1NF6A

X-ray structure of the desulfovibrio desulfuricans bacterioferritin: the diiron site in different catalytic states ("cycled" structure: reduced in solution and allowed to reoxidise before crystallisation)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
170
structure length
170
Chain Sequence
b'GNREDRKAKVIEVLNKARAMELHAIHQYMNQHYSLDDMDYGELAANMKLIAIDEMRHAENFAERIKELGGEPTTQKEGKVVTGQAVPVIYESDADQEDATIEAYSQFLKVCKEQGDIVTARLFERIIEEEQAHLTYYENIGSHIKNLGDTYLAKIAGTPSSTGTASKGFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords bacterioferritin
publication title The nature of the di-iron site in the bacterioferritin from Desulfovibrio desulfuricans
pubmed doi rcsb
molecule tags Iron storage/electron transport
total genus 77
structure length 170
sequence length 170
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2002-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1nf6A00
3GVYA 1NF6A 4LPNA 2GYQA 4Z3BA 4ZKHA 4AM2A 5E1UA 1TK6A 1H96A 5FFDA 3IQ1A 4RC5A 4REUA 2Z90A 3WVVA 2XJMA 1J30A 1LKOA 3GHQA 1DVBA 4TOGA 4RC5B 3FSEA 2FG4A 1UVHA 1ZS3A 3OGHA 4PG0A 4DYXA 2JD80 3F37A 5FFEA 1Z4AA 1TJOA 4Z5SA 4MUDA 5JKLA 2RBDA 3RD0A 4ZLWA 2Y3QA 1S2ZA 3RE7A 2UX1A 4M33A 3O7SA 1HRSA 4ML5A 3UNOA 5J8WA 1SOFA 5E2DA 4OYNA 1EUMA 3OJ5A 3ES3A 5FFCA 2FKZA 1JKUA 2ZA6A 5CMQA 3AF7X 2IB0A 3A68A 4TOFA 3E1MA 4LPMA 1BCFA 4A25A 5LS9A 4XGSA 1BFRA 1VEQA 4PGKA 2YJJA 3PW1B 4RC7A 3R2MA 5LG8A 3KA9A 4LQHA 3QHBA 1ZUJA 4LQVA 3PVTB 2JD60 5D8QA 4KVSA 2FJCA 2GS4A 1TKOA 1IESA 3R2OA 3KA8A 2V2PA 4CY9A 2QF9A 1LKPA 2IY4A 4RC8A 3BVFA 4DI0A 5CMRA 2YW6A 5GU0X 1Z6OM 3E1LA 3F35A 4IWJA 1L8HA 2HTNA 3UOFA 3IS7A 2FFXJ 4R42A 3SH6A 2V2NA 5D8XA 3PW8C 2QQYA 1S30A 3EZUA 3SHXA 4AM4A 2XGWA 3PW8A 1B71A 3AJPA 2C6RA 5D8OA 3QD8A 4XKSA 3AF9X 1TKPA 2BJYA 2BK6A 4CMYV 5HQOA 5J9VA 4ZKXA 3BVEA 3PWFA 2Z6MA 1LB3A 3FVBA 1RYTA 5GU1X 3AK9A 5GU3X 4II4B 2OH3A 3TA8A 2CN7A 1JI4A 3E6SA 2ZURX 2C2JA 2Z5RA 5D8YA 3WNWA 3KWOA 2F7NA 1Z6OA 3MPSA 3RBCA 2V15A 1RCDA 3E6RA 4Y08A 3R2LA 2PYBA 2Z5PA 4CVSA 4M32A 3AF8X 1JYBA 2V2IA 2FL0A 3KA6A 3ISFA 5JACA 1RCIA 3RAVA 4CYBA 4ISPA 3PWQC 4CVTA 5HJHA 3F34A 1RCEA 1NF4A 4M35A 4LQNA 4LYXA 4EVCA 3PWQA 1L8IA 2XKQA 4U3GA 3FI6A 5GOUA 5K53A 5I4JA 2W0OA 2VZBA 3BKNA 1FHAA 3E1PA 1KRQA 3QZ3A 3PW1A 1NNQA 1YV1A 3HIUA 4ETRA 3PVTA 5J8SA 5D8RA 3GE4A 4KVQA 3Q4RA 1MOJA 1LKMA 2X170 1IERA 2OC5A 4PG1A 3PZAA 1RCCA 3KA3A 4P18A 3SE1A 4DYZA 4DZ0A 1RCGA 3A9QA 3EGMA 4XKTA 4LQJA 4IXKA 1N1QA 4LPJA 2ZA7A 2C41A 4YKHA 4TOCA 2VXIA 5ERKA 2V2OA 2ZA8A 3KXUA 2G4HA 2CHPA 2XJNA 1QYBA 2BKCA 1DATA 4TOHA 1S3QA 5FFBA 2C2FA 3Q4OA 2FG8A 4DYUA 2CHIA 3U90A 4ISMA 1XZ3A 1GWGA 1O9RA 4TO9A 1JTSA 3RGDA 4QUWA 2CLUA 4DE6A 2YW7A 3E1NA 2CEIA 4IWKA 3F36A 1SQ3A 2GYDA 4II4A 2ZG9X 3Q4NA 4EVBA 1O9IA 4CVPA 4AM5A 2CIHA 5FFAA 2ITBA 2FZFA 3BVLA 4MN9A 5GN8A 3F32A 4CYAA 3O7RA 2HR5A 1F30A 3KA4A 2V2LA 3R2SA 1MFRA 5GN8B 3R2KA 4PGIA 5CZUA 1YUZA 4XKUA 3R2RA 1OTKA 2WLAA 1VJXA 4LYUA 