3A68A

Crystal structure of plant ferritin reveals a novel metal binding site that functions as a transit site for metal transfer in ferritin
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
194
structure length
194
Chain Sequence
IFEPFEEVKKELDLVPTVPQASLARQKYVDESESAVNEQINVEYNVSYVYHAMFAYFDRDNVALRGLAKFFKESSEEEREHAEKLMEYQNKRGGKVKLQSIVMPLSDFDHADKGDALHAMELALSLEKLTNEKLLNLHSVATKNGDVQLADFVETEYLGEQVEAIKRISEYVAQLRRVGKGHGVWHFDQMLLHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferritin-4, chloroplastic
publication title Crystal structure of plant ferritin reveals a novel metal binding site that functions as a transit site for metal transfer in ferritin
pubmed doi rcsb
source organism Glycine max
molecule tags Oxidoreductase
total genus 77
structure length 194
sequence length 194
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2009-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3a68A00
2C2UA 1NF6A 2JD80 3E2CA 4MJYA 3GVYA 1S30A 2BJYA 5ERKA 2VZBA 4U3GA 4EVBA 4LPMA 3OJ5A 5LS9A 4CVTA 2FG4A 2GYDA 3H7GA 1UMNA 2WLAA 3E1QA 4CYBA 3E6RA 1S3QA 5D8XA 1UVHA 3WVWA 1B71A 1QGHA 2XKQA 1JI4A 3U90A 1KRQA 5D8RA 4TOBA 2JD60 2ITBA 3IQ1A 2FG8A 4TW3A 3PVRA 2WTLA 2BW1A 4ISPA 5FFDA 3Q4QA 1HRSA 4CVPA 1F30A 1SOFA 3WVUA 4TOHA 5CMQA 4RC5A 1RCEA 3KA6A 2V2LA 4ZMCA 3MPSA 3PWQC 3BVFA 4CVRA 5J9VA 1Z6OM 3BVKA 3E1JA 1YUZA 2HR5A 4II4B 4DASA 4TOFA 2CHPA 2D5KA 4CMYA 1BFRA 3RBCA 4M35A 2CLBA 5FFAA 3QHCA 3FSEA 2V2OA 2IY4A 1BCFA 1EUMA 2FKZA 4LYXA 3PWQA 5GU0X 3PVRB 5JKMA 5GN8A 1R03A 5FFCA 3AF8X 3E1MA 2CIHA 3AJPA 1LKPA 3SHXA 3WNWA 4XKTA 5GOUA 4ZKWA 2ZA7A 3PW1A 2ZG7X 5J8SA 4XKUA 3SH6A 5LG2A 3R2OA 4TODA 5FFBA 3IS7A 2PYBA 1DPSA 1Z6OA 2VXXA 3UOFA 4LPJA 3QVDA 2F7NA 1VEIA 3O7RA 1VJXA 1N1QA 2V15A 3FI6A 1JREA 3E1NA 2XJMA 4ITWA 3R2LA 4PG0A 4DI0A 5GN8B 4KVQA 1JKVA 1RCDA 2FFXJ 3A68A 3HL1A 3A9QA 4PGIA 2X170 2YW7A 4M32A 1TKPA 3KA4A 3AF7X 3ES3A 2Y3QA 3AF9X 4XGSA 1VEQA 4ZKHA 2C2FA 3KXUA 2CF7A 3KWOA 2YJJA 3QZ3A 2W0OA 5E1UA 5GU3X 5LG8A 2ZG9X 2BKCA 3F36A 3QD8A 2ZG8X 5AXSA 1IERA 2UX1A 3RAVA 5JACA 2ZURX 3EZ0A 2OC5A 3F33A 1JYBA 5D8OA 4ETRA 3F34A 3RE7A 4EVEA 1FHAA 3PZAA 1NNQA 3NOZX 4IXKA 3KX9A 1J30A 3NP0X 1F33A 5I4JA 4LQJA 3HIUA 5J8WA 4CVSA 2ZA6A 4M34A 4DYZA 1GWGA 4AM5A 1AEWA 4PGKA 4ITTA 1RCGA 1OTKA 3PVYA 5D8QA 2XJNA 5HQOA 3KA3A 5D8SA 2V2MA 2C2JA 2FJCA 4Y08A 5C6FA 3GHQA 3OGHA 1TJOA 5LBHA 2VXIA 1JGCA 5IX6A 3F32A 3RD0A 3E1LA 3UNOA 5K52A 4RC5B 3EGMA 2CN7A 3BVIA 4M33A 3GE4A 4RC7A 2Z5RA 2XJOA 2BK6A 4CY9A 3PW8C 4DE6A 3PWFA 4REUA 4Z5SA 2YJKA 5ERJA 2FHAA 5HJHA 4ZLWA 1XZ1A 4ZTTA 1QYBA 3AK9A 4E6KA 4PG1A 1DVBA 3RGDA 1JKUA 1RCCA 2Z5QA 2XGWA 4CMYV 3PW8A 2GYQA 2V2JA 2QQYA 1JI5A 3E1OA 4AM4A 4ISMA 4AM2A 4RC8A 4DYYA 2FL0A 3Q4OA 3T9JA 5CMRA 3KA8A 4LYUA 1LKMA 5GU2X 3PW1B 3R2RA 2IU2A 5JKLG 3R2KA 1L8IA 1LB3A 5D8YA 3IS8A 3AJQA 1YV1A 4TOCA 5J93A 2C6RA 4EVDA 3SE1A 3E6SA 4TOAA 2YW6A 3UOIA 2JD70 2CHIA 4KVSA 1IESA 2V2PA 1JTSA 4A25A 