3A68A

Crystal structure of plant ferritin reveals a novel metal binding site that functions as a transit site for metal transfer in ferritin
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
194
structure length
194
Chain Sequence
IFEPFEEVKKELDLVPTVPQASLARQKYVDESESAVNEQINVEYNVSYVYHAMFAYFDRDNVALRGLAKFFKESSEEEREHAEKLMEYQNKRGGKVKLQSIVMPLSDFDHADKGDALHAMELALSLEKLTNEKLLNLHSVATKNGDVQLADFVETEYLGEQVEAIKRISEYVAQLRRVGKGHGVWHFDQMLLHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ferritin-4, chloroplastic
publication title Crystal structure of plant ferritin reveals a novel metal binding site that functions as a transit site for metal transfer in ferritin
pubmed doi rcsb
source organism Glycine max
total genus 77
structure length 194
sequence length 194
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2009-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3a68A00
3NP0X 2UX1A 2BJYA 1SQ3A 3IS7A 1JI4A 4TOHA 3AF7X 4DYXA 1QGHA 3AK9A 1SOFA 1KRQA 3SIDA 2HTNA 3F32A 3A68A 3KA8A 4IXKA 3PW8A 3PVTA 3RAVA 4TW3A 3PW1B 4AM5A 3BVLA 3U90A 3UOIA 4ITWA 2VXIA 1BG7A 1L8IA 2IU2A 1S2ZA 2C2UA 2W0OA 1VJXA 2JD60 2FHAA 4II4A 3PVRA 4TODA 3SHXA 3WVWA 1VELA 2G4HA 3F35A 3KA9A 4EVBA 1JIGA 1LKOA 2BW1A 1Z6OA 5K53A 4XKTA 5HQOA 4A25A 1JKVA 3ISFA 3E6RA 1JI5A 2V2SA 4M33A 5JKMG 4CVTA 4IWJA 1Z6OM 1RCDA 1O9IA 5GN8B 3IS8A 2VZBA 5HJHA 3O7SA 2GS4A 4P18A 1TKOA 1JREA 4ISMA 2XJOA 2BKCA 3KA3A 3O7RA 4DYZA 1JTSA 1Z4AA 5D8XA 2JD70 4QUWA 4KVSA 5FEJA 2C2FA 2C2JA 3E1JA 1GWGA 5JKLG 5FFBA 2V2LA 1NFVA 3BVIA 2YJKA 5GOUA 3GVYA 3PZAA 4YKHA 4ZL6A 1R03A 3EZ0A 4DASA 3KA6A 3EZUA 1FHAA 3QD8A 1NF4A 4DYYA 5GU3X 3R2SA 2FL0A 4ML5A 1YUZA 2V15A 4Y08A 3AJPA 5E1UA 3TA8A 3OJ5A 4XKUA 4ZMCA 3RBCA 3ES3A 3WNWA 5ERKA 4TOFA 2WTLA 4CMYV 1LKMA 4PG0A 2FJCA 2XGWA 3WVVA 2ZA7A 1BCFA 3RD0A 1NNQA 2ZG9X 4RC7B 5AXSA 4RC8A 2Z6MA 3NOZX 5GU2X 3WVUA 4ZLWA 4RC5A 3Q4QA 4LPJA 4CYBA 5D8SA 5JACA 2Z5QA 5J9VA 2YW7A 5FFDA 1O9RA 4XKSA 2GYQA 1UMNA 5D8PA 2FG8A 2ZURX 4LPMA 4DYUA 3AF8X 5FFAA 3AK8A 4TOEA 3EGMA 3T9JA 2WLAA 3E1LA 4DZ0A 4Z3BA 1L8HA 1RYTA 3KWOA 4MY7A 4LYXA 3MPSA 4E6KA 4PGIA 3Q4RA 3E1PA 2XJNA 4CY9A 3R2KA 2WLUA 5D8YA 1JGCA 1NF6A 3HL1A 5GN8A 3SH6A 3ISEA 5GU1X 3RE7A 4ZKHA 5J8WA 2V2OA 4Z5SA 2FKZA 4TOBA 1OTKA 3R2HA 3E1NA 2V2MA 3HIUA 4LQJA 2IB0A 1RCEA 5J93A 1YV1A 5JKMA 3FVBA 3E1MA 4CMYA 5FFEA 4CVPA 2GYDA 3H7GA 4LPNA 2ZG8X 1LKPA 2OC5A 1DPSA 2ZG7X 4AM4A 5J8SA 2CIHA 3OGHA 3BVKA 3F38A 2RBDA 2QQYA 5JKLA 5CMQA 2CHIA 3Q4OA 1TKPA 2IY4A 5CMRA 4ZL5A 4DI0A 4ZKWA 3KX9A 2CHPA 3AF9X 3BKNA 4MN9A 2X170 5FFCA 1AEWA 3Q4NA 5LG8A 1QYBA 5E2DA 5IX6A 2Y3QA 2CLUA 5ERJA 3NP2X 4RC7A 4LQNA 1RCCA 3GE4A 2F7NA 1TK6A 4ETRA 5HJFA 3R2LA 1MFRA 3AJOA 1LB3A 3FI6A 4LYUA 3UNOA 1EUMA 2JD80 3PVYB 1DVBA 2V2NA 3F33A 3QB9A 1RCIA 3KA4A 2XJMA 3PW1A 3F37A 4AM2A 5LS9A 1S30A 4MKUA 4IWKA 4RC6B 2CLBA 2PYBA 2Z5RA 2CN7A 1VEIA 3ERZA 1HRSA 4KVQA 2Z90A 2CEIA 3E2CA 3E1QA 1JYBA 4PGKA 1IESA 4RC5B 3AJQA 