2V2SA 3R2HA 5D8SA 3E1JA 1BG7A 2V2JA 3WVUA 3AJQA 1JREA 4TODA 3BT5A 5ERJA 3WVWA 2Z5QA 3E2CA 2YJKA 4ZL6A 1VLGA 4ZTTA 2V2RA 4DASA 3ISEA 3HL1A 4TOBA 4EVDA 3T9JA 2ZG8X 1DPSA 4ZL5A 4MJYA 1F33A 4TOEA 4KVRA 3VNXA 3Q4QA 1VELA 4ITTA 4DYYA 3AJOA 4MKUA 3UOIA 5J93A 3QHCA 1JI5A 2ZG7X 5HJFA 2XJOA 2CF7A 3BVIA 1R03A 5GU2X 3E1QA 3NOZX 4CMYA 5JKMG 5C6FA 3F38A 3NP2X 5IX6A 3E1OA 1XZ1A 4RC7B 3PVRA 3H7GA 3ERZA 4ZMCA 2CLBA 4CVRA 2FHAA 3PVRB 2C2UA 3F39A 3QVDA 4M34A 1VEIA 3KX9A 3PVYA 2D5KA 4E6KA 1QGHA 4TW3A 2WTLA 4TOAA 3NP0X 1JKVA 1AEWA 3PVYB 2WLUA 5JKLG 4EVEA 5FEJA 5LG2A 1JIGA 3SIDA 5D8PA 2BW1A 3QB9A 5LBHA 2V2MA 4RC6A 3AK8A 1NFVA 5K52A 5AXSA 2JD70 1JGCA 1YUXA 2IU2A 4ITWA 4RC6B 1UMNA 3EZ0A 3BVKA 4ZJKA 4ZKWA 4ERUA 4MY7A 3IS8A 5JKMA 3F33A 2CN6A 2VXXA
chains in the Genus database with same CATH superfamily
3GVYA 1NF6A 4LPNA 2GYQA 4Z3BA 4ZKHA 4AM2A 5E1UA 1TK6A 1H96A 5FFDA 3IQ1A 4RC5A 4REUA 2Z90A 3WVVA 2XJMA 1J30A 1LKOA 3GHQA 1DVBA 4TOGA 4RC5B 3FSEA 2FG4A 1UVHA 1ZS3A 3OGHA 4PG0A 4DYXA 2JD80 3F37A 5FFEA 1Z4AA 3W54A 1TJOA 3JZ9A 4Z5SA 4MUDA 5JKLA 2RBDA 3RD0A 4ZLWA 2Y3QA 1S2ZA 3RE7A 2UX1A 4M33A 3O7SA 1HRSA 4E40A 4ML5A 3UNOA 5J8WA 1SOFA 5E2DA 4OYNA 1EUMA 3OJ5A 3ES3A 5FFCA 2FKZA 1JKUA 2ZA6A 5CMQA 3AF7X 2IB0A 3A68A 4TOFA 3E1MA 4LPMA 1BCFA 4A25A 5LS9A 4XGSA 1BFRA 1VEQA 4PGKA 2YJJA 4W4LB 3PW1B 3C23A 4RC7A 3R2MA 5LG8A 3KA9A 4LQHA 3QHBA 1ZUJA 3GGYA 4LQVA 3PVTB 2JD60 2G38B 5D8QA 4KVSA 2FJCA 2GS4A 1TKOA 1IESA 3R2OA 3KA8A 2V2PA 4CY9A 2QF9A 1LKPA 2IY4A 4RC8A 3BVFA 4DI0A 5CMRA 2YW6A 5GU0X 1Z6OM 3E1LA 3F35A 4IWJA 1L8HA 2HTNA 3UOFA 3IS7A 2FFXJ 4R42A 3SH6A 2V2NA 5D8XA 3PW8C 2QQYA 1S30A 3EZUA 3SHXA 4AM4A 2XGWA 3PW8A 1B71A 3AJPA 2C6RA 5D8OA 5JDOA 3QD8A 4XKSA 3AF9X 1TKPA 2BJYA 5JDOB 2BK6A 4CMYV 5HQOA 5J9VA 4ZKXA 3BVEA 3PWFA 2Z6MA 1LB3A 3FVBA 1RYTA 5GU1X 3AK9A 5GU3X 4II4B 2OH3A 3TA8A 2CN7A 1JI4A 3E6SA 4W4KB 2ZURX 2C2JA 2Z5RA 5D8YA 3UFBA 3WNWA 3KWOA 2F7NA 3KDQA 1Z6OA 4YXJA 3MPSA 3RBCA 2V15A 1RCDA 3E6RA 4Y08A 3R2LA 2PYBA 2Z5PA 4CVSA 4M32A 3AF8X 1JYBA 2V2IA 2FL0A 3KA6A 3ISFA 5JACA 1RCIA 3RAVA 4CYBA 4ISPA 3PWQC 4CVTA 5HJHA 3F34A 1RCEA 1NF4A 4M35A 4LQNA 4LYXA 4EVCA 3PWQA 1L8IA 2XKQA 4U3GA 3FI6A 4YXMA 3LKDA 5GOUA 5K53A 5I4JA 2W0OA 2VZBA 3BKNA 1FHAA 3E1PA 1KRQA 3QZ3A 2MGYA 3PW1A 1NNQA 1YV1A 3GGZA 3M6JA 3HIUA 4ETRA 3PVTA 5J8SA 5D8RA 3GE4A 4KVQA 3Q4RA 1MOJA 1LKMA 2X170 1IERA 2OC5A 4PG1A 3PZAA 4WJG4 1RCCA 3KA3A 3DBYA 4P18A 3SE1A 4DYZA 2N02A 4DZ0A 1RCGA 3A9QA 3EGMA 4XKTA 4LQJA 4IXKA 1N1QA 4LPJA 2ZA7A 2C41A 4YKHA 4TOCA 2VXIA 5ERKA 2V2OA 2ZA8A 3KXUA 2G4HA 2CHPA 2XJNA 1QYBA 2BKCA 1DATA 4TOHA 1S3QA 5FFBA 2C2FA 3Q4OA 2FG8A 4DYUA 2CHIA 3U90A 2WWXB 4MXPA 4ISMA 1XZ3A 1GWGA 1O9RA 4TO9A 1JTSA 3RGDA 4QUWA 2CLUA 4DE6A 2YW7A 3E1NA 2CEIA 4IWKA 3F36A 1SQ3A 2GYDA 4II4A 2ZG9X 3Q4NA 4EVBA 1O9IA 4CVPA 4AM5A 2CIHA 3L0MA 5FFAA 2ITBA 2FZFA 3BVLA 4MN9A 5GN8A 3F32A 3N6OA 4CYAA 3O7RA 2HR5A 1F30A 3KA4A 2V2LA 3R2SA 1MFRA 5GN8B 3R2KA 4PGIA 