1NF6A

X-ray structure of the desulfovibrio desulfuricans bacterioferritin: the diiron site in different catalytic states ("cycled" structure: reduced in solution and allowed to reoxidise before crystallisation)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
170
structure length
170
Chain Sequence
GNREDRKAKVIEVLNKARAMELHAIHQYMNQHYSLDDMDYGELAANMKLIAIDEMRHAENFAERIKELGGEPTTQKEGKVVTGQAVPVIYESDADQEDATIEAYSQFLKVCKEQGDIVTARLFERIIEEEQAHLTYYENIGSHIKNLGDTYLAKIAGTPSSTGTASKGFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Iron storage/electron transport
molecule keywords bacterioferritin
publication title The nature of the di-iron site in the bacterioferritin from Desulfovibrio desulfuricans
pubmed doi rcsb
total genus 77
structure length 170
sequence length 170
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2002-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1nf6A00
1XZ1A 5GU3X 4M32A 4REUA 3BT5A 1YUXA 1LKOA 1SOFA 3IS8A 3R2HA 4QUWA 5E1UA 2QF9A 4ZMCA 3SIDA 3KA3A 2BJYA 2RBDA 3OGHA 3A9QA 4TOBA 1HRSA 4R42A 1MOJA 4ZLWA 1TJOA 2V2SA 3R2SA 5J93A 4PG0A 1S30A 2CLUA 3QZ3A 3KA6A 3FSEA 2XJOA 2W0OA 4CVPA 5HJFA 5FFDA 4DYXA 2C2JA 5IX6A 3BVEA 5J8WA 4TOAA 5E2DA 4MY7A 4P18A 3NOZX 3E1LA 5C6FA 2FFXJ 4ITTA 3PVTB 3ERZA 3F35A 3SE1A 3BVIA 2XJNA 3PVRB 4CY9A 2FJCA 2VXXA 4AM4A 2V2LA 3RD0A 5HJHA 3RBCA 2V15A 2D5KA 5ERKA 4LPJA 2Z90A 2CF7A 4TOEA 2Y3QA 1TKPA 3AK8A 2FG8A 3QVDA 3PW1A 3WVWA 1IERA 1Z4AA 4AM2A 3E1PA 2V2OA 3BKNA 1LB3A 1UMNA 4RC6A 3AK9A 3Q4QA 3RE7A 3U90A 4XKSA 3FVBA 2FKZA 3E6SA 2CHIA 1O9IA 4ITWA 4CMYV 3O7RA 2Z5PA 4IXKA 4MN9A 5GU2X 5GU0X 2Z5QA 3UOFA 1VELA 4EVDA 4ZKHA 3AF7X 4LYXA 3QB9A 4Z3BA 3AJQA 3R2LA 4TOGA 4RC5A 3MPSA 3ES3A 3GVYA 3E1NA 3A68A 5CZUA 5J9VA 2YW7A 5I4JA 4A25A 5LS9A 2JD80 