4LQNA 2QF9A 3NP2X 5FFEA 3Q4NA 1O9RA 4ZL5A 4LQHA 4KVRA 3R2SA 4MN9A 5CZUA 4ZJKA 2C41A 3TA8A 4ZKXA 1JIGA 3F39A 3SIDA 3KA9A 4II4A 1O9IA 4LPNA 4ERUA 4IWJA 4TOEA 2ZA8A 3QHBA 2V2IA 4MKUA 2CLUA 4MY7A 3Q4RA 4YKHA 3BT5A 2FZFA 2V2NA 3F37A 2CEIA 3BKNA 3E1PA 3VNXA 3O7SA 3ISEA 3PVTA 1YUXA 4IWKA 1ZUJA 5K53A 1MFRA 2G4HA 3AJOA 4ZL6A 1RYTA 3R2HA 4TO9A 4EVCA 1RCIA 1ZS3A 3BVLA 1VELA 4DYXA 4LQVA 4RC6A 2IB0A 3FVBA 1VLGA 2RBDA 1BG7A 2V2RA 4DYUA 3WVVA 2HTNA 1SQ3A 1S2ZA 1DATA 4Z3BA 5GU1X 1LKOA 3F38A 5FEJA 5JKMG 2V2SA 5HJFA 2Z90A 3PVTB 3PVYB 4P18A 2OH3A 3EZUA 3F35A 4ML5A 1NFVA 3ERZA 4DZ0A 1NF4A 3ISFA 4RC6B 3BVEA 3AK8A 1H96A 4XKSA 2CN6A 1TK6A 4R42A 2Z5PA 1Z4AA 4RC7B 5D8PA 1TKOA 3QB9A 5JKLA 4CYAA 1L8HA 3R2MA 1XZ3A 5E2DA 4QUWA 4MUDA 1MOJA 4TOGA 2WLUA 2GS4A 2Z6MA 4OYNA
chains in the Genus database with same CATH superfamily
2C2UA 4KXRB 1NF6A 2JD80 3E2CA 4MJYA 3GVYA 1S30A 2BJYA 5ERKA 2VZBA 4U3GA 4EVBA 4LPMA 5JDOB 3OJ5A 5LS9A 4CVTA 2FG4A 2GYDA 3H7GA 1UMNA 2WLAA 3E1QA 4CYBA 3E6RA 1S3QA 5D8XA 1UVHA 3WVWA 1B71A 1QGHA 2XKQA 1JI4A 3U90A 1KRQA 5D8RA 4TOBA 2JD60 2ITBA 3IQ1A 2FG8A 4TW3A 3PVRA 2WTLA 2Y44A 4ISPA 2BW1A 5FFDA 3Q4QA 1HRSA 4CVPA 1F30A 1SOFA 3WVUA 4TOHA 5CMQA 4RC5A 1RCEA 3KA6A 2V2LA 4ZMCA 3MPSA 3PWQC 3BVFA 4CVRA 5J9VA 1Z6OM 3BVKA 3E1JA 1YUZA 2HR5A 4II4B 3V3KB 4DASA 4TOFA 2CHPA 2D5KA 4CMYA 1BFRA 3C23A 3RBCA 4M35A 2CLBA 5FFAA 3QHCA 3FSEA 2V2OA 2IY4A 1BCFA 1EUMA 2FKZA 4LYXA 3PWQA 5GU0X 2WWXB 3PVRB 5JKMA 5GN8A 1R03A 5FFCA 3AF8X 3E1MA 2CIHA 3AJPA 3LKDA 1LKPA 3SHXA 3WNWA 4XKTA 5GOUA 4ZKWA 2ZA7A 3PW1A 2ZG7X 5J8SA 4XKUA 3SH6A 5LG2A 3R2OA 4TODA 5FFBA 3IS7A 2PYBA 1DPSA 1Z6OA 2VXXA 3UOFA 4LPJA 3QVDA 2F7NA 3VV9A 1VEIA 3O7RA 1VJXA 4E40A 2V8UA 1N1QA 2V15A 3FI6A 1JREA 3E1NA 2XJMA 4ITWA 3R2LA 4PG0A 4DI0A 5GN8B 4KVQA 1JKVA 1RCDA 2FFXJ 3A68A 3HL1A 3A9QA 4PGIA 2X170 2YW7A 3W54A 4M32A 1TKPA 3KA4A 3AF7X 3ES3A 2Y3QA 3JZAB 3AF9X 4XGSA 1VEQA 4ZKHA 2C2FA 3KXUA 2CF7A 3KWOA 2OKCA 2YJJA 3FRRA 3QZ3A 2W0OA 5E1UA 5GU3X 5LG8A 2ZG9X 2BKCA 3F36A 3QD8A 2ZG8X 5AXSA 1IERA 2UX1A 3RAVA 5JACA 4YVZA 2ZURX 3KHKA 3EZ0A 2OC5A 3F33A 1JYBA 5D8OA 4ETRA 3F34A 3RE7A 4EVEA 1FHAA 4WJG4 3PZAA 1NNQA 3NOZX 4IXKA 3KX9A 1J30A 3NP0X 1F33A 5I4JA 4LQJA 3HIUA 5J8WA 4CVSA 2ZA6A 4M34A 4YXJA 4W4LB 4DYZA 1GWGA 3KDQA 4AM5A 1AEWA 4PGKA 4ITTA 1RCGA 1OTKA 3PVYA 5D8QA 2XJNA 5HU6D 3DBYA 5HQOA 3KA3A 5D8SA 2V2MA 2C2JA 3C1YA 2FJCA 4Y08A 5C6FA 3GHQA 3OGHA 3N6OA 1TJOA 5LBHA 2VXIA 1JGCA 5IX6A 3F32A 3RD0A 3E1LA 3UNOA 5K52A 4RC5B 3GGZA 3EGMA 2CN7A 4W4KB 3BVIA 4M33A 3GE4A 4RC7A 2Z5RA 2XJOA 2BK6A 4CY9A 3PW8C 4DE6A 3PWFA 4MXPA 4REUA 3C1ZA 4Z5SA 2YJKA 5ERJA 2AR0A 4X0JA 2FHAA 5HJHA 4ZLWA 1XZ1A 4ZTTA 1QYBA 3AK9A 4E6KA 4PG1A 1DVBA 3RGDA 1JKUA 1RCCA 2Z5QA 2XGWA 4CMYV 3PW8A 2GYQA 2V2JA 2QQYA 1JI5A 3E1OA 4AM4A 4ISMA 4AM2A 4RC8A 4DYYA 2FL0A 3Q4OA 3T9JA 5CMRA 3KA8A 4LYUA 1LKMA 5GU2X 3VVAA 3PW1B 3R2RA 2IU2A 5JKLG 3R2KA 1L8IA 1LB3A 5D8YA 3IS8A 3AJQA 1YV1A 4TOCA 5J93A 3C21A 