;  3IS8 A;  2FHA A;  3IQ1 A;  4IWK A;  4OYN A;  2QQY A;  4ZKX A;  3T9J A;  5LG8 A;  2CHI A;  4LYX A;  1JI4 A;  4CYA A;  4YXM A;  2W0O A;  2WLA A;  3PZA A;  5HU6 D;  3GGY A;  2VXI A;  4RC5 B;  2CIH A;  4RC6 A;  3WVW A;  3F35 A;  4LQV A;  5D8Y A;  3BVK A;  2ZA8 A;  4AM4 A;  2VZB A;  3IS7 A;  3E6R A;  4EVB A;  4DYY A;  4CVT A;  2MGY A;  3RE7 A;  3QHB A;  4KVS A;  3HIU A;  2GS4 A;  1JKU A;  1O9I A;  1IES A;  5IX6 A;  4CMY V;  3PVT A;  1TKP A;  3C1Y A;  4II4 B;  4ITT A;  4DYX A;  1H96 A;  2V8T A;  3KXU A;  1R03 A;  3PVR B;  1HRS A;  3KA3 A;  1Z6O A;  1N1Q A;  4W4L B;  2IY4 A;  5FEJ A;  4ZMC A;  3SID A;  3QB9 A;  1OTK A;  2ZG7 X;  3QHC A;  4YKH A;  2HR5 A;  3C1Z A;  2OKC A;  3WVV A;  4DYZ A;  3AK9 A;  1SOF A;  5J8W A;  2XKQ A;  3FRS A;  3VNX A;  4A25 A;  1UVH A;  3Q4Q A;  3ERZ A;  3EZU A;  3PW8 C;  5LBH A;  5D8S A;  2OH3 A;  2BJY A;  2WTL A;  2Y44 A;  1RCD A;  1LKP A;  1DPS A;  5ERK A;  3KA4 A;  1RCC A;  3FI6 A;  3C21 A;  2CHP A;  3O7S A;  3H7G A;  3NP2 X;  4RC6 B;  2XJM A;  4IWJ A;  1XZ1 A;  4MY7 A;  5GU2 X;  3TA8 A;  3O7R A;  1VEL A;  4M35 A;  3WVU A;  5GN8 A;  1MOJ A;  2CF7 A;  3F37 A;  3OGH A;  2PYB A;  4X0J A;  1RCE A;  5HQO A;  1IER A;  3R2K A;  4TOD A;  1DVB A;  2YW7 A;  2V2I A;  3KWO A;  3E2C A;  3E1J A;  4QUW A;  3R2H A;  1JTS A;  4M33 A;  3UFB A;  3PVT B;  3QVD A;  4PG0 A;  3PW1 A;  1GWG A;  4ZJK A;  2V2O A;  3LKD A;  1TK6 A;  1NFV A;  2WLU A;  1YUZ A;  5K53 A;  4E6K A;  3GE4 A;  3NP0 X;  2RBD A;  2YJK A;  4LYU A;  3GHQ A;  4ETR A;  1FHA A;  4E40 A;  3MPS A;  2C2U A;  4CVR A;  3GVY A;  4Z3B A;  1JKV A;  2V2P A;  2UX1 A;  1TJO A;  2GYQ A;  3FVB A;  4WJG 4;  3F39 A;  3E1O A;  3E1Q A;  3R2M A;  2BK6 A;  2CN7 A;  4ZL5 A;  3Q4N A;  4TOH A;  3Q4O A;  1JGC A;  3KDQ A;  5FFD A;  3RGD A;  1ZUJ A;  3ISF A;  1UMN A;  4PG1 A;  5D8P A;  2IB0 A;  5HJH A;  4RC7 A;  4LPN A;  3U90 A;  4DYU A;  4ZKH A;  3AJQ A;  4ERU A;  2V2N A;  2QF9 A;  1LKM A;  4TOC A;  5JDO A;  3QZ3 A;  2CWL A;  3FRR A;  3EGM A;  3E1L A;  1L8I A;  3QD8 A;  2G38 B;  4W4K B;  3AJO A;  4TOB A;  1VEQ A;  4ZTT A;  5GN8 B;  2FG8 A;  3WNW A;  1QYB A;  2CN6 A;  3FSE A;  3SH6 A;  4XKS A;  3AF7 X;  