4ZTTA 1LKPA 4KVSA 1RCGA 4CYAA 3T9JA 3EZ0A 4EVCA 1R03A 4AM5A 5FEJA 1XZ3A 3F32A 1DATA 3F36A 1N1QA 4M35A 2OH3A 2JD60 3NP0X 5D8QA 5LBHA 2BK6A 3QD8A 5GN8B 1Z6OM 1JYBA 1NFVA 2Z6MA 5D8SA 4DI0A 2V2PA 3AF8X 2F7NA 3AF9X 5D8XA 2YW6A 1VLGA 4DZ0A 1JIGA 5FFBA 5D8OA 5ERJA 2FHAA 3R2MA 4LQJA 5D8YA 3R2OA 2CHPA 2IU2A 4Z5SA 4IWKA 2GS4A 2V2IA 1KRQA 1J30A 2ZG8X 3H7GA 2YJJA 5JKLA 3UOIA 4LPNA 3F37A 3AJPA 3AJOA 3KA4A 1UVHA 3R2RA 3KWOA 2C2FA 2ZG7X 2IB0A 2JD70 2CN6A 3KXUA 3PWQC 2V2MA 4ML5A 2CLBA 1YUZA 4ZJKA 3F38A 5JKLG 4ETRA 5D8PA 1MFRA 3WNWA 1OTKA 2QQYA 3HIUA 5GOUA 4DASA 2UX1A 1F30A 5K53A 4ZKXA 4LQVA 2VXIA 2CIHA 3O7SA 4TOHA 1EUMA 4TOFA 2XGWA 4U3GA 1Z6OA 4ZL5A 4ISMA 4II4B 3PW1B 3R2KA 2C41A 3GE4A 3QHBA 4TW3A 3RAVA 2ZURX 4XKUA 2V2NA 4OYNA 5FFAA 2WLUA 3KA8A 2C2UA 4RC6B 3ISEA 1L8IA 4TOCA 5AXSA 2YJKA 2GYDA 1JKUA 1JKVA 2BKCA 4CYBA 2ITBA 4M34A 4LYUA 3PVYA 4MUDA 3RGDA 5J8SA 1QGHA 1S3QA 4LQNA 3F39A 4DYYA 3OJ5A 4RC7B 3Q4RA 3Q4OA 4LQHA 3WVVA 2IY4A 1JGCA 4EVBA 2XKQA 2FG4A 5LG2A 4KVQA 4M33A 3F33A 4PGKA 1B71A 2X170 2BW1A 3KA9A 1JREA 1NNQA 3Q4NA 4IWJA 5JACA 4TODA 2WTLA 1ZS3A 2VZBA 3ISFA 1RYTA 4TO9A 4DYUA 1VEQA 5LG8A 1JI5A 1BFRA 1BCFA 4CVSA 3E1OA 3FI6A 3NP2X 3BVLA 2PYBA 2ZA8A 3BVFA 1RCIA 4EVEA 3PVTA 2FZFA 3E2CA 2FL0A 3SH6A 4CVTA 2HR5A 3PVRA 4PGIA 1L8HA 2CN7A 4Y08A 5D8RA 1S2ZA 1NF4A 4CMYA 3PWQA 4ZKWA 4RC8A 3BVKA 1GWGA 3E1QA 3F34A 2G4HA 1BG7A 2C6RA 3E6RA 5HQOA 1SQ3A 3PW8A 1AEWA 1TK6A 3PW8C 2XJMA 5FFCA 4XKTA 1RCDA 2WLAA 1IESA 2Z5RA 3PZAA 1TKOA 4II4A 5FFEA 1YV1A 1RCEA 4MKUA 5JKMA 3SHXA 4LPMA 1QYBA 4MJYA 1VJXA 1VEIA 3QHCA 1H96A 3VNXA 5K52A 1NF6A 3PWFA 3KX9A 3WVUA 2ZG9X 1JI4A 1DPSA 4KVRA 5GU1X 4DE6A 4ISPA 5JKMG 5CMQA 4ERUA 4DYZA 2CEIA 1DVBA 2V2JA 3GHQA 4YKHA 3UNOA 3E1JA 2ZA6A 3E1MA 4ZL6A 1RCCA 4RC7A 1F33A 4XGSA 4RC5B 1FHAA 3EGMA 4CVRA 1ZUJA 1JTSA 5GN8A 4E6KA 3PVYB 3IS7A 3TA8A 1O9RA 5CMRA 2GYQA 3EZUA 2HTNA 3IQ1A 2ZA7A 1LKMA 3HL1A 4PG1A 2V2RA 2OC5A