2C6RA 4EVDA 3SE1A 3E6SA 4TOAA 2YW6A 3UOIA 2JD70 2N02A 3M6JA 2CHIA 4KVSA 1IESA 2V2PA 1JTSA 4A25A 4LQNA 2QF9A 2G38B 3NP2X 5FFEA 3Q4NA 1O9RA 4ZL5A 4LQHA 4KVRA 3R2SA 4MN9A 5CZUA 4ZJKA 2C41A 3TA8A 4ZKXA 1JIGA 3D19A 3F39A 3SIDA 3KA9A 4II4A 1O9IA 4LPNA 4ERUA 4IWJA 4TOEA 2ZA8A 3QHBA 2V2IA 4MKUA 2CLUA 4MY7A 3Q4RA 4YKHA 3BT5A 2FZFA 2V2NA 3F37A 4YXMA 2CEIA 3BKNA 3E1PA 3VNXA 3O7SA 3ISEA 3PVTA 1YUXA 3JZ9A 4IWKA 1ZUJA 5K53A 1MFRA 2G4HA 3AJOA 4ZL6A 1RYTA 3R2HA 4TO9A 4EVCA 1RCIA 1ZS3A 3BVLA 1VELA 4DYXA 4LQVA 4RC6A 2IB0A 3FVBA 1VLGA 2RBDA 1BG7A 2V2RA 4DYUA 3WVVA 2HTNA 1SQ3A 1S2ZA 1DATA 3GGYA 4Z3BA 5GU1X 1LKOA 3F38A 5FEJA 5JKMG 2V2SA 5HJFA 2Z90A 3PVTB 3PVYB 4P18A 2OH3A 3EZUA 3F35A 4ML5A 1NFVA 3ERZA 4DZ0A 1NF4A 3ISFA 4RC6B 2MGYA 3BVEA 3AK8A 1H96A 5JDOA 4XKSA 2CN6A 1TK6A 4R42A 2Z5PA 1Z4AA 4RC7B 5D8PA 1TKOA 3QB9A 5JKLA 3L0MA 4CYAA 2CWLA 1L8HA 2V8TA 3R2MA 1XZ3A 5E2DA 4QUWA 4MUDA 1MOJA 4TOGA 2WLUA 2GS4A 3FRSA 2Z6MA 4OYNA 3UFBA
chains in the Genus database with same CATH topology
2C2UA 4KXRB 1NF6A 2JD80 3E2CA 4MJYA 3GVYA 1S30A 2BJYA 5ERKA 2VZBA 4U3GA 4EVBA 4LPMA 5JDOB 3OJ5A 5LS9A 4CVTA 2FG4A 2GYDA 3H7GA 1UMNA 2WLAA 3E1QA 4CYBA 3E6RA 1S3QA 5D8XA 1UVHA 3WVWA 1B71A 1QGHA 2XKQA 1JI4A 3U90A 1KRQA 5D8RA 4TOBA 2JD60 2ITBA 3IQ1A 2FG8A 4TW3A 3PVRA 2WTLA 2Y44A 4ISPA 2BW1A 5FFDA 3Q4QA 1HRSA 4CVPA 1F30A 1SOFA 3WVUA 4TOHA 5CMQA 4RC5A 1RCEA 3KA6A 2V2LA 4ZMCA 3MPSA 3PWQC 3BVFA 4CVRA 5J9VA 1Z6OM 3BVKA 3E1JA 1YUZA 2HR5A 4II4B 3V3KB 4DASA 4TOFA 2CHPA 2D5KA 4CMYA 1BFRA 3C23A 3RBCA 4M35A 2CLBA 5FFAA 3QHCA 3FSEA 2V2OA 2IY4A 1BCFA 1EUMA 2FKZA 4LYXA 3PWQA 5GU0X 2WWXB 3PVRB 5JKMA 5GN8A 1R03A 5FFCA 3AF8X 3E1MA 2CIHA 3AJPA 3LKDA 1LKPA 3SHXA 3WNWA 4XKTA 5GOUA 4ZKWA 2ZA7A 3PW1A 2ZG7X 5J8SA 4XKUA 3SH6A 5LG2A 3R2OA 4TODA 5FFBA 3IS7A 2PYBA 1DPSA 1Z6OA 2VXXA 3UOFA 4LPJA 3QVDA 2F7NA 3VV9A 1VEIA 3O7RA 1VJXA 4E40A 2V8UA 1N1QA 2V15A 3FI6A 1JREA 3E1NA 2XJMA 4ITWA 3R2LA 4PG0A 4DI0A 5GN8B 4KVQA 1JKVA 1RCDA 2FFXJ 3A68A 3HL1A 3A9QA 4PGIA 2X170 2YW7A 3W54A 4M32A 1TKPA 3KA4A 3AF7X 3ES3A 2Y3QA 3JZAB 3AF9X 4XGSA 1VEQA 4ZKHA 2C2FA 3KXUA 2CF7A 3KWOA 2OKCA 2YJJA 3FRRA 3QZ3A 2W0OA 5E1UA 5GU3X 5LG8A 2ZG9X 2BKCA 3F36A 3QD8A 2ZG8X 5AXSA 1IERA 2UX1A 3RAVA 5JACA 4YVZA 2ZURX 3KHKA 3EZ0A 2OC5A 3F33A 1JYBA 5D8OA 4ETRA 3F34A 3RE7A 4EVEA 1FHAA 4WJG4 3PZAA 1NNQA 3NOZX 4IXKA 3KX9A 1J30A 3NP0X 1F33A 5I4JA 4LQJA 3HIUA 5J8WA 4CVSA 2ZA6A 4M34A 4YXJA 4W4LB 4DYZA 1GWGA 3KDQA 4AM5A 1AEWA 4PGKA 4ITTA 1RCGA 1OTKA 3PVYA 5D8QA 2XJNA 5HU6D 3DBYA 5HQOA 3KA3A 5D8SA 2V2MA 2C2JA 3C1YA 2FJCA 4Y08A 5C6FA 3GHQA 3OGHA 3N6OA 1TJOA 5LBHA 2VXIA 1JGCA 5IX6A 3F32A 3RD0A 3E1LA 3UNOA 5K52A 4RC5B 3GGZA 3EGMA 2CN7A 4W4KB 3BVIA 4M33A 3GE4A 4RC7A 2Z5RA 2XJOA 2BK6A 4CY9A 3PW8C 4DE6A 3PWFA 4MXPA 4REUA 3C1ZA 4Z5SA 2YJKA 5ERJA 2AR0A 4X0JA 2FHAA 5HJHA 4ZLWA 1XZ1A 4ZTTA 1QYBA 3AK9A 4E6KA 4PG1A 1DVBA 3RGDA 1JKUA 1RCCA 2Z5QA 2XGWA 4CMYV 3PW8A 2GYQA 2V2JA 2QQYA 1JI5A 3E1OA 