1IERA 4ZKXA 3R2OA 5GU0X 3F36A 5LG2A 3PVTB 4U3GA 3PWQC 2D5KA 1RCGA 4LQVA 1ZUJA 1TJOA 2Z5PA 2OH3A 2YJJA 2C41A 5K52A 3QHBA 3PWFA 1DATA 1F33A 5CZUA 4TOGA 2C6RA 1J30A 2FZFA 4II4B 3PVRB 5D8QA 3PWQA 3IQ1A 2FFXJ 4REUA 4CYAA 4XGSA 5I4JA 5D8RA 3VNXA 3BVEA 1F30A 2CN6A 3E6SA 1B71A 1BFRA 3FSEA 4TOCA 3QVDA 4OYNA 4KVRA 1VLGA 3F34A 4ZTTA 3QZ3A 4EVDA 2QF9A 3E1OA 1UVHA 1XZ1A 4CVRA 2YW6A 1MOJA 5C6FA 3QHCA 2V2JA 4ERUA 4R42A 4MJYA 4ZJKA 1VEQA 4EVEA 4MUDA 2ITBA 1ZS3A 3UOFA 4ISPA 4DE6A 4PG1A 2HR5A 4ITTA 1XZ3A 1S3QA 2V2RA 3PVYA 4M32A 2FG4A 3KXUA 3BVFA 4M35A 2BK6A 2ZA6A 1YUXA 2V2IA 1JKUA 4LQHA 2V2PA 4EVCA 3RGDA 4CVSA 2ZA8A 3R2RA 1N1QA 4RC6A 3GHQA 3BT5A 4TOAA 4M34A 3PW8C 4TO9A 5D8OA 2CF7A 3F39A 2XKQA 1H96A 3SE1A 5LBHA 3A9QA 3R2MA 2VXXA
chains in the Genus database with same CATH superfamily
3NP0X 2UX1A 2BJYA 1SQ3A 3IS7A 1JI4A 4TOHA 3AF7X 4DYXA 1QGHA 3AK9A 1SOFA 1KRQA 3SIDA 2HTNA 3F32A 3A68A 3KA8A 4IXKA 3PW8A 3PVTA 3RAVA 4TW3A 3PW1B 3DBYA 4AM5A 3FRRA 3BVLA 3U90A 3L0MA 3UOIA 4ITWA 2VXIA 3V3KB 1BG7A 1L8IA 2IU2A 1S2ZA 2C2UA 2W0OA 1VJXA 2JD60 2FHAA 4II4A 3PVRA 4TODA 3SHXA 3WVWA 1VELA 4W4LB 2G4HA 3F35A 3KA9A 4EVBA 1JIGA 1LKOA 2BW1A 3GGYA 1Z6OA 5K53A 4XKTA 5HQOA 4A25A 1JKVA 3ISFA 3E6RA 1JI5A 2V2SA 4M33A 3GGZA 4CVTA 5JKMG 4IWJA 3FRSA 1Z6OM 1RCDA 1O9IA 5GN8B 3IS8A 2VZBA 5HJHA 3O7SA 2GS4A 4P18A 1TKOA 1JREA 4ISMA 2XJOA 2BKCA 3KA3A 3O7RA 4DYZA 1JTSA 1Z4AA 5D8XA 2JD70 4QUWA 4KVSA 5FEJA 2C2FA 3C1ZA 3VVAA 2C2JA 3E1JA 1GWGA 5JKLG 5FFBA 3C1YA 2V2LA 1NFVA 3BVIA 2YJKA 5GOUA 3GVYA 3PZAA 4YKHA 4ZL6A 1R03A 3EZ0A 4DASA 3KA6A 3UFBA 4KXRB 3EZUA 1FHAA 3QD8A 1NF4A 4DYYA 5GU3X 3R2SA 2FL0A 4ML5A 1YUZA 2V15A 4Y08A 3AJPA 5E1UA 3TA8A 3OJ5A 4XKUA 4ZMCA 3RBCA 3KHKA 3ES3A 3WNWA 5ERKA 4TOFA 2WTLA 4CMYV 1LKMA 4PG0A 2FJCA 2XGWA 3WVVA 2ZA7A 1BCFA 3RD0A 1NNQA 2ZG9X 4RC7B 5AXSA 4RC8A 2Z6MA 3NOZX 5GU2X 3WVUA 3JZAB 4ZLWA 4RC5A 3Q4QA 4LPJA 4CYBA 5D8SA 5JACA 2Z5QA 5J9VA 2YW7A 5FFDA 1O9RA 4XKSA 2GYQA 1UMNA 5D8PA 2FG8A 2ZURX 4LPMA 4DYUA 4WJG4 3AF8X 5FFAA 3AK8A 4TOEA 3EGMA 3T9JA 2WLAA 3E1LA 4DZ0A 4Z3BA 1L8HA 3JZ9A 1RYTA 3KWOA 4MY7A 4LYXA 3MPSA 4E6KA 4PGIA 3Q4RA 3C21A 3E1PA 2XJNA 4CY9A 3R2KA 2WLUA 5D8YA 1JGCA 1NF6A 3HL1A 5GN8A 3SH6A 3ISEA 5GU1X 4YXMA 3RE7A 4ZKHA 5J8WA 2V2OA 4Z5SA 2FKZA 4TOBA 1OTKA 3R2HA 3E1NA 2V2MA 3HIUA 4LQJA 2IB0A 1RCEA 5J93A 1YV1A 5JKMA 3FVBA 3E1MA 4CMYA 5FFEA 4CVPA 2GYDA 3H7GA 4LPNA 2ZG8X 1LKPA 2OC5A 1DPSA 2ZG7X 4AM4A 5J8SA 2CIHA 3OGHA 3BVKA 2V8UA 3F38A 2G38B 2RBDA 2QQYA 5JKLA 5CMQA 2CHIA 3Q4OA 3M6JA 1TKPA 2IY4A 4MXPA 3LKDA 5CMRA 4ZL5A 4DI0A 4ZKWA 3KX9A 2CHPA 3AF9X 3BKNA 4MN9A 2X170 5FFCA 1AEWA 3Q4NA 5LG8A 1QYBA 5E2DA 5IX6A 2Y3QA 2CLUA 5ERJA 3NP2X 4RC7A 4LQNA 1RCCA 3GE4A 2F7NA 4X0JA 1TK6A 4ETRA 5HJFA 3R2LA 1MFRA 3AJOA 1LB3A 3FI6A 4LYUA 3UNOA 1EUMA 2JD80 3PVYB 1DVBA 2V2NA 3F33A 3QB9A 1RCIA 3KA4A 2XJMA 3PW1A 3F37A 4AM2A 5LS9A 1S30A 4MKUA 4IWKA 4RC6B 2CLBA 2PYBA 2Z5RA 2CN7A 5JDOB 1VEIA 3ERZA 1HRSA 