chains in the Genus database with same CATH superfamily
1XZ1A 2V8UA 5GU3X 4M32A 3JZAB 4REUA 3BT5A 1YUXA 1LKOA 1SOFA 3IS8A 3R2HA 4QUWA 5E1UA 3C21A 2QF9A 4ZMCA 3SIDA 3KA3A 2BJYA 2RBDA 3OGHA 3A9QA 4TOBA 1HRSA 4R42A 1MOJA 4E40A 4ZLWA 1TJOA 2V2SA 3R2SA 5J93A 4PG0A 1S30A 2CLUA 3QZ3A 3KA6A 3FSEA 2XJOA 2W0OA 4CVPA 5HJFA 5FFDA 4DYXA 3JZ9A 2C2JA 2G38B 5IX6A 3BVEA 5J8WA 4TOAA 5E2DA 4MY7A 4P18A 3C23A 3NOZX 5HU6D 3E1LA 5C6FA 2FFXJ 4ITTA 3PVTB 3ERZA 3F35A 3SE1A 3BVIA 2XJNA 3PVRB 4CY9A 2FJCA 2VXXA 4AM4A 2V2LA 3RD0A 5HJHA 3RBCA 2V15A 2D5KA 5ERKA 4LPJA 2Z90A 2CF7A 4TOEA 3C1ZA 3VVAA 2Y3QA 1TKPA 3AK8A 2FG8A 3QVDA 3PW1A 3WVWA 1IERA 1Z4AA 4AM2A 3E1PA 2V2OA 3BKNA 3VV9A 1LB3A 1UMNA 4RC6A 3AK9A 3Q4QA 3RE7A 3U90A 4YXJA 4XKSA 3FVBA 2FKZA 3E6SA 5JDOA 2CHIA 1O9IA 3FRRA 4ITWA 4CMYV 3O7RA 2Z5PA 4IXKA 4MN9A 5GU2X 5GU0X 2Z5QA 3UOFA 1VELA 4EVDA 4ZKHA 3AF7X 4LYXA 3QB9A 4Z3BA 3AJQA 3R2LA 4TOGA 4RC5A 3MPSA 3ES3A 3GVYA 3E1NA 3A68A 5CZUA 5J9VA 3D19A 4W4LB 2YW7A 5I4JA 4A25A 5LS9A 2JD80 4ZTTA 1LKPA 4KVSA 1RCGA 4CYAA 3GGYA 3T9JA 3EZ0A 4EVCA 1R03A 4YXMA 4AM5A 5FEJA 1XZ3A 3F32A 1DATA 3F36A 1N1QA 4M35A 2OH3A 2JD60 3NP0X 5D8QA 5LBHA 2BK6A 3QD8A 5GN8B 1Z6OM 1JYBA 1NFVA 2Z6MA 5D8SA 4DI0A 2V2PA 3AF8X 2F7NA 3AF9X 5D8XA 2YW6A 3GGZA 1VLGA 4DZ0A 1JIGA 5FFBA 5D8OA 5ERJA 2FHAA 3R2MA 4LQJA 5D8YA 3KDQA 3R2OA 2CHPA 2IU2A 4Z5SA 4IWKA 2GS4A 2V2IA 4KXRB 1KRQA 1J30A 2ZG8X 3H7GA 2YJJA 2CWLA 5JKLA 3UOIA 4LPNA 3F37A 3AJPA 3AJOA 3KA4A 1UVHA 3R2RA 3KWOA 2C2FA 2ZG7X 2IB0A 2JD70 2CN6A 3KXUA 3PWQC 2V2MA 4YVZA 4ML5A 2CLBA 1YUZA 4ZJKA 3F38A 5JKLG 4ETRA 5D8PA 1MFRA 3WNWA 1OTKA 2QQYA 3HIUA 2N02A 5GOUA 4DASA 2UX1A 1F30A 