4AM4A 4ISMA 4AM2A 4RC8A 4DYYA 2FL0A 3Q4OA 3T9JA 5CMRA 3KA8A 4LYUA 1LKMA 5GU2X 3VVAA 3PW1B 3R2RA 2IU2A 5JKLG 3R2KA 1L8IA 1LB3A 5D8YA 3IS8A 3AJQA 1YV1A 4TOCA 5J93A 3C21A 2C6RA 4EVDA 3SE1A 3E6SA 4TOAA 2YW6A 3UOIA 2JD70 2N02A 3M6JA 2CHIA 4KVSA 1IESA 2V2PA 1JTSA 4A25A 4LQNA 2QF9A 2G38B 3NP2X 5FFEA 3Q4NA 1O9RA 4ZL5A 4LQHA 4KVRA 3R2SA 4MN9A 5CZUA 4ZJKA 2C41A 3TA8A 4ZKXA 1JIGA 3D19A 3F39A 3SIDA 3KA9A 4II4A 1O9IA 4LPNA 4ERUA 4IWJA 4TOEA 2ZA8A 3QHBA 2V2IA 4MKUA 2CLUA 4MY7A 3Q4RA 4YKHA 3BT5A 2FZFA 2V2NA 3F37A 4YXMA 2CEIA 3BKNA 3E1PA 3VNXA 3O7SA 3ISEA 3PVTA 1YUXA 3JZ9A 4IWKA 1ZUJA 5K53A 1MFRA 2G4HA 3AJOA 4ZL6A 1RYTA 3R2HA 4TO9A 4EVCA 1RCIA 1ZS3A 3BVLA 1VELA 4DYXA 4LQVA 4RC6A 2IB0A 3FVBA 1VLGA 2RBDA 1BG7A 2V2RA 4DYUA 3WVVA 2HTNA 1SQ3A 1S2ZA 1DATA 3GGYA 4Z3BA 5GU1X 1LKOA 3F38A 5FEJA 5JKMG 2V2SA 5HJFA 2Z90A 3PVTB 3PVYB 4P18A 2OH3A 3EZUA 3F35A 4ML5A 1NFVA 3ERZA 4DZ0A 1NF4A 3ISFA 4RC6B 2MGYA 3BVEA 3AK8A 1H96A 5JDOA 4XKSA 2CN6A 1TK6A 4R42A 2Z5PA 1Z4AA 4RC7B 5D8PA 1TKOA 3QB9A 5JKLA 3L0MA 4CYAA 2CWLA 1L8HA 2V8TA 3R2MA 1XZ3A 5E2DA 4QUWA 4MUDA 1MOJA 4TOGA 2WLUA 2GS4A 3FRSA 2Z6MA 4OYNA 3UFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2U A;  1NF6 A;  2JD8 0;  3E2C A;  4MJY A;  3GVY A;  1S30 A;  2BJY A;  5ERK A;  2VZB A;  4U3G A;  4EVB A;  4LPM A;  3OJ5 A;  5LS9 A;  4CVT A;  2FG4 A;  2GYD A;  3H7G A;  1UMN A;  2WLA A;  3E1Q A;  4CYB A;  3E6R A;  1S3Q A;  5D8X A;  1UVH A;  3WVW A;  1B71 A;  1QGH A;  2XKQ A;  1JI4 A;  3U90 A;  1KRQ A;  5D8R A;  4TOB A;  2JD6 0;  2ITB A;  3IQ1 A;  2FG8 A;  4TW3 A;  3PVR A;  2WTL A;  2BW1 A;  4ISP A;  5FFD A;  3Q4Q A;  1HRS A;  4CVP A;  1F30 A;  1SOF A;  3WVU A;  4TOH A;  5CMQ A;  4RC5 A;  1RCE A;  3KA6 A;  2V2L A;  4ZMC A;  3MPS A;  3PWQ C;  3BVF A;  4CVR A;  5J9V A;  1Z6O M;  3BVK A;  3E1J A;  1YUZ A;  2HR5 A;  4II4 B;  4DAS A;  4TOF A;  2CHP A;  2D5K A;  4CMY A;  1BFR A;  3RBC A;  4M35 A;  2CLB A;  5FFA A;  3QHC A;  3FSE A;  2V2O A;  2IY4 A;  1BCF A;  1EUM A;  2FKZ A;  4LYX A;  3PWQ A;  5GU0 X;  3PVR B;  5JKM A;  5GN8 A;  1R03 A;  5FFC A;  3AF8 X;  3E1M A;  2CIH A;  3AJP A;  1LKP A;  3SHX A;  3WNW A;  4XKT A;  5GOU A;  4ZKW A;  2ZA7 A;  3PW1 A;  2ZG7 X;  5J8S A;  4XKU A;  3SH6 A;  5LG2 A;  3R2O A;  4TOD A;  5FFB A;  3IS7 A;  2PYB A;  1DPS A;  1Z6O A;  2VXX A;  3UOF A;  4LPJ A;  3QVD A;  2F7N A;  1VEI A;  3O7R A;  1VJX A;  1N1Q A;  2V15 A;  3FI6 A;  1JRE A;  3E1N A;  2XJM A;  4ITW A;  3R2L A;  4PG0 A;  4DI0 A;  5GN8 B;  4KVQ A;  1JKV A;  1RCD A;  2FFX J;  3A68 A;  3HL1 A;  3A9Q A;  4PGI A;  2X17 0;  2YW7 A;  4M32 A;  1TKP A;  3KA4 A;  3AF7 X;  3ES3 A;  2Y3Q A;  3AF9 X;  4XGS A;  1VEQ A;  4ZKH A;  2C2F A;  3KXU A;  2CF7 A;  3KWO A;  2YJJ A;  3QZ3 A;  2W0O A;  5E1U A;  5GU3 X;  5LG8 A;  2ZG9 X;  2BKC A;  3F36 A;  3QD8 A;  2ZG8 X;  5AXS A;  1IER A;  2UX1 A;  3RAV A;  5JAC A;  2ZUR X;  3EZ0 A;  2OC5 A;  3F33 A;  1JYB A;  5D8O A;  4ETR A;  