1L8H A;  1QGH A;  2CLU A;  4CYB A;  3A68 A;  1BCF A;  2C41 A;  3F34 A;  1JRE A;  3PWQ A;  4KVQ A;  3SHX A;  4ZLW A;  3PW1 B;  4AM2 A;  1VEI A;  3E6S A;  3F32 A;  4TOG A;  4TO9 A;  3AK8 A;  5ERJ A;  2V8U A;  4XKT A;  1NF6 A;  3A9Q A;  2ZA6 A;  1F30 A;  3RBC A;  3E1M A;  5J8S A;  5CMR A;  3JZ9 A;  4LQN A;  1VLG A;  4CMY A;  4DI0 A;  3HL1 A;  1DAT A;  3AF9 X;  4ISP A;  4EVD A;  1LKO A;  1JI5 A;  2FL0 A;  3KA9 A;  2AR0 A;  4R42 A;  3D19 A;  3N6O A;  4MJY A;  4LQJ A;  4XGS A;  2ZUR X;  4M34 A;  2V2M A;  3F38 A;  5D8X A;  3BVL A;  2V2S A;  1MFR A;  1VJX A;  2V2L A;  4U3G A;  4CVS A;  2C2J A;  4CVP A;  4MN9 A;  3KX9 A;  1S2Z A;  4EVC A;  1NNQ A;  3OJ5 A;  4LPM A;  4ML5 A;  4RC7 B;  2FKZ A;  3VV9 A;  4TW3 A;  4YVZ A;  2Z5R A;  2FFX J;  2Z90 A;  4PGK A;  2G4H A;  5J9V A;  5JDO B;  4KVR A;  5E1U A;  4DE6 A;  4AM5 A;  2D5K A;  1B71 A;  2JD7 0;  3NOZ X;  2IU2 A;  2CEI A;  3Q4R A;  5CZU A;  4YXJ A;  3BVE A;  5FFB A;  2JD8 0;  1YUX A;  2Z5P A;  1RYT A;  5D8Q A;  1YV1 A;  5JKL A;  3DBY A;  2FG4 A;  2V2J A;  5FFC A;  3PW8 A;  5GU3 X;  3R2L A;  2GYD A;  4PGI A;  3EZ0 A;  4Z5S A;  2Z6M A;  5E2D A;  1S30 A;  1F33 A;  2V2R A;  3ES3 A;  3F33 A;  2WWX B;  5C6F A;  3R2R A;  4TOE A;  3RAV A;  3UNO A;  3BKN A;  2OC5 A;  3L0M A;  2ZA7 A;  3PWF A;  4M32 A;  2ZG9 X;  1JYB A;  3KA8 A;  5JKL G;  4ISM A;  2F7N A;  1AEW A;  4DAS A;  2CLB A;  5LG2 A;  3R2S A;  3BVF A;  4LQH A;  1Z6O M;  5I4J A;  3ISE A;  4P18 A;  4DZ0 A;  1S3Q A;  2BW1 A;  3PVY A;  3R2O A;  3VVA A;  1O9R A;  4MKU A;  3C23 A;  5FFA A;  5K52 A;  1LB3 A;  2FZF A;  4CY9 A;  3UOF A;  1XZ3 A;  3SE1 A;  2YJJ A;  3AJP A;  1J30 A;  2JD6 0;  2VXX A;  3V3K B;  5J93 A;  3KHK A;  3GGZ A;  5GU1 X;  4RC5 A;  4REU A;  5AXS A;  1TKO A;  1SQ3 A;  2XGW A;  1Z4A A;  2YW6 A;  2XJN A;  4ZL6 A;  4MXP A;  2Y3Q A;  3BT5 A; 
#chains in the Genus database with same CATH homology