5K53A 4ZKXA 4LQVA 2VXIA 2CIHA 3O7SA 4TOHA 1EUMA 4TOFA 2XGWA 3W54A 4U3GA 1Z6OA 4ZL5A 4ISMA 4II4B 3PW1B 3R2KA 2C41A 3GE4A 3QHBA 4TW3A 3RAVA 2ZURX 4XKUA 2V2NA 4OYNA 3LKDA 5FFAA 2WLUA 3KA8A 2C2UA 4RC6B 3ISEA 1L8IA 4TOCA 5AXSA 2YJKA 2GYDA 4WJG4 1JKUA 1JKVA 2BKCA 4CYBA 2ITBA 4M34A 3UFBA 4LYUA 3PVYA 4MUDA 3RGDA 5J8SA 1QGHA 1S3QA 4LQNA 3F39A 4DYYA 3OJ5A 4RC7B 3Q4RA 3Q4OA 3DBYA 4LQHA 3WVVA 2IY4A 3V3KB 1JGCA 4EVBA 2XKQA 2FG4A 5LG2A 4KVQA 4M33A 3F33A 4PGKA 1B71A 4X0JA 2X170 2BW1A 3KA9A 1JREA 1NNQA 3Q4NA 4IWJA 5JACA 4TODA 2WTLA 1ZS3A 2VZBA 3ISFA 1RYTA 4TO9A 4DYUA 1VEQA 3FRSA 3KHKA 1JI5A 5LG8A 1BFRA 1BCFA 4CVSA 3E1OA 2WWXB 3FI6A 3NP2X 3BVLA 2PYBA 2ZA8A 3BVFA 1RCIA 4EVEA 3PVTA 2FZFA 3E2CA 2FL0A 3SH6A 4CVTA 2HR5A 3PVRA 4PGIA 1L8HA 2CN7A 4Y08A 5D8RA 2MGYA 1S2ZA 1NF4A 4CMYA 3PWQA 4ZKWA 4RC8A 3BVKA 1GWGA 3E1QA 2OKCA 3F34A 2G4HA 1BG7A 2C6RA 3E6RA 5HQOA 1SQ3A 3PW8A 1AEWA 1TK6A 3PW8C 2XJMA 5FFCA 4XKTA 1RCDA 4MXPA 2WLAA 1IESA 2Z5RA 3PZAA 1TKOA 4II4A 5FFEA 1YV1A 1RCEA 2V8TA 4MKUA 5JKMA 3SHXA 4LPMA 1QYBA 4MJYA 1VJXA 3C1YA 1VEIA 3QHCA 1H96A 3VNXA 5K52A 1NF6A 5JDOB 3PWFA 3KX9A 3WVUA 2AR0A 2ZG9X 1JI4A 1DPSA 4KVRA 5GU1X 4DE6A 4ISPA 5JKMG 5CMQA 4ERUA 4DYZA 2CEIA 3M6JA 1DVBA 2V2JA 3GHQA 4YKHA 3UNOA 3E1JA 2ZA6A 3E1MA 4ZL6A 1RCCA 4RC7A 1F33A 4XGSA 4RC5B 1FHAA 3EGMA 4CVRA 1ZUJA 1JTSA 3L0MA 5GN8A 4E6KA 3PVYB 3N6OA 4W4KB 3IS7A 3TA8A 1O9RA 5CMRA 2GYQA 3EZUA 2HTNA 3IQ1A 2ZA7A 1LKMA 3HL1A 4PG1A 2V2RA 2Y44A 2OC5A
chains in the Genus database with same CATH topology