3F34 A;  3RE7 A;  4EVE A;  1FHA A;  3PZA A;  1NNQ A;  3NOZ X;  4IXK A;  3KX9 A;  1J30 A;  3NP0 X;  1F33 A;  5I4J A;  4LQJ A;  3HIU A;  5J8W A;  4CVS A;  2ZA6 A;  4M34 A;  4DYZ A;  1GWG A;  4AM5 A;  1AEW A;  4PGK A;  4ITT A;  1RCG A;  1OTK A;  3PVY A;  5D8Q A;  2XJN A;  5HQO A;  3KA3 A;  5D8S A;  2V2M A;  2C2J A;  2FJC A;  4Y08 A;  5C6F A;  3GHQ A;  3OGH A;  1TJO A;  5LBH A;  2VXI A;  1JGC A;  5IX6 A;  3F32 A;  3RD0 A;  3E1L A;  3UNO A;  5K52 A;  4RC5 B;  3EGM A;  2CN7 A;  3BVI A;  4M33 A;  3GE4 A;  4RC7 A;  2Z5R A;  2XJO A;  2BK6 A;  4CY9 A;  3PW8 C;  4DE6 A;  3PWF A;  4REU A;  4Z5S A;  2YJK A;  5ERJ A;  2FHA A;  5HJH A;  4ZLW A;  1XZ1 A;  4ZTT A;  1QYB A;  3AK9 A;  4E6K A;  4PG1 A;  1DVB A;  3RGD A;  1JKU A;  1RCC A;  2Z5Q A;  2XGW A;  4CMY V;  3PW8 A;  2GYQ A;  2V2J A;  2QQY A;  1JI5 A;  3E1O A;  4AM4 A;  4ISM A;  4AM2 A;  4RC8 A;  4DYY A;  2FL0 A;  3Q4O A;  3T9J A;  5CMR A;  3KA8 A;  4LYU A;  1LKM A;  5GU2 X;  3PW1 B;  3R2R A;  2IU2 A;  5JKL G;  3R2K A;  1L8I A;  1LB3 A;  5D8Y A;  3IS8 A;  3AJQ A;  1YV1 A;  4TOC A;  5J93 A;  2C6R A;  4EVD A;  3SE1 A;  3E6S A;  4TOA A;  2YW6 A;  3UOI A;  2JD7 0;  2CHI A;  4KVS A;  1IES A;  2V2P A;  1JTS A;  4A25 A;  4LQN A;  2QF9 A;  3NP2 X;  5FFE A;  3Q4N A;  1O9R A;  4ZL5 A;  4LQH A;  4KVR A;  3R2S A;  4MN9 A;  5CZU A;  4ZJK A;  2C41 A;  3TA8 A;  4ZKX A;  1JIG A;  3F39 A;  3SID A;  3KA9 A;  4II4 A;  1O9I A;  4LPN A;  4ERU A;  4IWJ A;  4TOE A;  2ZA8 A;  3QHB A;  2V2I A;  4MKU A;  2CLU A;  4MY7 A;  3Q4R A;  4YKH A;  3BT5 A;  2FZF A;  2V2N A;  3F37 A;  2CEI A;  3BKN A;  3E1P A;  3VNX A;  3O7S A;  3ISE A;  3PVT A;  1YUX A;  4IWK A;  1ZUJ A;  5K53 A;  1MFR A;  2G4H A;  3AJO A;  4ZL6 A;  1RYT A;  3R2H A;  4TO9 A;  4EVC A;  1RCI A;  1ZS3 A;  3BVL A;  1VEL A;  4DYX A;  4LQV A;  4RC6 A;  2IB0 A;  3FVB A;  1VLG A;  2RBD A;  1BG7 A;  2V2R A;  4DYU A;  3WVV A;  2HTN A;  1SQ3 A;  1S2Z A;  1DAT A;  4Z3B A;  5GU1 X;  1LKO A;  3F38 A;  5FEJ A;  5JKM G;  2V2S A;  5HJF A;  2Z90 A;  3PVT B;  3PVY B;  4P18 A;  2OH3 A;  3EZU A;  3F35 A;  4ML5 A;  1NFV A;  3ERZ A;  4DZ0 A;  1NF4 A;  3ISF A;  4RC6 B;  3BVE A;  3AK8 A;  1H96 A;  4XKS A;  2CN6 A;  1TK6 A;  4R42 A;  2Z5P A;  1Z4A A;  4RC7 B;  5D8P A;  1TKO A;  3QB9 A;  5JKL A;  4CYA A;  1L8H A;  3R2M A;  1XZ3 A;  5E2D A;  4QUW A;  4MUD A;  1MOJ A;  4TOG A;  2WLU A;  2GS4 A;  2Z6M A;  4OYN A; 
#chains in the Genus database with same CATH topology
 2C2U A;  4KXR B;  1NF6 A;  2JD8 0;  3E2C A;  4MJY A;  3GVY A;  1S30 A;  2BJY A;  5ERK A;  2VZB A;  4U3G A;  4EVB A;  4LPM A;  5JDO B;  3OJ5 A;  5LS9 A;  4CVT A;  2FG4 A;  2GYD A;  3H7G A;  1UMN A;  2WLA A;  3E1Q A;  4CYB A;  3E6R A;  1S3Q A;  5D8X A;  1UVH A;  3WVW A;  1B71 A;  1QGH A;  2XKQ A;  1JI4 A;  3U90 A;  1KRQ A;  5D8R A;  4TOB A;  2JD6 0;  2ITB A;  3IQ1 A;  2FG8 A;  4TW3 A;  3PVR A;  2WTL A;  2Y44 A;  4ISP A;  2BW1 A;  5FFD A;  3Q4Q A;  