5CZUA 1YUZA 4XKUA 3R2RA 1OTKA 3FRRA 2WLAA 1VJXA 4LYUA 3D19A 2V2SA 3R2HA 3VVAA 5D8SA 2OKCA 3E1JA 1BG7A 3FRSA 2V2JA 3WVUA 3AJQA 1JREA 4TODA 3BT5A 5ERJA 3WVWA 3C21A 2Z5QA 3E2CA 2YJKA 4ZL6A 1VLGA 2Y44A 4ZTTA 2V2RA 4DASA 3ISEA 3HL1A 4TOBA 4EVDA 5HU6D 3T9JA 2ZG8X 1DPSA 4ZL5A 4MJYA 1F33A 4TOEA 4KVRA 3VNXA 3Q4QA 1VELA 4ITTA 4DYYA 4KXRB 3JZAB 3AJOA 4MKUA 3UOIA 2AR0A 5J93A 2CWLA 3QHCA 1JI5A 2ZG7X 5HJFA 2XJOA 2CF7A 3KHKA 3BVIA 1R03A 5GU2X 4YVZA 3E1QA 3NOZX 4CMYA 5JKMG 5C6FA 3F38A 3NP2X 5IX6A 3E1OA 4X0JA 1XZ1A 4RC7B 3PVRA 3H7GA 3ERZA 4ZMCA 2CLBA 4CVRA 2FHAA 3PVRB 2C2UA 3F39A 3QVDA 2V8UA 4M34A 1VEIA 3C1YA 3KX9A 3PVYA 2D5KA 4E6KA 1QGHA 4TW3A 2WTLA 4TOAA 3NP0X 1JKVA 3VV9A 1AEWA 3PVYB 2WLUA 5JKLG 4EVEA 5FEJA 5LG2A 1JIGA 3SIDA 5D8PA 2BW1A 3C1ZA 3QB9A 5LBHA 2V2MA 4RC6A 3V3KB 3AK8A 1NFVA 5K52A 5AXSA 2JD70 1JGCA 1YUXA 2IU2A 4ITWA 4RC6B 1UMNA 3EZ0A 3BVKA 4ZJKA 4ZKWA 4ERUA 4MY7A 2V8TA 3IS8A 5JKMA 3F33A 2CN6A 2VXXA
chains in the Genus database with same CATH topology
3GVYA 1NF6A 4LPNA 2GYQA 4Z3BA 4ZKHA 4AM2A 5E1UA 1TK6A 1H96A 5FFDA 3IQ1A 4RC5A 4REUA 2Z90A 3WVVA 2XJMA 1J30A 1LKOA 3GHQA 1DVBA 4TOGA 4RC5B 3FSEA 2FG4A 1UVHA 1ZS3A 3OGHA 4PG0A 4DYXA 2JD80 3F37A 5FFEA 1Z4AA 3W54A 1TJOA 3JZ9A 4Z5SA 4MUDA 5JKLA 2RBDA 3RD0A 4ZLWA 2Y3QA 1S2ZA 3RE7A 2UX1A 4M33A 3O7SA 1HRSA 4E40A 4ML5A 3UNOA 5J8WA 1SOFA 5E2DA 4OYNA 1EUMA 3OJ5A 3ES3A 5FFCA 2FKZA 1JKUA 2ZA6A 5CMQA 3AF7X 2IB0A 3A68A 4TOFA 3E1MA 4LPMA 1BCFA 4A25A 5LS9A 4XGSA 1BFRA 1VEQA 4PGKA 2YJJA 4W4LB 3PW1B 3C23A 4RC7A 3R2MA 5LG8A 3KA9A 4LQHA 3QHBA 1ZUJA 3GGYA 4LQVA 3PVTB 2JD60 2G38B 5D8QA 4KVSA 2FJCA 2GS4A 1TKOA 1IESA 3R2OA 3KA8A 2V2PA 4CY9A 2QF9A 1LKPA 2IY4A 4RC8A 3BVFA 4DI0A 5CMRA 2YW6A 5GU0X 1Z6OM 3E1LA 3F35A 4IWJA 1L8HA 2HTNA 3UOFA 3IS7A 2FFXJ 4R42A 3SH6A 2V2NA 5D8XA 3PW8C 2QQYA 1S30A 3EZUA 3SHXA 4AM4A 2XGWA 3PW8A 1B71A 3AJPA 2C6RA 5D8OA 5JDOA 3QD8A 4XKSA 3AF9X 1TKPA 2BJYA 5JDOB 2BK6A 4CMYV 5HQOA 5J9VA 4ZKXA 3BVEA 3PWFA 2Z6MA 1LB3A 3FVBA 1RYTA 5GU1X 3AK9A 5GU3X 4II4B 2OH3A 3TA8A 2CN7A 1JI4A 3E6SA 4W4KB 2ZURX 2C2JA 2Z5RA 5D8YA 3UFBA 3WNWA 3KWOA 2F7NA 3KDQA 1Z6OA 4YXJA 3MPSA 3RBCA 2V15A 1RCDA 3E6RA 4Y08A 3R2LA 2PYBA 2Z5PA 4CVSA 4M32A 3AF8X 1JYBA 2V2IA 2FL0A 3KA6A 3ISFA 5JACA 1RCIA 3RAVA 4CYBA 4ISPA 3PWQC 4CVTA 5HJHA 3F34A 1RCEA 1NF4A 4M35A 4LQNA 4LYXA 4EVCA 3PWQA 1L8IA 2XKQA 4U3GA 3FI6A 4YXMA 3LKDA 5GOUA 5K53A 5I4JA 2W0OA 2VZBA 3BKNA 1FHAA 3E1PA 1KRQA 3QZ3A 2MGYA 3PW1A 1NNQA 1YV1A 3GGZA 3M6JA 3HIUA 4ETRA 3PVTA 5J8SA 5D8RA 3GE4A 4KVQA 3Q4RA 1MOJA 1LKMA 2X170 1IERA 2OC5A 4PG1A 3PZAA 4WJG4 1RCCA 3KA3A 3DBYA 4P18A 3SE1A 4DYZA 2N02A 4DZ0A 1RCGA 3A9QA 3EGMA 4XKTA 4LQJA 4IXKA 1N1QA 4LPJA 2ZA7A 2C41A 4YKHA 4TOCA 2VXIA 5ERKA 2V2OA 2ZA8A 3KXUA 2G4HA 2CHPA 2XJNA 1QYBA 2BKCA 1DATA 4TOHA 1S3QA 5FFBA 2C2FA 3Q4OA 2FG8A 4DYUA 2CHIA 3U90A 2WWXB 4MXPA 4ISMA 1XZ3A 1GWGA 1O9RA 4TO9A 1JTSA 3RGDA 4QUWA 2CLUA 4DE6A 2YW7A 3E1NA 2CEIA 4IWKA 3F36A 1SQ3A 