4KVQA 2Z90A 2CEIA 3E2CA 3E1QA 1JYBA 4PGKA 4W4KB 1IESA 4RC5B 2OKCA 3AJQA 1IERA 4ZKXA 3R2OA 5GU0X 3F36A 4YXJA 5LG2A 3PVTB 4U3GA 3W54A 3PWQC 2D5KA 1RCGA 4LQVA 1ZUJA 3C23A 1TJOA 2Z5PA 2OH3A 2YJJA 2C41A 5K52A 3QHBA 3PWFA 1DATA 1F33A 5CZUA 4TOGA 2C6RA 1J30A 5HU6D 2FZFA 3N6OA 4II4B 3PVRB 3KDQA 5D8QA 3PWQA 2WWXB 3IQ1A 2FFXJ 4REUA 4CYAA 4E40A 4XGSA 5I4JA 5D8RA 3VNXA 3BVEA 1F30A 2CN6A 3E6SA 1B71A 1BFRA 2N02A 3FSEA 4TOCA 3QVDA 4OYNA 4KVRA 1VLGA 3F34A 4ZTTA 3QZ3A 4EVDA 2QF9A 3E1OA 1UVHA 1XZ1A 4CVRA 2YW6A 1MOJA 5C6FA 3QHCA 2AR0A 2V2JA 4ERUA 4R42A 4MJYA 4ZJKA 1VEQA 4EVEA 4MUDA 2ITBA 1ZS3A 2MGYA 3UOFA 4ISPA 4DE6A 4PG1A 2HR5A 4ITTA 1XZ3A 1S3QA 2V2RA 2Y44A 3PVYA 2FG4A 3KXUA 4M32A 3BVFA 2BK6A 2ZA6A 4M35A 1YUXA 2V2IA 1JKUA 4LQHA 2V2PA 4YVZA 4EVCA 2V8TA 3RGDA 4CVSA 2ZA8A 3R2RA 1N1QA 4RC6A 3GHQA 3BT5A 4TOAA 4M34A 5JDOA 3PW8C 4TO9A 5D8OA 2CF7A 3F39A 2XKQA 1H96A 3VV9A 3SE1A 5LBHA 2CWLA 3A9QA 3R2MA 2VXXA 3D19A
chains in the Genus database with same CATH topology
3NP0X 2UX1A 2BJYA 1SQ3A 3IS7A 1JI4A 4TOHA 3AF7X 4DYXA 1QGHA 3AK9A 1SOFA 1KRQA 3SIDA 2HTNA 3F32A 3A68A 3KA8A 4IXKA 3PW8A 3PVTA 3RAVA 4TW3A 3PW1B 3DBYA 4AM5A 3FRRA 3BVLA 3U90A 3L0MA 3UOIA 4ITWA 2VXIA 3V3KB 1BG7A 1L8IA 2IU2A 1S2ZA 2C2UA 2W0OA 1VJXA 2JD60 2FHAA 4II4A 3PVRA 4TODA 3SHXA 3WVWA 1VELA 4W4LB 2G4HA 3F35A 3KA9A 4EVBA 1JIGA 1LKOA 2BW1A 3GGYA 1Z6OA 5K53A 4XKTA 5HQOA 4A25A 1JKVA 3ISFA 3E6RA 1JI5A 2V2SA 4M33A 3GGZA 4CVTA 5JKMG 4IWJA 3FRSA 1Z6OM 1RCDA 1O9IA 5GN8B 3IS8A 2VZBA 5HJHA 3O7SA 2GS4A 4P18A 1TKOA 1JREA 4ISMA 2XJOA 2BKCA 3KA3A 3O7RA 4DYZA 1JTSA 1Z4AA 5D8XA 2JD70 4QUWA 4KVSA 5FEJA 2C2FA 3C1ZA 3VVAA 2C2JA 3E1JA 1GWGA 5JKLG 5FFBA 3C1YA 2V2LA 1NFVA 3BVIA 2YJKA 5GOUA 3GVYA 3PZAA 4YKHA 4ZL6A 1R03A 3EZ0A 4DASA 3KA6A 3UFBA 4KXRB 3EZUA 1FHAA 3QD8A 1NF4A 4DYYA 5GU3X 3R2SA 2FL0A 4ML5A 1YUZA 2V15A 4Y08A 3AJPA 5E1UA 3TA8A 3OJ5A 4XKUA 4ZMCA 3RBCA 3KHKA 3ES3A 3WNWA 5ERKA 4TOFA 2WTLA 4CMYV 1LKMA 4PG0A 2FJCA 2XGWA 3WVVA 2ZA7A 1BCFA 3RD0A 1NNQA 2ZG9X 4RC7B 5AXSA 4RC8A 2Z6MA 3NOZX 5GU2X 3WVUA 3JZAB 4ZLWA 4RC5A 3Q4QA 4LPJA 4CYBA 5D8SA 5JACA 2Z5QA 5J9VA 2YW7A 5FFDA 1O9RA 4XKSA 2GYQA 1UMNA 5D8PA 2FG8A 2ZURX 4LPMA 4DYUA 4WJG4 3AF8X 5FFAA 3AK8A 4TOEA 3EGMA 3T9JA 2WLAA 3E1LA 4DZ0A 4Z3BA 1L8HA 3JZ9A 1RYTA 3KWOA 4MY7A 4LYXA 3MPSA 4E6KA 4PGIA 3Q4RA 3C21A 3E1PA 2XJNA 4CY9A 3R2KA 2WLUA 5D8YA 1JGCA 1NF6A 3HL1A 5GN8A 3SH6A 3ISEA 5GU1X 4YXMA 3RE7A 4ZKHA 5J8WA 2V2OA 4Z5SA 2FKZA 4TOBA 1OTKA 3R2HA 3E1NA 2V2MA 3HIUA 4LQJA 2IB0A 1RCEA 5J93A 1YV1A 5JKMA 3FVBA 3E1MA 4CMYA 5FFEA 4CVPA 2GYDA 3H7GA 4LPNA 2ZG8X 1LKPA 2OC5A 1DPSA 2ZG7X 4AM4A 5J8SA 2CIHA 3OGHA 3BVKA 2V8UA 3F38A 2G38B 2RBDA 2QQYA 5JKLA 5CMQA 2CHIA 3Q4OA 3M6JA 1TKPA 2IY4A 4MXPA 3LKDA 5CMRA 4ZL5A 4DI0A 4ZKWA 3KX9A 2CHPA 3AF9X 3BKNA 4MN9A 2X170 5FFCA 1AEWA 3Q4NA 5LG8A 1QYBA 5E2DA 5IX6A 2Y3QA 2CLUA 5ERJA 3NP2X 4RC7A 4LQNA 1RCCA 3GE4A 2F7NA 4X0JA 1TK6A 4ETRA 5HJFA 3R2LA 1MFRA 3AJOA 1LB3A 3FI6A 