 2C6R A;  2C2F A;  5GOU A;  3E1N A;  3E1P A;  4ITW A;  3M6J A;  1EUM A;  5JAC A;  3JZA B;  5FFE A;  5D8O A;  3AF8 X;  1RCI A;  1BG7 A;  3BVI A;  3UOI A;  1JIG A;  2XJO A;  4MUD A;  2BKC A;  5CMQ A;  1KRQ A;  2N02 A;  4II4 A;  2HTN A;  4IXK A;  5JKM A;  4KXR B;  3RD0 A;  1RCG A;  2ZG8 X;  3PVR A;  1ZS3 A;  4TOF A;  5HJF A;  4TOA A;  2FJC A;  4ZKW A;  5GU0 X;  5D8R A;  4EVE A;  4LPJ A;  2X17 0;  3KA6 A;  4RC8 A;  2V15 A;  3PVY B;  1NF4 A;  5JKM G;  1BFR A;  2Z5Q A;  3F36 A;  4XKU A;  3W54 A;  5LS9 A;  2ITB A;  4Y08 A;  3PWQ C;  3IS8 A;  2FHA A;  3IQ1 A;  4IWK A;  4OYN A;  2QQY A;  4ZKX A;  3T9J A;  5LG8 A;  2CHI A;  4LYX A;  1JI4 A;  4CYA A;  4YXM A;  2W0O A;  2WLA A;  3PZA A;  5HU6 D;  3GGY A;  2VXI A;  4RC5 B;  2CIH A;  4RC6 A;  3WVW A;  3F35 A;  4LQV A;  5D8Y A;  3BVK A;  2ZA8 A;  4AM4 A;  2VZB A;  3IS7 A;  3E6R A;  4EVB A;  4DYY A;  4CVT A;  2MGY A;  3RE7 A;  3QHB A;  4KVS A;  3HIU A;  2GS4 A;  1JKU A;  1O9I A;  1IES A;  5IX6 A;  4CMY V;  3PVT A;  1TKP A;  3C1Y A;  4II4 B;  4ITT A;  4DYX A;  1H96 A;  2V8T A;  3KXU A;  1R03 A;  3PVR B;  1HRS A;  3KA3 A;  1Z6O A;  1N1Q A;  4W4L B;  2IY4 A;  5FEJ A;  4ZMC A;  3SID A;  3QB9 A;  1OTK A;  2ZG7 X;  3QHC A;  4YKH A;  2HR5 A;  3C1Z A;  2OKC A;  3WVV A;  4DYZ A;  3AK9 A;  1SOF A;  5J8W A;  2XKQ A;  3FRS A;  3VNX A;  4A25 A;  1UVH A;  3Q4Q A;  3ERZ A;  3EZU A;  3PW8 C;  5LBH A;  5D8S A;  2OH3 A;  2BJY A;  2WTL A;  2Y44 A;  1RCD A;  1LKP A;  1DPS A;  5ERK A;  3KA4 A;  1RCC A;  3FI6 A;  3C21 A;  2CHP A;  3O7S A;  3H7G A;  3NP2 X;  4RC6 B;  2XJM A;  4IWJ A;  1XZ1 A;  4MY7 A;  5GU2 X;  3TA8 A;  3O7R A;  1VEL A;  4M35 A;  3WVU A;  5GN8 A;  1MOJ A;  2CF7 A;  3F37 A;  3OGH A;  2PYB A;  4X0J A;  1RCE A;  5HQO A;  1IER A;  3R2K A;  4TOD A;  1DVB A;  2YW7 A;  2V2I A;  3KWO A;  3E2C A;  3E1J A;  4QUW A;  3R2H A;  1JTS A;  4M33 A;  3UFB A;  3PVT B;  3QVD A;  4PG0 A;  3PW1 A;  1GWG A;  4ZJK A;  2V2O A;  3LKD A;  1TK6 A;  1NFV A;  2WLU A;  1YUZ A;  5K53 A;  4E6K A;  3GE4 A;  3NP0 X;  2RBD A;  2YJK A;  4LYU A;  3GHQ A;  4ETR A;  1FHA A;  4E40 A;  3MPS A;  2C2U A;  4CVR A;  3GVY A;  4Z3B A;  1JKV A;  2V2P A;  2UX1 A;  1TJO A;  2GYQ A;  3FVB A;  4WJG 4;  3F39 A;  3E1O A;  3E1Q A;  3R2M A;  2BK6 A;  2CN7 A;  4ZL5 A;  3Q4N A;  4TOH A;  3Q4O A;  1JGC A;  3KDQ A;  5FFD A;  3RGD A;  1ZUJ A;  3ISF A;  1UMN A;  4PG1 A;  5D8P A;  2IB0 A;  5HJH A;  4RC7 A;  4LPN A;  3U90 A;  4DYU A;  4ZKH