2GYDA 4II4A 2ZG9X 3Q4NA 4EVBA 1O9IA 4CVPA 4AM5A 2CIHA 3L0MA 5FFAA 2ITBA 2FZFA 3BVLA 4MN9A 5GN8A 3F32A 3N6OA 4CYAA 3O7RA 2HR5A 1F30A 3KA4A 2V2LA 3R2SA 1MFRA 5GN8B 3R2KA 4PGIA 5CZUA 1YUZA 4XKUA 3R2RA 1OTKA 3FRRA 2WLAA 1VJXA 4LYUA 3D19A 2V2SA 3R2HA 3VVAA 5D8SA 2OKCA 3E1JA 1BG7A 3FRSA 2V2JA 3WVUA 3AJQA 1JREA 4TODA 3BT5A 5ERJA 3WVWA 3C21A 2Z5QA 3E2CA 2YJKA 4ZL6A 1VLGA 2Y44A 4ZTTA 2V2RA 4DASA 3ISEA 3HL1A 4TOBA 4EVDA 5HU6D 3T9JA 2ZG8X 1DPSA 4ZL5A 4MJYA 1F33A 4TOEA 4KVRA 3VNXA 3Q4QA 1VELA 4ITTA 4DYYA 4KXRB 3JZAB 3AJOA 4MKUA 3UOIA 2AR0A 5J93A 2CWLA 3QHCA 1JI5A 2ZG7X 5HJFA 2XJOA 2CF7A 3KHKA 3BVIA 1R03A 5GU2X 4YVZA 3E1QA 3NOZX 4CMYA 5JKMG 5C6FA 3F38A 3NP2X 5IX6A 3E1OA 4X0JA 1XZ1A 4RC7B 3PVRA 3H7GA 3ERZA 4ZMCA 2CLBA 4CVRA 2FHAA 3PVRB 2C2UA 3F39A 3QVDA 2V8UA 4M34A 1VEIA 3C1YA 3KX9A 3PVYA 2D5KA 4E6KA 1QGHA 4TW3A 2WTLA 4TOAA 3NP0X 1JKVA 3VV9A 1AEWA 3PVYB 2WLUA 5JKLG 4EVEA 5FEJA 5LG2A 1JIGA 3SIDA 5D8PA 2BW1A 3C1ZA 3QB9A 5LBHA 2V2MA 4RC6A 3V3KB 3AK8A 1NFVA 5K52A 5AXSA 2JD70 1JGCA 1YUXA 2IU2A 4ITWA 4RC6B 1UMNA 3EZ0A 3BVKA 4ZJKA 4ZKWA 4ERUA 4MY7A 2V8TA 3IS8A 5JKMA 3F33A 2CN6A 2VXXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GVY A;  1NF6 A;  4LPN A;  2GYQ A;  4Z3B A;  4ZKH A;  4AM2 A;  5E1U A;  1TK6 A;  1H96 A;  5FFD A;  3IQ1 A;  4RC5 A;  4REU A;  2Z90 A;  3WVV A;  2XJM A;  1J30 A;  1LKO A;  3GHQ A;  1DVB A;  4TOG A;  4RC5 B;  3FSE A;  2FG4 A;  1UVH A;  1ZS3 A;  3OGH A;  4PG0 A;  4DYX A;  2JD8 0;  3F37 A;  5FFE A;  1Z4A A;  1TJO A;  4Z5S A;  4MUD A;  5JKL A;  2RBD A;  3RD0 A;  4ZLW A;  2Y3Q A;  1S2Z A;  3RE7 A;  2UX1 A;  4M33 A;  3O7S A;  1HRS A;  4ML5 A;  3UNO A;  5J8W A;  1SOF A;  5E2D A;  4OYN A;  1EUM A;  3OJ5 A;  3ES3 A;  5FFC A;  2FKZ A;  1JKU A;  2ZA6 A;  5CMQ A;  3AF7 X;  2IB0 A;  3A68 A;  4TOF A;  3E1M A;  4LPM A;  1BCF A;  4A25 A;  5LS9 A;  4XGS A;  1BFR A;  1VEQ A;  4PGK A;  2YJJ A;  3PW1 B;  4RC7 A;  3R2M A;  5LG8 A;  3KA9 A;  4LQH A;  3QHB A;  1ZUJ A;  4LQV A;  3PVT B;  2JD6 0;  5D8Q A;  4KVS A;  2FJC A;  2GS4 A;  1TKO A;  1IES A;  3R2O A;  3KA8 A;  2V2P A;  4CY9 A;  2QF9 A;  1LKP A;  2IY4 A;  4RC8 A;  3BVF A;  4DI0 A;  5CMR A;  2YW6 A;  5GU0 X;  1Z6O M;  3E1L A;  3F35 A;  4IWJ A;  1L8H A;  2HTN A;  3UOF A;  3IS7 A;  2FFX J;  4R42 A;  3SH6 A;  2V2N A;  5D8X A;  3PW8 C;  2QQY A;  1S30 A;  3EZU A;  3SHX A;  4AM4 A;  2XGW A;  3PW8 A;  1B71 A;  3AJP A;  2C6R A;  5D8O A;  3QD8 A;  4XKS A;  3AF9 X;  1TKP A;  2BJY A;  2BK6 A;  4CMY V;  5HQO A;  5J9V A;  4ZKX A;  3BVE A;  3PWF A;  2Z6M A;  1LB3 A;  3FVB A;  1RYT A;  5GU1 X;  3AK9 A;  5GU3 X;  4II4 B;  2OH3 A;  3TA8 A;  2CN7 A;  1JI4 A;  3E6S A;  2ZUR X;  2C2J A;  2Z5R A;  5D8Y A;  3WNW A;  3KWO A;  2F7N A;  1Z6O A;  3MPS A;  3RBC A;  2V15 A;  1RCD A;  3E6R A;  4Y08 A;  3R2L A;  2PYB A;  2Z5P A;  4CVS A;  4M32 A;  3AF8 X;  1JYB A;  2V2I A;  2FL0 A;  3KA6 A;  3ISF A;  5JAC A;  1RCI A;  3RAV A;  4CYB A;  4ISP