4LYUA 3UNOA 1EUMA 2JD80 3PVYB 1DVBA 2V2NA 3F33A 3QB9A 1RCIA 3KA4A 2XJMA 3PW1A 3F37A 4AM2A 5LS9A 1S30A 4MKUA 4IWKA 4RC6B 2CLBA 2PYBA 2Z5RA 2CN7A 5JDOB 1VEIA 3ERZA 1HRSA 4KVQA 2Z90A 2CEIA 3E2CA 3E1QA 1JYBA 4PGKA 4W4KB 1IESA 4RC5B 2OKCA 3AJQA 1IERA 4ZKXA 3R2OA 5GU0X 3F36A 4YXJA 5LG2A 3PVTB 4U3GA 3W54A 3PWQC 2D5KA 1RCGA 4LQVA 1ZUJA 3C23A 1TJOA 2Z5PA 2OH3A 2YJJA 2C41A 5K52A 3QHBA 3PWFA 1DATA 1F33A 5CZUA 4TOGA 2C6RA 1J30A 5HU6D 2FZFA 3N6OA 4II4B 3PVRB 3KDQA 5D8QA 3PWQA 2WWXB 3IQ1A 2FFXJ 4REUA 4CYAA 4E40A 4XGSA 5I4JA 5D8RA 3VNXA 3BVEA 1F30A 2CN6A 3E6SA 1B71A 1BFRA 2N02A 3FSEA 4TOCA 3QVDA 4OYNA 4KVRA 1VLGA 3F34A 4ZTTA 3QZ3A 4EVDA 2QF9A 3E1OA 1UVHA 1XZ1A 4CVRA 2YW6A 1MOJA 5C6FA 3QHCA 2AR0A 2V2JA 4ERUA 4R42A 4MJYA 4ZJKA 1VEQA 4EVEA 4MUDA 2ITBA 1ZS3A 2MGYA 3UOFA 4ISPA 4DE6A 4PG1A 2HR5A 4ITTA 1XZ3A 1S3QA 2V2RA 2Y44A 3PVYA 2FG4A 3KXUA 4M32A 3BVFA 2BK6A 2ZA6A 4M35A 1YUXA 2V2IA 1JKUA 4LQHA 2V2PA 4YVZA 4EVCA 2V8TA 3RGDA 4CVSA 2ZA8A 3R2RA 1N1QA 4RC6A 3GHQA 3BT5A 4TOAA 4M34A 5JDOA 3PW8C 4TO9A 5D8OA 2CF7A 3F39A 2XKQA 1H96A 3VV9A 3SE1A 5LBHA 2CWLA 3A9QA 3R2MA 2VXXA 3D19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NP0 X;  2UX1 A;  2BJY A;  1SQ3 A;  3IS7 A;  1JI4 A;  4TOH A;  3AF7 X;  4DYX A;  1QGH A;  3AK9 A;  1SOF A;  1KRQ A;  3SID A;  2HTN A;  3F32 A;  3A68 A;  3KA8 A;  4IXK A;  3PW8 A;  3PVT A;  3RAV A;  4TW3 A;  3PW1 B;  4AM5 A;  3BVL A;  3U90 A;  3UOI A;  4ITW A;  2VXI A;  1BG7 A;  1L8I A;  2IU2 A;  1S2Z A;  2C2U A;  2W0O A;  1VJX A;  2JD6 0;  2FHA A;  4II4 A;  3PVR A;  4TOD A;  3SHX A;  3WVW A;  1VEL A;  2G4H A;  3F35 A;  3KA9 A;  4EVB A;  1JIG A;  1LKO A;  2BW1 A;  1Z6O A;  5K53 A;  4XKT A;  5HQO A;  4A25 A;  1JKV A;  3ISF A;  3E6R A;  1JI5 A;  2V2S A;  4M33 A;  5JKM G;  4CVT A;  4IWJ A;  1Z6O M;  1RCD A;  1O9I A;  5GN8 B;  3IS8 A;  2VZB A;  5HJH A;  3O7S A;  2GS4 A;  4P18 A;  1TKO A;  1JRE A;  4ISM A;  2XJO A;  2BKC A;  3KA3 A;  3O7R A;  4DYZ A;  1JTS A;  1Z4A A;  5D8X A;  2JD7 0;  4QUW A;  4KVS A;  5FEJ A;  2C2F A;  2C2J A;  3E1J A;  1GWG A;  5JKL G;  5FFB A;  2V2L A;  1NFV A;  3BVI A;  2YJK A;  5GOU A;  3GVY A;  3PZA A;  4YKH A;  4ZL6 A;  1R03 A;  3EZ0 A;  4DAS A;  3KA6 A;  3EZU A;  1FHA A;  3QD8 A;  1NF4 A;  4DYY A;  5GU3 X;  3R2S A;  2FL0 A;  4ML5 A;  1YUZ A;  2V15 A;  4Y08 A;  3AJP A;  5E1U A;  3TA8 A;  3OJ5 A;  4XKU A;  4ZMC A;  3RBC A;  3ES3 A;  3WNW A;  5ERK A;  4TOF A;  2WTL A;  4CMY V;  1LKM A;  4PG0 A;  2FJC A;  2XGW A;  3WVV A;  2ZA7 A;  1BCF A;  3RD0 A;  1NNQ A;  2ZG9 X;  4RC7 B;  5AXS A;  4RC8 A;  2Z6M A;  3NOZ X;  5GU2 X;  3WVU A;  4ZLW A;  4RC5 A;  3Q4Q A;  4LPJ A;  4CYB A;  5D8S A;  5JAC A;  2Z5Q A;  5J9V A;  2YW7 A;  5FFD A;  1O9R A;  4XKS A;  2GYQ A;  1UMN A;  5D8P A;  2FG8 A;  2ZUR X;  4LPM A;  4DYU A;  3AF8 X;  5FFA A;  3AK8 A;  4TOE A;  3EGM A;  3T9J A;  2WLA A;  3E1L A;  4DZ0 A;  4Z3B A;  1L8H A;  1RYT A;  3KWO A;  4MY7 A;  4LYX