1HRS A;  4CVP A;  1F30 A;  1SOF A;  3WVU A;  4TOH A;  5CMQ A;  4RC5 A;  1RCE A;  3KA6 A;  2V2L A;  4ZMC A;  3MPS A;  3PWQ C;  3BVF A;  4CVR A;  5J9V A;  1Z6O M;  3BVK A;  3E1J A;  1YUZ A;  2HR5 A;  4II4 B;  3V3K B;  4DAS A;  4TOF A;  2CHP A;  2D5K A;  4CMY A;  1BFR A;  3C23 A;  3RBC A;  4M35 A;  2CLB A;  5FFA A;  3QHC A;  3FSE A;  2V2O A;  2IY4 A;  1BCF A;  1EUM A;  2FKZ A;  4LYX A;  3PWQ A;  5GU0 X;  2WWX B;  3PVR B;  5JKM A;  5GN8 A;  1R03 A;  5FFC A;  3AF8 X;  3E1M A;  2CIH A;  3AJP A;  3LKD A;  1LKP A;  3SHX A;  3WNW A;  4XKT A;  5GOU A;  4ZKW A;  2ZA7 A;  3PW1 A;  2ZG7 X;  5J8S A;  4XKU A;  3SH6 A;  5LG2 A;  3R2O A;  4TOD A;  5FFB A;  3IS7 A;  2PYB A;  1DPS A;  1Z6O A;  2VXX A;  3UOF A;  4LPJ A;  3QVD A;  2F7N A;  3VV9 A;  1VEI A;  3O7R A;  1VJX A;  4E40 A;  2V8U A;  1N1Q A;  2V15 A;  3FI6 A;  1JRE A;  3E1N A;  2XJM A;  4ITW A;  3R2L A;  4PG0 A;  4DI0 A;  5GN8 B;  4KVQ A;  1JKV A;  1RCD A;  2FFX J;  3A68 A;  3HL1 A;  3A9Q A;  4PGI A;  2X17 0;  2YW7 A;  3W54 A;  4M32 A;  1TKP A;  3KA4 A;  3AF7 X;  3ES3 A;  2Y3Q A;  3JZA B;  3AF9 X;  4XGS A;  1VEQ A;  4ZKH A;  2C2F A;  3KXU A;  2CF7 A;  3KWO A;  2OKC A;  2YJJ A;  3FRR A;  3QZ3 A;  2W0O A;  5E1U A;  5GU3 X;  5LG8 A;  2ZG9 X;  2BKC A;  3F36 A;  3QD8 A;  2ZG8 X;  5AXS A;  1IER A;  2UX1 A;  3RAV A;  5JAC A;  4YVZ A;  2ZUR X;  3KHK A;  3EZ0 A;  2OC5 A;  3F33 A;  1JYB A;  5D8O A;  4ETR A;  3F34 A;  3RE7 A;  4EVE A;  1FHA A;  4WJG 4;  3PZA A;  1NNQ A;  3NOZ X;  4IXK A;  3KX9 A;  1J30 A;  3NP0 X;  1F33 A;  5I4J A;  4LQJ A;  3HIU A;  5J8W A;  4CVS A;  2ZA6 A;  4M34 A;  4YXJ A;  4W4L B;  4DYZ A;  1GWG A;  3KDQ A;  4AM5 A;  1AEW A;  4PGK A;  4ITT A;  1RCG A;  1OTK A;  3PVY A;  5D8Q A;  2XJN A;  5HU6 D;  3DBY A;  5HQO A;  3KA3 A;  5D8S A;  2V2M A;  2C2J A;  3C1Y A;  2FJC A;  4Y08 A;  5C6F A;  3GHQ A;  3OGH A;  3N6O A;  1TJO A;  5LBH A;  2VXI A;  1JGC A;  5IX6 A;  3F32 A;  3RD0 A;  3E1L A;  3UNO A;  5K52 A;  4RC5 B;  3GGZ A;  3EGM A;  2CN7 A;  4W4K B;  3BVI A;  4M33 A;  3GE4 A;  4RC7 A;  2Z5R A;  2XJO A;  2BK6 A;  4CY9 A;  3PW8 C;  4DE6 A;  3PWF A;  4MXP A;  4REU A;  3C1Z A;  4Z5S A;  2YJK A;  5ERJ A;  2AR0 A;  4X0J A;  2FHA A;  5HJH A;  4ZLW A;  1XZ1 A;  4ZTT A;  1QYB A;  3AK9 A;  4E6K A;  4PG1 A;  1DVB A;  3RGD A;  1JKU A;  1RCC A;  2Z5Q A;  2XGW A;  4CMY V;  3PW8 A;  2GYQ A;  2V2J A;  2QQY A;  1JI5 A;  3E1O A;  4AM4 A;  4ISM A;  4AM2 A;  4RC8 A;  4DYY A;  2FL0 A;  3Q4O A;  3T9J A;  5CMR A;  3KA8 A;  4LYU A;  1LKM A;  5GU2 X;  3VVA A;  3PW1 B;  3R2R A;  2IU2 A;  5JKL G;  3R2K A;  1L8I A;  1LB3 A;  5D8Y A;  3IS8 A;  3AJQ A;  1YV1 A;  4TOC A;  5J93 A;  3C21 A;  2C6R A;  4EVD A;  3SE1 A;  3E6S A;  4TOA A;  2YW6 A;  3UOI A;  2JD7 0;  2N02 A;  3M6J A;  2CHI A;  4KVS A;  1IES A;  2V2P A;  1JTS A;  4A25 A;  4LQN A;  2QF9 A;  2G38 B;  3NP2 X;  5FFE A;  3Q4N A;  1O9R A;  4ZL5 A;  4LQH A;  4KVR A;  3R2S A;  4MN9 A;  