A;  3PWQ C;  4CVT A;  5HJH A;  3F34 A;  1RCE A;  1NF4 A;  4M35 A;  4LQN A;  4LYX A;  4EVC A;  3PWQ A;  1L8I A;  2XKQ A;  4U3G A;  3FI6 A;  5GOU A;  5K53 A;  5I4J A;  2W0O A;  2VZB A;  3BKN A;  1FHA A;  3E1P A;  1KRQ A;  3QZ3 A;  3PW1 A;  1NNQ A;  1YV1 A;  3HIU A;  4ETR A;  3PVT A;  5J8S A;  5D8R A;  3GE4 A;  4KVQ A;  3Q4R A;  1MOJ A;  1LKM A;  2X17 0;  1IER A;  2OC5 A;  4PG1 A;  3PZA A;  1RCC A;  3KA3 A;  4P18 A;  3SE1 A;  4DYZ A;  4DZ0 A;  1RCG A;  3A9Q A;  3EGM A;  4XKT A;  4LQJ A;  4IXK A;  1N1Q A;  4LPJ A;  2ZA7 A;  2C41 A;  4YKH A;  4TOC A;  2VXI A;  5ERK A;  2V2O A;  2ZA8 A;  3KXU A;  2G4H A;  2CHP A;  2XJN A;  1QYB A;  2BKC A;  1DAT A;  4TOH A;  1S3Q A;  5FFB A;  2C2F A;  3Q4O A;  2FG8 A;  4DYU A;  2CHI A;  3U90 A;  4ISM A;  1XZ3 A;  1GWG A;  1O9R A;  4TO9 A;  1JTS A;  3RGD A;  4QUW A;  2CLU A;  4DE6 A;  2YW7 A;  3E1N A;  2CEI A;  4IWK A;  3F36 A;  1SQ3 A;  2GYD A;  4II4 A;  2ZG9 X;  3Q4N A;  4EVB A;  1O9I A;  4CVP A;  4AM5 A;  2CIH A;  5FFA A;  2ITB A;  2FZF A;  3BVL A;  4MN9 A;  5GN8 A;  3F32 A;  4CYA A;  3O7R A;  2HR5 A;  1F30 A;  3KA4 A;  2V2L A;  3R2S A;  1MFR A;  5GN8 B;  3R2K A;  4PGI A;  5CZU A;  1YUZ A;  4XKU A;  3R2R A;  1OTK A;  2WLA A;  1VJX A;  4LYU A;  2V2S A;  3R2H A;  5D8S A;  3E1J A;  1BG7 A;  2V2J A;  3WVU A;  3AJQ A;  1JRE A;  4TOD A;  3BT5 A;  5ERJ A;  3WVW A;  2Z5Q A;  3E2C A;  2YJK A;  4ZL6 A;  1VLG A;  4ZTT A;  2V2R A;  4DAS A;  3ISE A;  3HL1 A;  4TOB A;  4EVD A;  3T9J A;  2ZG8 X;  1DPS A;  4ZL5 A;  4MJY A;  1F33 A;  4TOE A;  4KVR A;  3VNX A;  3Q4Q A;  1VEL A;  4ITT A;  4DYY A;  3AJO A;  4MKU A;  3UOI A;  5J93 A;  3QHC A;  1JI5 A;  2ZG7 X;  5HJF A;  2XJO A;  2CF7 A;  3BVI A;  1R03 A;  5GU2 X;  3E1Q A;  3NOZ X;  4CMY A;  5JKM G;  5C6F A;  3F38 A;  3NP2 X;  5IX6 A;  3E1O A;  1XZ1 A;  4RC7 B;  3PVR A;  3H7G A;  3ERZ A;  4ZMC A;  2CLB A;  4CVR A;  2FHA A;  3PVR B;  2C2U A;  3F39 A;  3QVD A;  4M34 A;  1VEI A;  3KX9 A;  3PVY A;  2D5K A;  4E6K A;  1QGH A;  4TW3 A;  2WTL A;  4TOA A;  3NP0 X;  1JKV A;  1AEW A;  3PVY B;  2WLU A;  5JKL G;  4EVE A;  5FEJ A;  5LG2 A;  1JIG A;  3SID A;  5D8P A;  2BW1 A;  3QB9 A;  5LBH A;  2V2M A;  4RC6 A;  3AK8 A;  1NFV A;  5K52 A;  5AXS A;  2JD7 0;  1JGC A;  1YUX A;  2IU2 A;  4ITW A;  4RC6 B;  1UMN A;  3EZ0 A;  3BVK A;  4ZJK A;  4ZKW A;  4ERU A;  4MY7 A;  3IS8 A;  5JKM A;  3F33 A;  2CN6 A;  2VXX A; 
#chains in the Genus database with same CATH topology
 3GVY A;  1NF6 A;  4LPN A;  2GYQ A;  4Z3B A;  4ZKH A;  4AM2 A;  5E1U A;  1TK6 A;  1H96 A;  5FFD A;  3IQ1 A;  4RC5 A;  4REU A;  2Z90 A;  3WVV A;  2XJM A;  1J30 A;  1LKO A;  3GHQ A;  1DVB A;  4TOG A;  4RC5 B;  3FSE A;  2FG4 A;  1UVH A;  1ZS3 A;  3OGH A;  4PG0 A;  4DYX A;  2JD8 0;  3F37 A;  5FFE A;  1Z4A A;  3W54 A;  1TJO A;  3JZ9 A;  4Z5S A;  4MUD A;  5JKL A;  2RBD A;  3RD0 A;  4ZLW A;  2Y3Q A;  1S2Z A;  3RE7 A;  2UX1 A;  4M33 A;  3O7S A;  1HRS A;  4E40 