1XZ1A 2V8UA 5GU3X 4M32A 3JZAB 4REUA 3BT5A 1YUXA 1LKOA 1SOFA 3IS8A 3R2HA 4QUWA 5E1UA 3C21A 2QF9A 4ZMCA 3SIDA 3KA3A 2BJYA 2RBDA 3OGHA 3A9QA 4TOBA 1HRSA 4R42A 1MOJA 4E40A 4ZLWA 1TJOA 2V2SA 3R2SA 5J93A 4PG0A 1S30A 2CLUA 3QZ3A 3KA6A 3FSEA 2XJOA 2W0OA 4CVPA 5HJFA 5FFDA 4DYXA 3JZ9A 2C2JA 2G38B 5IX6A 3BVEA 5J8WA 4TOAA 5E2DA 4MY7A 4P18A 3C23A 3NOZX 5HU6D 3E1LA 5C6FA 2FFXJ 4ITTA 3PVTB 3ERZA 3F35A 3SE1A 3BVIA 2XJNA 3PVRB 4CY9A 2FJCA 2VXXA 4AM4A 2V2LA 3RD0A 5HJHA 3RBCA 2V15A 2D5KA 5ERKA 4LPJA 2Z90A 2CF7A 4TOEA 3C1ZA 3VVAA 2Y3QA 1TKPA 3AK8A 2FG8A 3QVDA 3PW1A 3WVWA 1IERA 1Z4AA 4AM2A 3E1PA 2V2OA 3BKNA 3VV9A 1LB3A 1UMNA 4RC6A 3AK9A 3Q4QA 3RE7A 3U90A 4YXJA 4XKSA 3FVBA 2FKZA 3E6SA 5JDOA 2CHIA 1O9IA 3FRRA 4ITWA 4CMYV 3O7RA 2Z5PA 4IXKA 4MN9A 5GU2X 5GU0X 2Z5QA 3UOFA 1VELA 4EVDA 4ZKHA 3AF7X 4LYXA 3QB9A 4Z3BA 3AJQA 3R2LA 4TOGA 4RC5A 3MPSA 3ES3A 3GVYA 3E1NA 3A68A 5CZUA 5J9VA 3D19A 4W4LB 2YW7A 5I4JA 4A25A 5LS9A 2JD80 4ZTTA 1LKPA 4KVSA 1RCGA 4CYAA 3GGYA 3T9JA 3EZ0A 4EVCA 1R03A 4YXMA 4AM5A 5FEJA 1XZ3A 3F32A 1DATA 3F36A 1N1QA 4M35A 2OH3A 2JD60 3NP0X 5D8QA 5LBHA 2BK6A 3QD8A 5GN8B 1Z6OM 1JYBA 1NFVA 2Z6MA 5D8SA 4DI0A 2V2PA 3AF8X 2F7NA 3AF9X 5D8XA 2YW6A 3GGZA 1VLGA 4DZ0A 1JIGA 5FFBA 5D8OA 5ERJA 2FHAA 3R2MA 4LQJA 5D8YA 3KDQA 3R2OA 2CHPA 2IU2A 4Z5SA 4IWKA 2GS4A 2V2IA 4KXRB 1KRQA 1J30A 2ZG8X 3H7GA 2YJJA 2CWLA 5JKLA 3UOIA 4LPNA 3F37A 3AJPA 3AJOA 3KA4A 1UVHA 3R2RA 3KWOA 2C2FA 2ZG7X 2IB0A 2JD70 2CN6A 3KXUA 3PWQC 2V2MA 4YVZA 4ML5A 2CLBA 1YUZA 4ZJKA 3F38A 5JKLG 4ETRA 5D8PA 1MFRA 3WNWA 1OTKA 2QQYA 3HIUA 2N02A 5GOUA 4DASA 2UX1A 1F30A 5K53A 4ZKXA 4LQVA 2VXIA 2CIHA 3O7SA 4TOHA 1EUMA 4TOFA 2XGWA 3W54A 4U3GA 1Z6OA 4ZL5A 4ISMA 4II4B 3PW1B 3R2KA 2C41A 3GE4A 3QHBA 4TW3A 3RAVA 2ZURX 4XKUA 2V2NA 4OYNA 3LKDA 5FFAA 2WLUA 3KA8A 2C2UA 4RC6B 3ISEA 1L8IA 4TOCA 5AXSA 2YJKA 2GYDA 4WJG4 1JKUA 1JKVA 2BKCA 4CYBA 2ITBA 4M34A 3UFBA 4LYUA 3PVYA 4MUDA 3RGDA 5J8SA 1QGHA 1S3QA 4LQNA 3F39A 4DYYA 3OJ5A 4RC7B 3Q4RA 3Q4OA 3DBYA 4LQHA 3WVVA 2IY4A 3V3KB 1JGCA 4EVBA 2XKQA 2FG4A 5LG2A 4KVQA 