5CZU A;  4ZJK A;  2C41 A;  3TA8 A;  4ZKX A;  1JIG A;  3D19 A;  3F39 A;  3SID A;  3KA9 A;  4II4 A;  1O9I A;  4LPN A;  4ERU A;  4IWJ A;  4TOE A;  2ZA8 A;  3QHB A;  2V2I A;  4MKU A;  2CLU A;  4MY7 A;  3Q4R A;  4YKH A;  3BT5 A;  2FZF A;  2V2N A;  3F37 A;  4YXM A;  2CEI A;  3BKN A;  3E1P A;  3VNX A;  3O7S A;  3ISE A;  3PVT A;  1YUX A;  3JZ9 A;  4IWK A;  1ZUJ A;  5K53 A;  1MFR A;  2G4H A;  3AJO A;  4ZL6 A;  1RYT A;  3R2H A;  4TO9 A;  4EVC A;  1RCI A;  1ZS3 A;  3BVL A;  1VEL A;  4DYX A;  4LQV A;  4RC6 A;  2IB0 A;  3FVB A;  1VLG A;  2RBD A;  1BG7 A;  2V2R A;  4DYU A;  3WVV A;  2HTN A;  1SQ3 A;  1S2Z A;  1DAT A;  3GGY A;  4Z3B A;  5GU1 X;  1LKO A;  3F38 A;  5FEJ A;  5JKM G;  2V2S A;  5HJF A;  2Z90 A;  3PVT B;  3PVY B;  4P18 A;  2OH3 A;  3EZU A;  3F35 A;  4ML5 A;  1NFV A;  3ERZ A;  4DZ0 A;  1NF4 A;  3ISF A;  4RC6 B;  2MGY A;  3BVE A;  3AK8 A;  1H96 A;  5JDO A;  4XKS A;  2CN6 A;  1TK6 A;  4R42 A;  2Z5P A;  1Z4A A;  4RC7 B;  5D8P A;  1TKO A;  3QB9 A;  5JKL A;  3L0M A;  4CYA A;  2CWL A;  1L8H A;  2V8T A;  3R2M A;  1XZ3 A;  5E2D A;  4QUW A;  4MUD A;  1MOJ A;  4TOG A;  2WLU A;  2GS4 A;  3FRS A;  2Z6M A;  4OYN A;  3UFB A; 
#chains in the Genus database with same CATH homology
 2C2U A;  4KXR B;  1NF6 A;  2JD8 0;  3E2C A;  4MJY A;  3GVY A;  1S30 A;  2BJY A;  5ERK A;  2VZB A;  4U3G A;  4EVB A;  4LPM A;  5JDO B;  3OJ5 A;  5LS9 A;  4CVT A;  2FG4 A;  2GYD A;  3H7G A;  1UMN A;  2WLA A;  3E1Q A;  4CYB A;  3E6R A;  1S3Q A;  5D8X A;  1UVH A;  3WVW A;  1B71 A;  1QGH A;  2XKQ A;  1JI4 A;  3U90 A;  1KRQ A;  5D8R A;  4TOB A;  2JD6 0;  2ITB A;  3IQ1 A;  2FG8 A;  4TW3 A;  3PVR A;  2WTL A;  2Y44 A;  4ISP A;  2BW1 A;  5FFD A;  3Q4Q A;  1HRS A;  4CVP A;  1F30 A;  1SOF A;  3WVU A;  4TOH A;  5CMQ A;  4RC5 A;  1RCE A;  3KA6 A;  2V2L A;  4ZMC A;  3MPS A;  3PWQ C;  3BVF A;  4CVR A;  5J9V A;  1Z6O M;  3BVK A;  3E1J A;  1YUZ A;  2HR5 A;  4II4 B;  3V3K B;  4DAS A;  4TOF A;  2CHP A;  2D5K A;  4CMY A;  1BFR A;  3C23 A;  3RBC A;  4M35 A;  2CLB A;  5FFA A;  3QHC A;  3FSE A;  2V2O A;  2IY4 A;  1BCF A;  1EUM A;  2FKZ A;  4LYX A;  3PWQ A;  5GU0 X;  2WWX B;  3PVR B;  5JKM A;  5GN8 A;  1R03 A;  5FFC A;  3AF8 X;  3E1M A;  2CIH A;  3AJP A;  3LKD A;  1LKP A;  3SHX A;  3WNW A;  4XKT A;  5GOU A;  4ZKW A;  2ZA7 A;  3PW1 A;  2ZG7 X;  5J8S A;  4XKU A;  3SH6 A;  5LG2 A;  3R2O A;  4TOD A;  5FFB A;  3IS7 A;  2PYB A;  1DPS A;  1Z6O A;  2VXX A;  3UOF A;  4LPJ A;  3QVD A;  2F7N A;  3VV9 A;  1VEI A;  3O7R A;  1VJX A;  4E40 A;  2V8U A;  1N1Q A;  2V15 A;  3FI6 A;  1JRE A;  3E1N A;  2XJM A;  4ITW A;  3R2L A;  4PG0 A;  4DI0 A;  5GN8 B;  4KVQ A;  1JKV A;  1RCD A;  2FFX J;  3A68 A;  3HL1 A;  3A9Q A;  4PGI A;  2X17 0;  2YW7 A;  3W54 A;  4M32 A;  1TKP A;  3KA4 A;  3AF7 X;  3ES3 A;  2Y3Q A;  3JZA B;  3AF9 X;  4XGS A;  1VEQ A;  4ZKH A;  2C2F A;  3KXU A;  2CF7 A;  3KWO A;  2OKC A;  2YJJ A;  3FRR A;  3QZ3 A;  2W0O A;  5E1U A;  5GU3 