A;  3MPS A;  4E6K A;  4PGI A;  3Q4R A;  3E1P A;  2XJN A;  4CY9 A;  3R2K A;  2WLU A;  5D8Y A;  1JGC A;  1NF6 A;  3HL1 A;  5GN8 A;  3SH6 A;  3ISE A;  5GU1 X;  3RE7 A;  4ZKH A;  5J8W A;  2V2O A;  4Z5S A;  2FKZ A;  4TOB A;  1OTK A;  3R2H A;  3E1N A;  2V2M A;  3HIU A;  4LQJ A;  2IB0 A;  1RCE A;  5J93 A;  1YV1 A;  5JKM A;  3FVB A;  3E1M A;  4CMY A;  5FFE A;  4CVP A;  2GYD A;  3H7G A;  4LPN A;  2ZG8 X;  1LKP A;  2OC5 A;  1DPS A;  2ZG7 X;  4AM4 A;  5J8S A;  2CIH A;  3OGH A;  3BVK A;  3F38 A;  2RBD A;  2QQY A;  5JKL A;  5CMQ A;  2CHI A;  3Q4O A;  1TKP A;  2IY4 A;  5CMR A;  4ZL5 A;  4DI0 A;  4ZKW A;  3KX9 A;  2CHP A;  3AF9 X;  3BKN A;  4MN9 A;  2X17 0;  5FFC A;  1AEW A;  3Q4N A;  5LG8 A;  1QYB A;  5E2D A;  5IX6 A;  2Y3Q A;  2CLU A;  5ERJ A;  3NP2 X;  4RC7 A;  4LQN A;  1RCC A;  3GE4 A;  2F7N A;  1TK6 A;  4ETR A;  5HJF A;  3R2L A;  1MFR A;  3AJO A;  1LB3 A;  3FI6 A;  4LYU A;  3UNO A;  1EUM A;  2JD8 0;  3PVY B;  1DVB A;  2V2N A;  3F33 A;  3QB9 A;  1RCI A;  3KA4 A;  2XJM A;  3PW1 A;  3F37 A;  4AM2 A;  5LS9 A;  1S30 A;  4MKU A;  4IWK A;  4RC6 B;  2CLB A;  2PYB A;  2Z5R A;  2CN7 A;  1VEI A;  3ERZ A;  1HRS A;  4KVQ A;  2Z90 A;  2CEI A;  3E2C A;  3E1Q A;  1JYB A;  4PGK A;  1IES A;  4RC5 B;  3AJQ A;  1IER A;  4ZKX A;  3R2O A;  5GU0 X;  3F36 A;  5LG2 A;  3PVT B;  4U3G A;  3PWQ C;  2D5K A;  1RCG A;  4LQV A;  1ZUJ A;  1TJO A;  2Z5P A;  2OH3 A;  2YJJ A;  2C41 A;  5K52 A;  3QHB A;  3PWF A;  1DAT A;  1F33 A;  5CZU A;  4TOG A;  2C6R A;  1J30 A;  2FZF A;  4II4 B;  3PVR B;  5D8Q A;  3PWQ A;  3IQ1 A;  2FFX J;  4REU A;  4CYA A;  4XGS A;  5I4J A;  5D8R A;  3VNX A;  3BVE A;  1F30 A;  2CN6 A;  3E6S A;  1B71 A;  1BFR A;  3FSE A;  4TOC A;  3QVD A;  4OYN A;  4KVR A;  1VLG A;  3F34 A;  4ZTT A;  3QZ3 A;  4EVD A;  2QF9 A;  3E1O A;  1UVH A;  1XZ1 A;  4CVR A;  2YW6 A;  1MOJ A;  5C6F A;  3QHC A;  2V2J A;  4ERU A;  4R42 A;  4MJY A;  4ZJK A;  1VEQ A;  4EVE A;  4MUD A;  2ITB A;  1ZS3 A;  3UOF A;  4ISP A;  4DE6 A;  4PG1 A;  2HR5 A;  4ITT A;  1XZ3 A;  1S3Q A;  2V2R A;  3PVY A;  4M32 A;  2FG4 A;  3KXU A;  3BVF A;  4M35 A;  2BK6 A;  2ZA6 A;  1YUX A;  2V2I A;  1JKU A;  4LQH A;  2V2P A;  4EVC A;  3RGD A;  4CVS A;  2ZA8 A;  3R2R A;  1N1Q A;  4RC6 A;  3GHQ A;  3BT5 A;  4TOA A;  4M34 A;  3PW8 C;  4TO9 A;  5D8O A;  2CF7 A;  3F39 A;  2XKQ A;  1H96 A;  3SE1 A;  5LBH A;  3A9Q A;  3R2M A;  2VXX A; 
#chains in the Genus database with same CATH topology
 3NP0 X;  2UX1 A;  2BJY A;  1SQ3 A;  3IS7 A;  1JI4 A;  4TOH A;  3AF7 X;  4DYX A;  1QGH A;  3AK9 A;  1SOF A;  1KRQ A;  3SID A;  2HTN A;  3F32 A;  3A68 A;  3KA8 A;  4IXK A;  3PW8 A;  3PVT A;  3RAV A;  4TW3 A;  3PW1 B;  3DBY A;  4AM5 A;  3FRR A;  3BVL A;  3U90 A;  3L0M A;  3UOI A;  4ITW A;  2VXI A;  3V3K B;  1BG7 A;  1L8I A;  2IU2 A;  1S2Z A;  2C2U A;  2W0O A;  1VJX A;  2JD6 0;  2FHA A;  4II4 A;  3PVR A;  4TOD A;  3SHX A;  3WVW A;  1VEL A;  4W4L B;  2G4H A;  