A;  3AJQ A;  4ERU A;  2V2N A;  2QF9 A;  1LKM A;  4TOC A;  5JDO A;  3QZ3 A;  2CWL A;  3FRR A;  3EGM A;  3E1L A;  1L8I A;  3QD8 A;  2G38 B;  4W4K B;  3AJO A;  4TOB A;  1VEQ A;  4ZTT A;  5GN8 B;  2FG8 A;  3WNW A;  1QYB A;  2CN6 A;  3FSE A;  3SH6 A;  4XKS A;  3AF7 X;  1L8H A;  1QGH A;  2CLU A;  4CYB A;  3A68 A;  1BCF A;  2C41 A;  3F34 A;  1JRE A;  3PWQ A;  4KVQ A;  3SHX A;  4ZLW A;  3PW1 B;  4AM2 A;  1VEI A;  3E6S A;  3F32 A;  4TOG A;  4TO9 A;  3AK8 A;  5ERJ A;  2V8U A;  4XKT A;  1NF6 A;  3A9Q A;  2ZA6 A;  1F30 A;  3RBC A;  3E1M A;  5J8S A;  5CMR A;  3JZ9 A;  4LQN A;  1VLG A;  4CMY A;  4DI0 A;  3HL1 A;  1DAT A;  3AF9 X;  4ISP A;  4EVD A;  1LKO A;  1JI5 A;  2FL0 A;  3KA9 A;  2AR0 A;  4R42 A;  3D19 A;  3N6O A;  4MJY A;  4LQJ A;  4XGS A;  2ZUR X;  4M34 A;  2V2M A;  3F38 A;  5D8X A;  3BVL A;  2V2S A;  1MFR A;  1VJX A;  2V2L A;  4U3G A;  4CVS A;  2C2J A;  4CVP A;  4MN9 A;  3KX9 A;  1S2Z A;  4EVC A;  1NNQ A;  3OJ5 A;  4LPM A;  4ML5 A;  4RC7 B;  2FKZ A;  3VV9 A;  4TW3 A;  4YVZ A;  2Z5R A;  2FFX J;  2Z90 A;  4PGK A;  2G4H A;  5J9V A;  5JDO B;  4KVR A;  5E1U A;  4DE6 A;  4AM5 A;  2D5K A;  1B71 A;  2JD7 0;  3NOZ X;  2IU2 A;  2CEI A;  3Q4R A;  5CZU A;  4YXJ A;  3BVE A;  5FFB A;  2JD8 0;  1YUX A;  2Z5P A;  1RYT A;  5D8Q A;  1YV1 A;  5JKL A;  3DBY A;  2FG4 A;  2V2J A;  5FFC A;  3PW8 A;  5GU3 X;  3R2L A;  2GYD A;  4PGI A;  3EZ0 A;  4Z5S A;  2Z6M A;  5E2D A;  1S30 A;  1F33 A;  2V2R A;  3ES3 A;  3F33 A;  2WWX B;  5C6F A;  3R2R A;  4TOE A;  3RAV A;  3UNO A;  3BKN A;  2OC5 A;  3L0M A;  2ZA7 A;  3PWF A;  4M32 A;  2ZG9 X;  1JYB A;  3KA8 A;  5JKL G;  4ISM A;  2F7N A;  1AEW A;  4DAS A;  2CLB A;  5LG2 A;  3R2S A;  3BVF A;  4LQH A;  1Z6O M;  5I4J A;  3ISE A;  4P18 A;  4DZ0 A;  1S3Q A;  2BW1 A;  3PVY A;  3R2O A;  3VVA A;  1O9R A;  4MKU A;  3C23 A;  5FFA A;  5K52 A;  1LB3 A;  2FZF A;  4CY9 A;  3UOF A;  1XZ3 A;  3SE1 A;  2YJJ A;  3AJP A;  1J30 A;  2JD6 0;  2VXX A;  3V3K B;  5J93 A;  3KHK A;  3GGZ A;  5GU1 X;  4RC5 A;  4REU A;  5AXS A;  1TKO A;  1SQ3 A;  2XGW A;  1Z4A A;  2YW6 A;  2XJN A;  4ZL6 A;  4MXP A;  2Y3Q A;  3BT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...