A;  4ML5 A;  3UNO A;  5J8W A;  1SOF A;  5E2D A;  4OYN A;  1EUM A;  3OJ5 A;  3ES3 A;  5FFC A;  2FKZ A;  1JKU A;  2ZA6 A;  5CMQ A;  3AF7 X;  2IB0 A;  3A68 A;  4TOF A;  3E1M A;  4LPM A;  1BCF A;  4A25 A;  5LS9 A;  4XGS A;  1BFR A;  1VEQ A;  4PGK A;  2YJJ A;  4W4L B;  3PW1 B;  3C23 A;  4RC7 A;  3R2M A;  5LG8 A;  3KA9 A;  4LQH A;  3QHB A;  1ZUJ A;  3GGY A;  4LQV A;  3PVT B;  2JD6 0;  2G38 B;  5D8Q A;  4KVS A;  2FJC A;  2GS4 A;  1TKO A;  1IES A;  3R2O A;  3KA8 A;  2V2P A;  4CY9 A;  2QF9 A;  1LKP A;  2IY4 A;  4RC8 A;  3BVF A;  4DI0 A;  5CMR A;  2YW6 A;  5GU0 X;  1Z6O M;  3E1L A;  3F35 A;  4IWJ A;  1L8H A;  2HTN A;  3UOF A;  3IS7 A;  2FFX J;  4R42 A;  3SH6 A;  2V2N A;  5D8X A;  3PW8 C;  2QQY A;  1S30 A;  3EZU A;  3SHX A;  4AM4 A;  2XGW A;  3PW8 A;  1B71 A;  3AJP A;  2C6R A;  5D8O A;  5JDO A;  3QD8 A;  4XKS A;  3AF9 X;  1TKP A;  2BJY A;  5JDO B;  2BK6 A;  4CMY V;  5HQO A;  5J9V A;  4ZKX A;  3BVE A;  3PWF A;  2Z6M A;  1LB3 A;  3FVB A;  1RYT A;  5GU1 X;  3AK9 A;  5GU3 X;  4II4 B;  2OH3 A;  3TA8 A;  2CN7 A;  1JI4 A;  3E6S A;  4W4K B;  2ZUR X;  2C2J A;  2Z5R A;  5D8Y A;  3UFB A;  3WNW A;  3KWO A;  2F7N A;  3KDQ A;  1Z6O A;  4YXJ A;  3MPS A;  3RBC A;  2V15 A;  1RCD A;  3E6R A;  4Y08 A;  3R2L A;  2PYB A;  2Z5P A;  4CVS A;  4M32 A;  3AF8 X;  1JYB A;  2V2I A;  2FL0 A;  3KA6 A;  3ISF A;  5JAC A;  1RCI A;  3RAV A;  4CYB A;  4ISP A;  3PWQ C;  4CVT A;  5HJH A;  3F34 A;  1RCE A;  1NF4 A;  4M35 A;  4LQN A;  4LYX A;  4EVC A;  3PWQ A;  1L8I A;  2XKQ A;  4U3G A;  3FI6 A;  4YXM A;  3LKD A;  5GOU A;  5K53 A;  5I4J A;  2W0O A;  2VZB A;  3BKN A;  1FHA A;  3E1P A;  1KRQ A;  3QZ3 A;  2MGY A;  3PW1 A;  1NNQ A;  1YV1 A;  3GGZ A;  3M6J A;  3HIU A;  4ETR A;  3PVT A;  5J8S A;  5D8R A;  3GE4 A;  4KVQ A;  3Q4R A;  1MOJ A;  1LKM A;  2X17 0;  1IER A;  2OC5 A;  4PG1 A;  3PZA A;  4WJG 4;  1RCC A;  3KA3 A;  3DBY A;  4P18 A;  3SE1 A;  4DYZ A;  2N02 A;  4DZ0 A;  1RCG A;  3A9Q A;  3EGM A;  4XKT A;  4LQJ A;  4IXK A;  1N1Q A;  4LPJ A;  2ZA7 A;  2C41 A;  4YKH A;  4TOC A;  2VXI A;  5ERK A;  2V2O A;  2ZA8 A;  3KXU A;  2G4H A;  2CHP A;  2XJN A;  1QYB A;  2BKC A;  1DAT A;  4TOH A;  1S3Q A;  5FFB A;  2C2F A;  3Q4O A;  2FG8 A;  4DYU A;  2CHI A;  3U90 A;  2WWX B;  4MXP A;  4ISM A;  1XZ3 A;  1GWG A;  1O9R A;  4TO9 A;  1JTS A;  3RGD A;  4QUW A;  2CLU A;  4DE6 A;  2YW7 A;  3E1N A;  2CEI A;  4IWK A;  3F36 A;  1SQ3 A;  2GYD A;  4II4 A;  2ZG9 X;  3Q4N A;  4EVB A;  1O9I A;  4CVP A;  4AM5 A;  2CIH A;  3L0M A;  5FFA A;  2ITB A;  2FZF A;  3BVL A;  4MN9 A;  5GN8 A;  3F32 A;  3N6O A;  4CYA A;  3O7R A;  2HR5 A;  1F30 A;  3KA4 A;  2V2L A;  3R2S A;  1MFR A;  5GN8 B;  3R2K A;  4PGI A;  5CZU A;  1YUZ A;  4XKU A;  3R2R A;  1OTK A;  3FRR A;  2WLA A;  1VJX A;  4LYU A;  3D19 A;  2V2S A;  3R2H A;  3VVA A;  5D8S A;  2OKC A;  3E1J A;  1BG7 A;  3FRS A;  2V2J A;  3WVU A;  3AJQ A;  1JRE A;  4TOD A;  3BT5 A;  5ERJ A;  3WVW A;  3C21 