3F35 A;  3KA9 A;  4EVB A;  1JIG A;  1LKO A;  2BW1 A;  3GGY A;  1Z6O A;  5K53 A;  4XKT A;  5HQO A;  4A25 A;  1JKV A;  3ISF A;  3E6R A;  1JI5 A;  2V2S A;  4M33 A;  3GGZ A;  4CVT A;  5JKM G;  4IWJ A;  3FRS A;  1Z6O M;  1RCD A;  1O9I A;  5GN8 B;  3IS8 A;  2VZB A;  5HJH A;  3O7S A;  2GS4 A;  4P18 A;  1TKO A;  1JRE A;  4ISM A;  2XJO A;  2BKC A;  3KA3 A;  3O7R A;  4DYZ A;  1JTS A;  1Z4A A;  5D8X A;  2JD7 0;  4QUW A;  4KVS A;  5FEJ A;  2C2F A;  3C1Z A;  3VVA A;  2C2J A;  3E1J A;  1GWG A;  5JKL G;  5FFB A;  3C1Y A;  2V2L A;  1NFV A;  3BVI A;  2YJK A;  5GOU A;  3GVY A;  3PZA A;  4YKH A;  4ZL6 A;  1R03 A;  3EZ0 A;  4DAS A;  3KA6 A;  3UFB A;  4KXR B;  3EZU A;  1FHA A;  3QD8 A;  1NF4 A;  4DYY A;  5GU3 X;  3R2S A;  2FL0 A;  4ML5 A;  1YUZ A;  2V15 A;  4Y08 A;  3AJP A;  5E1U A;  3TA8 A;  3OJ5 A;  4XKU A;  4ZMC A;  3RBC A;  3KHK A;  3ES3 A;  3WNW A;  5ERK A;  4TOF A;  2WTL A;  4CMY V;  1LKM A;  4PG0 A;  2FJC A;  2XGW A;  3WVV A;  2ZA7 A;  1BCF A;  3RD0 A;  1NNQ A;  2ZG9 X;  4RC7 B;  5AXS A;  4RC8 A;  2Z6M A;  3NOZ X;  5GU2 X;  3WVU A;  3JZA B;  4ZLW A;  4RC5 A;  3Q4Q A;  4LPJ A;  4CYB A;  5D8S A;  5JAC A;  2Z5Q A;  5J9V A;  2YW7 A;  5FFD A;  1O9R A;  4XKS A;  2GYQ A;  1UMN A;  5D8P A;  2FG8 A;  2ZUR X;  4LPM A;  4DYU A;  4WJG 4;  3AF8 X;  5FFA A;  3AK8 A;  4TOE A;  3EGM A;  3T9J A;  2WLA A;  3E1L A;  4DZ0 A;  4Z3B A;  1L8H A;  3JZ9 A;  1RYT A;  3KWO A;  4MY7 A;  4LYX A;  3MPS A;  4E6K A;  4PGI A;  3Q4R A;  3C21 A;  3E1P A;  2XJN A;  4CY9 A;  3R2K A;  2WLU A;  5D8Y A;  1JGC A;  1NF6 A;  3HL1 A;  5GN8 A;  3SH6 A;  3ISE A;  5GU1 X;  4YXM A;  3RE7 A;  4ZKH A;  5J8W A;  2V2O A;  4Z5S A;  2FKZ A;  4TOB A;  1OTK A;  3R2H A;  3E1N A;  2V2M A;  3HIU A;  4LQJ A;  2IB0 A;  1RCE A;  5J93 A;  1YV1 A;  5JKM A;  3FVB A;  3E1M A;  4CMY A;  5FFE A;  4CVP A;  2GYD A;  3H7G A;  4LPN A;  2ZG8 X;  1LKP A;  2OC5 A;  1DPS A;  2ZG7 X;  4AM4 A;  5J8S A;  2CIH A;  3OGH A;  3BVK A;  2V8U A;  3F38 A;  2G38 B;  2RBD A;  2QQY A;  5JKL A;  5CMQ A;  2CHI A;  3Q4O A;  3M6J A;  1TKP A;  2IY4 A;  4MXP A;  3LKD A;  5CMR A;  4ZL5 A;  4DI0 A;  4ZKW A;  3KX9 A;  2CHP A;  3AF9 X;  3BKN A;  4MN9 A;  2X17 0;  5FFC A;  1AEW A;  3Q4N A;  5LG8 A;  1QYB A;  5E2D A;  5IX6 A;  2Y3Q A;  2CLU A;  5ERJ A;  3NP2 X;  4RC7 A;  4LQN A;  1RCC A;  3GE4 A;  2F7N A;  4X0J A;  1TK6 A;  4ETR A;  5HJF A;  3R2L A;  1MFR A;  3AJO A;  1LB3 A;  3FI6 A;  4LYU A;  3UNO A;  1EUM A;  2JD8 0;  3PVY B;  1DVB A;  2V2N A;  3F33 A;  3QB9 A;  1RCI A;  3KA4 A;  2XJM A;  3PW1 A;  3F37 A;  4AM2 A;  5LS9 A;  1S30 A;  4MKU A;  4IWK A;  4RC6 B;  2CLB A;  2PYB A;  2Z5R A;  2CN7 A;  5JDO B;  1VEI A;  3ERZ A;  1HRS A;  4KVQ A;  2Z90 A;  2CEI A;  3E2C A;  3E1Q A;  1JYB A;  4PGK A;  4W4K B;  1IES A;  4RC5 B;  2OKC A;  3AJQ A;  1IER A;  4ZKX A;  3R2O A;  5GU0 X;  3F36 A;  4YXJ A;  5LG2 A;  3PVT B;  4U3G A;  3W54 A;  3PWQ C;  2D5K A;  1RCG A;  4LQV A;  