X;  5LG8 A;  2ZG9 X;  2BKC A;  3F36 A;  3QD8 A;  2ZG8 X;  5AXS A;  1IER A;  2UX1 A;  3RAV A;  5JAC A;  4YVZ A;  2ZUR X;  3KHK A;  3EZ0 A;  2OC5 A;  3F33 A;  1JYB A;  5D8O A;  4ETR A;  3F34 A;  3RE7 A;  4EVE A;  1FHA A;  4WJG 4;  3PZA A;  1NNQ A;  3NOZ X;  4IXK A;  3KX9 A;  1J30 A;  3NP0 X;  1F33 A;  5I4J A;  4LQJ A;  3HIU A;  5J8W A;  4CVS A;  2ZA6 A;  4M34 A;  4YXJ A;  4W4L B;  4DYZ A;  1GWG A;  3KDQ A;  4AM5 A;  1AEW A;  4PGK A;  4ITT A;  1RCG A;  1OTK A;  3PVY A;  5D8Q A;  2XJN A;  5HU6 D;  3DBY A;  5HQO A;  3KA3 A;  5D8S A;  2V2M A;  2C2J A;  3C1Y A;  2FJC A;  4Y08 A;  5C6F A;  3GHQ A;  3OGH A;  3N6O A;  1TJO A;  5LBH A;  2VXI A;  1JGC A;  5IX6 A;  3F32 A;  3RD0 A;  3E1L A;  3UNO A;  5K52 A;  4RC5 B;  3GGZ A;  3EGM A;  2CN7 A;  4W4K B;  3BVI A;  4M33 A;  3GE4 A;  4RC7 A;  2Z5R A;  2XJO A;  2BK6 A;  4CY9 A;  3PW8 C;  4DE6 A;  3PWF A;  4MXP A;  4REU A;  3C1Z A;  4Z5S A;  2YJK A;  5ERJ A;  2AR0 A;  4X0J A;  2FHA A;  5HJH A;  4ZLW A;  1XZ1 A;  4ZTT A;  1QYB A;  3AK9 A;  4E6K A;  4PG1 A;  1DVB A;  3RGD A;  1JKU A;  1RCC A;  2Z5Q A;  2XGW A;  4CMY V;  3PW8 A;  2GYQ A;  2V2J A;  2QQY A;  1JI5 A;  3E1O A;  4AM4 A;  4ISM A;  4AM2 A;  4RC8 A;  4DYY A;  2FL0 A;  3Q4O A;  3T9J A;  5CMR A;  3KA8 A;  4LYU A;  1LKM A;  5GU2 X;  3VVA A;  3PW1 B;  3R2R A;  2IU2 A;  5JKL G;  3R2K A;  1L8I A;  1LB3 A;  5D8Y A;  3IS8 A;  3AJQ A;  1YV1 A;  4TOC A;  5J93 A;  3C21 A;  2C6R A;  4EVD A;  3SE1 A;  3E6S A;  4TOA A;  2YW6 A;  3UOI A;  2JD7 0;  2N02 A;  3M6J A;  2CHI A;  4KVS A;  1IES A;  2V2P A;  1JTS A;  4A25 A;  4LQN A;  2QF9 A;  2G38 B;  3NP2 X;  5FFE A;  3Q4N A;  1O9R A;  4ZL5 A;  4LQH A;  4KVR A;  3R2S A;  4MN9 A;  5CZU A;  4ZJK A;  2C41 A;  3TA8 A;  4ZKX A;  1JIG A;  3D19 A;  3F39 A;  3SID A;  3KA9 A;  4II4 A;  1O9I A;  4LPN A;  4ERU A;  4IWJ A;  4TOE A;  2ZA8 A;  3QHB A;  2V2I A;  4MKU A;  2CLU A;  4MY7 A;  3Q4R A;  4YKH A;  3BT5 A;  2FZF A;  2V2N A;  3F37 A;  4YXM A;  2CEI A;  3BKN A;  3E1P A;  3VNX A;  3O7S A;  3ISE A;  3PVT A;  1YUX A;  3JZ9 A;  4IWK A;  1ZUJ A;  5K53 A;  1MFR A;  2G4H A;  3AJO A;  4ZL6 A;  1RYT A;  3R2H A;  4TO9 A;  4EVC A;  1RCI A;  1ZS3 A;  3BVL A;  1VEL A;  4DYX A;  4LQV A;  4RC6 A;  2IB0 A;  3FVB A;  1VLG A;  2RBD A;  1BG7 A;  2V2R A;  4DYU A;  3WVV A;  2HTN A;  1SQ3 A;  1S2Z A;  1DAT A;  3GGY A;  4Z3B A;  5GU1 X;  1LKO A;  3F38 A;  5FEJ A;  5JKM G;  2V2S A;  5HJF A;  2Z90 A;  3PVT B;  3PVY B;  4P18 A;  2OH3 A;  3EZU A;  3F35 A;  4ML5 A;  1NFV A;  3ERZ A;  4DZ0 A;  1NF4 A;  3ISF A;  4RC6 B;  2MGY A;  3BVE A;  3AK8 A;  1H96 A;  5JDO A;  4XKS A;  2CN6 A;  1TK6 A;  4R42 A;  2Z5P A;  1Z4A A;  4RC7 B;  5D8P A;  1TKO A;  3QB9 A;  5JKL A;  3L0M A;  4CYA A;  2CWL A;  1L8H A;  2V8T A;  3R2M A;  1XZ3 A;  5E2D A;  4QUW A;  4MUD A;  1MOJ A;  4TOG A;  2WLU A;  2GS4 A;  3FRS A;  2Z6M A;  4OYN A;  3UFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...