A;  2Z5Q A;  3E2C A;  2YJK A;  4ZL6 A;  1VLG A;  2Y44 A;  4ZTT A;  2V2R A;  4DAS A;  3ISE A;  3HL1 A;  4TOB A;  4EVD A;  5HU6 D;  3T9J A;  2ZG8 X;  1DPS A;  4ZL5 A;  4MJY A;  1F33 A;  4TOE A;  4KVR A;  3VNX A;  3Q4Q A;  1VEL A;  4ITT A;  4DYY A;  4KXR B;  3JZA B;  3AJO A;  4MKU A;  3UOI A;  2AR0 A;  5J93 A;  2CWL A;  3QHC A;  1JI5 A;  2ZG7 X;  5HJF A;  2XJO A;  2CF7 A;  3KHK A;  3BVI A;  1R03 A;  5GU2 X;  4YVZ A;  3E1Q A;  3NOZ X;  4CMY A;  5JKM G;  5C6F A;  3F38 A;  3NP2 X;  5IX6 A;  3E1O A;  4X0J A;  1XZ1 A;  4RC7 B;  3PVR A;  3H7G A;  3ERZ A;  4ZMC A;  2CLB A;  4CVR A;  2FHA A;  3PVR B;  2C2U A;  3F39 A;  3QVD A;  2V8U A;  4M34 A;  1VEI A;  3C1Y A;  3KX9 A;  3PVY A;  2D5K A;  4E6K A;  1QGH A;  4TW3 A;  2WTL A;  4TOA A;  3NP0 X;  1JKV A;  3VV9 A;  1AEW A;  3PVY B;  2WLU A;  5JKL G;  4EVE A;  5FEJ A;  5LG2 A;  1JIG A;  3SID A;  5D8P A;  2BW1 A;  3C1Z A;  3QB9 A;  5LBH A;  2V2M A;  4RC6 A;  3V3K B;  3AK8 A;  1NFV A;  5K52 A;  5AXS A;  2JD7 0;  1JGC A;  1YUX A;  2IU2 A;  4ITW A;  4RC6 B;  1UMN A;  3EZ0 A;  3BVK A;  4ZJK A;  4ZKW A;  4ERU A;  4MY7 A;  2V8T A;  3IS8 A;  5JKM A;  3F33 A;  2CN6 A;  2VXX A; 
#chains in the Genus database with same CATH homology
 3GVY A;  1NF6 A;  4LPN A;  2GYQ A;  4Z3B A;  4ZKH A;  4AM2 A;  5E1U A;  1TK6 A;  1H96 A;  5FFD A;  3IQ1 A;  4RC5 A;  4REU A;  2Z90 A;  3WVV A;  2XJM A;  1J30 A;  1LKO A;  3GHQ A;  1DVB A;  4TOG A;  4RC5 B;  3FSE A;  2FG4 A;  1UVH A;  1ZS3 A;  3OGH A;  4PG0 A;  4DYX A;  2JD8 0;  3F37 A;  5FFE A;  1Z4A A;  3W54 A;  1TJO A;  3JZ9 A;  4Z5S A;  4MUD A;  5JKL A;  2RBD A;  3RD0 A;  4ZLW A;  2Y3Q A;  1S2Z A;  3RE7 A;  2UX1 A;  4M33 A;  3O7S A;  1HRS A;  4E40 A;  4ML5 A;  3UNO A;  5J8W A;  1SOF A;  5E2D A;  4OYN A;  1EUM A;  3OJ5 A;  3ES3 A;  5FFC A;  2FKZ A;  1JKU A;  2ZA6 A;  5CMQ A;  3AF7 X;  2IB0 A;  3A68 A;  4TOF A;  3E1M A;  4LPM A;  1BCF A;  4A25 A;  5LS9 A;  4XGS A;  1BFR A;  1VEQ A;  4PGK A;  2YJJ A;  4W4L B;  3PW1 B;  3C23 A;  4RC7 A;  3R2M A;  5LG8 A;  3KA9 A;  4LQH A;  3QHB A;  1ZUJ A;  3GGY A;  4LQV A;  3PVT B;  2JD6 0;  2G38 B;  5D8Q A;  4KVS A;  2FJC A;  2GS4 A;  1TKO A;  1IES A;  3R2O A;  3KA8 A;  2V2P A;  4CY9 A;  2QF9 A;  1LKP A;  2IY4 A;  4RC8 A;  3BVF A;  4DI0 A;  5CMR A;  2YW6 A;  5GU0 X;  1Z6O M;  3E1L A;  3F35 A;  4IWJ A;  1L8H A;  2HTN A;  3UOF A;  3IS7 A;  2FFX J;  4R42 A;  3SH6 A;  2V2N A;  5D8X A;  3PW8 C;  2QQY A;  1S30 A;  3EZU A;  3SHX A;  4AM4 A;  2XGW A;  3PW8 A;  1B71 A;  3AJP A;  2C6R A;  5D8O A;  5JDO A;  3QD8 A;  4XKS A;  3AF9 X;  1TKP A;  2BJY A;  5JDO B;  2BK6 A;  4CMY V;  5HQO A;  5J9V A;  4ZKX A;  3BVE A;  3PWF A;  2Z6M A;  1LB3 A;  3FVB A;  1RYT A;  5GU1 X;  3AK9 A;  5GU3 X;  4II4 B;  2OH3 A;  3TA8 A;  2CN7 A;  1JI4 A;  3E6S A;  4W4K B;  2ZUR X;  2C2J A;  2Z5R A;  5D8Y A;  3UFB A;  3WNW A;  3KWO A;  2F7N A;  3KDQ A;  1Z6O A;  4YXJ A;  3MPS A;  3RBC A;  2V15 A;  1RCD