1ZUJ A;  3C23 A;  1TJO A;  2Z5P A;  2OH3 A;  2YJJ A;  2C41 A;  5K52 A;  3QHB A;  3PWF A;  1DAT A;  1F33 A;  5CZU A;  4TOG A;  2C6R A;  1J30 A;  5HU6 D;  2FZF A;  3N6O A;  4II4 B;  3PVR B;  3KDQ A;  5D8Q A;  3PWQ A;  2WWX B;  3IQ1 A;  2FFX J;  4REU A;  4CYA A;  4E40 A;  4XGS A;  5I4J A;  5D8R A;  3VNX A;  3BVE A;  1F30 A;  2CN6 A;  3E6S A;  1B71 A;  1BFR A;  2N02 A;  3FSE A;  4TOC A;  3QVD A;  4OYN A;  4KVR A;  1VLG A;  3F34 A;  4ZTT A;  3QZ3 A;  4EVD A;  2QF9 A;  3E1O A;  1UVH A;  1XZ1 A;  4CVR A;  2YW6 A;  1MOJ A;  5C6F A;  3QHC A;  2AR0 A;  2V2J A;  4ERU A;  4R42 A;  4MJY A;  4ZJK A;  1VEQ A;  4EVE A;  4MUD A;  2ITB A;  1ZS3 A;  2MGY A;  3UOF A;  4ISP A;  4DE6 A;  4PG1 A;  2HR5 A;  4ITT A;  1XZ3 A;  1S3Q A;  2V2R A;  2Y44 A;  3PVY A;  2FG4 A;  3KXU A;  4M32 A;  3BVF A;  2BK6 A;  2ZA6 A;  4M35 A;  1YUX A;  2V2I A;  1JKU A;  4LQH A;  2V2P A;  4YVZ A;  4EVC A;  2V8T A;  3RGD A;  4CVS A;  2ZA8 A;  3R2R A;  1N1Q A;  4RC6 A;  3GHQ A;  3BT5 A;  4TOA A;  4M34 A;  5JDO A;  3PW8 C;  4TO9 A;  5D8O A;  2CF7 A;  3F39 A;  2XKQ A;  1H96 A;  3VV9 A;  3SE1 A;  5LBH A;  2CWL A;  3A9Q A;  3R2M A;  2VXX A;  3D19 A; 
#chains in the Genus database with same CATH homology
 3NP0 X;  2UX1 A;  2BJY A;  1SQ3 A;  3IS7 A;  1JI4 A;  4TOH A;  3AF7 X;  4DYX A;  1QGH A;  3AK9 A;  1SOF A;  1KRQ A;  3SID A;  2HTN A;  3F32 A;  3A68 A;  3KA8 A;  4IXK A;  3PW8 A;  3PVT A;  3RAV A;  4TW3 A;  3PW1 B;  3DBY A;  4AM5 A;  3FRR A;  3BVL A;  3U90 A;  3L0M A;  3UOI A;  4ITW A;  2VXI A;  3V3K B;  1BG7 A;  1L8I A;  2IU2 A;  1S2Z A;  2C2U A;  2W0O A;  1VJX A;  2JD6 0;  2FHA A;  4II4 A;  3PVR A;  4TOD A;  3SHX A;  3WVW A;  1VEL A;  4W4L B;  2G4H A;  3F35 A;  3KA9 A;  4EVB A;  1JIG A;  1LKO A;  2BW1 A;  3GGY A;  1Z6O A;  5K53 A;  4XKT A;  5HQO A;  4A25 A;  1JKV A;  3ISF A;  3E6R A;  1JI5 A;  2V2S A;  4M33 A;  3GGZ A;  4CVT A;  5JKM G;  4IWJ A;  3FRS A;  1Z6O M;  1RCD A;  1O9I A;  5GN8 B;  3IS8 A;  2VZB A;  5HJH A;  3O7S A;  2GS4 A;  4P18 A;  1TKO A;  1JRE A;  4ISM A;  2XJO A;  2BKC A;  3KA3 A;  3O7R A;  4DYZ A;  1JTS A;  1Z4A A;  5D8X A;  2JD7 0;  4QUW A;  4KVS A;  5FEJ A;  2C2F A;  3C1Z A;  3VVA A;  2C2J A;  3E1J A;  1GWG A;  5JKL G;  5FFB A;  3C1Y A;  2V2L A;  1NFV A;  3BVI A;  2YJK A;  5GOU A;  3GVY A;  3PZA A;  4YKH A;  4ZL6 A;  1R03 A;  3EZ0 A;  4DAS A;  3KA6 A;  3UFB A;  4KXR B;  3EZU A;  1FHA A;  3QD8 A;  1NF4 A;  4DYY A;  5GU3 X;  3R2S A;  2FL0 A;  4ML5 A;  1YUZ A;  2V15 A;  4Y08 A;  3AJP A;  5E1U A;  3TA8 A;  3OJ5 A;  4XKU A;  4ZMC A;  3RBC A;  3KHK A;  3ES3 A;  3WNW A;  5ERK A;  4TOF A;  2WTL A;  4CMY V;  1LKM A;  4PG0 A;  2FJC A;  2XGW A;  3WVV A;  2ZA7 A;  1BCF A;  3RD0 A;  1NNQ A;  2ZG9 X;  4RC7 B;  5AXS A;  4RC8 A;  2Z6M A;  3NOZ X;  5GU2 X;  3WVU A;  3JZA B;  4ZLW A;  4RC5 A;  3Q4Q A;  4LPJ A;  4CYB A;  5D8S A;  5JAC A;  2Z5Q A;  5J9V A;  2YW7 A;  5FFD A;  1O9R A;  4XKS A;  2GYQ A;  