A;  3E6R A;  4Y08 A;  3R2L A;  2PYB A;  2Z5P A;  4CVS A;  4M32 A;  3AF8 X;  1JYB A;  2V2I A;  2FL0 A;  3KA6 A;  3ISF A;  5JAC A;  1RCI A;  3RAV A;  4CYB A;  4ISP A;  3PWQ C;  4CVT A;  5HJH A;  3F34 A;  1RCE A;  1NF4 A;  4M35 A;  4LQN A;  4LYX A;  4EVC A;  3PWQ A;  1L8I A;  2XKQ A;  4U3G A;  3FI6 A;  4YXM A;  3LKD A;  5GOU A;  5K53 A;  5I4J A;  2W0O A;  2VZB A;  3BKN A;  1FHA A;  3E1P A;  1KRQ A;  3QZ3 A;  2MGY A;  3PW1 A;  1NNQ A;  1YV1 A;  3GGZ A;  3M6J A;  3HIU A;  4ETR A;  3PVT A;  5J8S A;  5D8R A;  3GE4 A;  4KVQ A;  3Q4R A;  1MOJ A;  1LKM A;  2X17 0;  1IER A;  2OC5 A;  4PG1 A;  3PZA A;  4WJG 4;  1RCC A;  3KA3 A;  3DBY A;  4P18 A;  3SE1 A;  4DYZ A;  2N02 A;  4DZ0 A;  1RCG A;  3A9Q A;  3EGM A;  4XKT A;  4LQJ A;  4IXK A;  1N1Q A;  4LPJ A;  2ZA7 A;  2C41 A;  4YKH A;  4TOC A;  2VXI A;  5ERK A;  2V2O A;  2ZA8 A;  3KXU A;  2G4H A;  2CHP A;  2XJN A;  1QYB A;  2BKC A;  1DAT A;  4TOH A;  1S3Q A;  5FFB A;  2C2F A;  3Q4O A;  2FG8 A;  4DYU A;  2CHI A;  3U90 A;  2WWX B;  4MXP A;  4ISM A;  1XZ3 A;  1GWG A;  1O9R A;  4TO9 A;  1JTS A;  3RGD A;  4QUW A;  2CLU A;  4DE6 A;  2YW7 A;  3E1N A;  2CEI A;  4IWK A;  3F36 A;  1SQ3 A;  2GYD A;  4II4 A;  2ZG9 X;  3Q4N A;  4EVB A;  1O9I A;  4CVP A;  4AM5 A;  2CIH A;  3L0M A;  5FFA A;  2ITB A;  2FZF A;  3BVL A;  4MN9 A;  5GN8 A;  3F32 A;  3N6O A;  4CYA A;  3O7R A;  2HR5 A;  1F30 A;  3KA4 A;  2V2L A;  3R2S A;  1MFR A;  5GN8 B;  3R2K A;  4PGI A;  5CZU A;  1YUZ A;  4XKU A;  3R2R A;  1OTK A;  3FRR A;  2WLA A;  1VJX A;  4LYU A;  3D19 A;  2V2S A;  3R2H A;  3VVA A;  5D8S A;  2OKC A;  3E1J A;  1BG7 A;  3FRS A;  2V2J A;  3WVU A;  3AJQ A;  1JRE A;  4TOD A;  3BT5 A;  5ERJ A;  3WVW A;  3C21 A;  2Z5Q A;  3E2C A;  2YJK A;  4ZL6 A;  1VLG A;  2Y44 A;  4ZTT A;  2V2R A;  4DAS A;  3ISE A;  3HL1 A;  4TOB A;  4EVD A;  5HU6 D;  3T9J A;  2ZG8 X;  1DPS A;  4ZL5 A;  4MJY A;  1F33 A;  4TOE A;  4KVR A;  3VNX A;  3Q4Q A;  1VEL A;  4ITT A;  4DYY A;  4KXR B;  3JZA B;  3AJO A;  4MKU A;  3UOI A;  2AR0 A;  5J93 A;  2CWL A;  3QHC A;  1JI5 A;  2ZG7 X;  5HJF A;  2XJO A;  2CF7 A;  3KHK A;  3BVI A;  1R03 A;  5GU2 X;  4YVZ A;  3E1Q A;  3NOZ X;  4CMY A;  5JKM G;  5C6F A;  3F38 A;  3NP2 X;  5IX6 A;  3E1O A;  4X0J A;  1XZ1 A;  4RC7 B;  3PVR A;  3H7G A;  3ERZ A;  4ZMC A;  2CLB A;  4CVR A;  2FHA A;  3PVR B;  2C2U A;  3F39 A;  3QVD A;  2V8U A;  4M34 A;  1VEI A;  3C1Y A;  3KX9 A;  3PVY A;  2D5K A;  4E6K A;  1QGH A;  4TW3 A;  2WTL A;  4TOA A;  3NP0 X;  1JKV A;  3VV9 A;  1AEW A;  3PVY B;  2WLU A;  5JKL G;  4EVE A;  5FEJ A;  5LG2 A;  1JIG A;  3SID A;  5D8P A;  2BW1 A;  3C1Z A;  3QB9 A;  5LBH A;  2V2M A;  4RC6 A;  3V3K B;  3AK8 A;  1NFV A;  5K52 A;  5AXS A;  2JD7 0;  1JGC A;  1YUX A;  2IU2 A;  4ITW A;  4RC6 B;  1UMN A;  3EZ0 A;  3BVK A;  4ZJK A;  4ZKW A;  4ERU A;  4MY7 A;  2V8T A;  3IS8 A;  5JKM A;  3F33 A;  2CN6 A;  2VXX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...