1UMN A;  5D8P A;  2FG8 A;  2ZUR X;  4LPM A;  4DYU A;  4WJG 4;  3AF8 X;  5FFA A;  3AK8 A;  4TOE A;  3EGM A;  3T9J A;  2WLA A;  3E1L A;  4DZ0 A;  4Z3B A;  1L8H A;  3JZ9 A;  1RYT A;  3KWO A;  4MY7 A;  4LYX A;  3MPS A;  4E6K A;  4PGI A;  3Q4R A;  3C21 A;  3E1P A;  2XJN A;  4CY9 A;  3R2K A;  2WLU A;  5D8Y A;  1JGC A;  1NF6 A;  3HL1 A;  5GN8 A;  3SH6 A;  3ISE A;  5GU1 X;  4YXM A;  3RE7 A;  4ZKH A;  5J8W A;  2V2O A;  4Z5S A;  2FKZ A;  4TOB A;  1OTK A;  3R2H A;  3E1N A;  2V2M A;  3HIU A;  4LQJ A;  2IB0 A;  1RCE A;  5J93 A;  1YV1 A;  5JKM A;  3FVB A;  3E1M A;  4CMY A;  5FFE A;  4CVP A;  2GYD A;  3H7G A;  4LPN A;  2ZG8 X;  1LKP A;  2OC5 A;  1DPS A;  2ZG7 X;  4AM4 A;  5J8S A;  2CIH A;  3OGH A;  3BVK A;  2V8U A;  3F38 A;  2G38 B;  2RBD A;  2QQY A;  5JKL A;  5CMQ A;  2CHI A;  3Q4O A;  3M6J A;  1TKP A;  2IY4 A;  4MXP A;  3LKD A;  5CMR A;  4ZL5 A;  4DI0 A;  4ZKW A;  3KX9 A;  2CHP A;  3AF9 X;  3BKN A;  4MN9 A;  2X17 0;  5FFC A;  1AEW A;  3Q4N A;  5LG8 A;  1QYB A;  5E2D A;  5IX6 A;  2Y3Q A;  2CLU A;  5ERJ A;  3NP2 X;  4RC7 A;  4LQN A;  1RCC A;  3GE4 A;  2F7N A;  4X0J A;  1TK6 A;  4ETR A;  5HJF A;  3R2L A;  1MFR A;  3AJO A;  1LB3 A;  3FI6 A;  4LYU A;  3UNO A;  1EUM A;  2JD8 0;  3PVY B;  1DVB A;  2V2N A;  3F33 A;  3QB9 A;  1RCI A;  3KA4 A;  2XJM A;  3PW1 A;  3F37 A;  4AM2 A;  5LS9 A;  1S30 A;  4MKU A;  4IWK A;  4RC6 B;  2CLB A;  2PYB A;  2Z5R A;  2CN7 A;  5JDO B;  1VEI A;  3ERZ A;  1HRS A;  4KVQ A;  2Z90 A;  2CEI A;  3E2C A;  3E1Q A;  1JYB A;  4PGK A;  4W4K B;  1IES A;  4RC5 B;  2OKC A;  3AJQ A;  1IER A;  4ZKX A;  3R2O A;  5GU0 X;  3F36 A;  4YXJ A;  5LG2 A;  3PVT B;  4U3G A;  3W54 A;  3PWQ C;  2D5K A;  1RCG A;  4LQV A;  1ZUJ A;  3C23 A;  1TJO A;  2Z5P A;  2OH3 A;  2YJJ A;  2C41 A;  5K52 A;  3QHB A;  3PWF A;  1DAT A;  1F33 A;  5CZU A;  4TOG A;  2C6R A;  1J30 A;  5HU6 D;  2FZF A;  3N6O A;  4II4 B;  3PVR B;  3KDQ A;  5D8Q A;  3PWQ A;  2WWX B;  3IQ1 A;  2FFX J;  4REU A;  4CYA A;  4E40 A;  4XGS A;  5I4J A;  5D8R A;  3VNX A;  3BVE A;  1F30 A;  2CN6 A;  3E6S A;  1B71 A;  1BFR A;  2N02 A;  3FSE A;  4TOC A;  3QVD A;  4OYN A;  4KVR A;  1VLG A;  3F34 A;  4ZTT A;  3QZ3 A;  4EVD A;  2QF9 A;  3E1O A;  1UVH A;  1XZ1 A;  4CVR A;  2YW6 A;  1MOJ A;  5C6F A;  3QHC A;  2AR0 A;  2V2J A;  4ERU A;  4R42 A;  4MJY A;  4ZJK A;  1VEQ A;  4EVE A;  4MUD A;  2ITB A;  1ZS3 A;  2MGY A;  3UOF A;  4ISP A;  4DE6 A;  4PG1 A;  2HR5 A;  4ITT A;  1XZ3 A;  1S3Q A;  2V2R A;  2Y44 A;  3PVY A;  2FG4 A;  3KXU A;  4M32 A;  3BVF A;  2BK6 A;  2ZA6 A;  4M35 A;  1YUX A;  2V2I A;  1JKU A;  4LQH A;  2V2P A;  4YVZ A;  4EVC A;  2V8T A;  3RGD A;  4CVS A;  2ZA8 A;  3R2R A;  1N1Q A;  4RC6 A;  3GHQ A;  3BT5 A;  4TOA A;  4M34 A;  5JDO A;  3PW8 C;  4TO9 A;  5D8O A;  2CF7 A;  3F39 A;  2XKQ A;  1H96 A;  3VV9 A;  3SE1 A;  5LBH A;  2CWL A;  3A9Q A;  3R2M A;  2VXX A;  3D19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...