4M33A 3F33A 4PGKA 1B71A 4X0JA 2X170 2BW1A 3KA9A 1JREA 1NNQA 3Q4NA 4IWJA 5JACA 4TODA 2WTLA 1ZS3A 2VZBA 3ISFA 1RYTA 4TO9A 4DYUA 1VEQA 3FRSA 3KHKA 1JI5A 5LG8A 1BFRA 1BCFA 4CVSA 3E1OA 2WWXB 3FI6A 3NP2X 3BVLA 2PYBA 2ZA8A 3BVFA 1RCIA 4EVEA 3PVTA 2FZFA 3E2CA 2FL0A 3SH6A 4CVTA 2HR5A 3PVRA 4PGIA 1L8HA 2CN7A 4Y08A 5D8RA 2MGYA 1S2ZA 1NF4A 4CMYA 3PWQA 4ZKWA 4RC8A 3BVKA 1GWGA 3E1QA 2OKCA 3F34A 2G4HA 1BG7A 2C6RA 3E6RA 5HQOA 1SQ3A 3PW8A 1AEWA 1TK6A 3PW8C 2XJMA 5FFCA 4XKTA 1RCDA 4MXPA 2WLAA 1IESA 2Z5RA 3PZAA 1TKOA 4II4A 5FFEA 1YV1A 1RCEA 2V8TA 4MKUA 5JKMA 3SHXA 4LPMA 1QYBA 4MJYA 1VJXA 3C1YA 1VEIA 3QHCA 1H96A 3VNXA 5K52A 1NF6A 5JDOB 3PWFA 3KX9A 3WVUA 2AR0A 2ZG9X 1JI4A 1DPSA 4KVRA 5GU1X 4DE6A 4ISPA 5JKMG 5CMQA 4ERUA 4DYZA 2CEIA 3M6JA 1DVBA 2V2JA 3GHQA 4YKHA 3UNOA 3E1JA 2ZA6A 3E1MA 4ZL6A 1RCCA 4RC7A 1F33A 4XGSA 4RC5B 1FHAA 3EGMA 4CVRA 1ZUJA 1JTSA 3L0MA 5GN8A 4E6KA 3PVYB 3N6OA 4W4KB 3IS7A 3TA8A 1O9RA 5CMRA 2GYQA 3EZUA 2HTNA 3IQ1A 2ZA7A 1LKMA 3HL1A 4PG1A 2V2RA 2Y44A 2OC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XZ1 A;  5GU3 X;  4M32 A;  4REU A;  3BT5 A;  1YUX A;  1LKO A;  1SOF A;  3IS8 A;  3R2H A;  4QUW A;  5E1U A;  2QF9 A;  4ZMC A;  3SID A;  3KA3 A;  2BJY A;  2RBD A;  3OGH A;  3A9Q A;  4TOB A;  1HRS A;  4R42 A;  1MOJ A;  4ZLW A;  1TJO A;  2V2S A;  3R2S A;  5J93 A;  4PG0 A;  1S30 A;  2CLU A;  3QZ3 A;  3KA6 A;  3FSE A;  2XJO A;  2W0O A;  4CVP A;  5HJF A;  5FFD A;  4DYX A;  2C2J A;  5IX6 A;  3BVE A;  5J8W A;  4TOA A;  5E2D A;  4MY7 A;  4P18 A;  3NOZ X;  3E1L A;  5C6F A;  2FFX J;  4ITT A;  3PVT B;  3ERZ A;  3F35 A;  3SE1 A;  3BVI A;  2XJN A;  3PVR B;  4CY9 A;  2FJC A;  2VXX A;  4AM4 A;  2V2L A;  3RD0 A;  5HJH A;  3RBC A;  2V15 A;  2D5K A;  5ERK A;  4LPJ A;  2Z90 A;  2CF7 A;  4TOE A;  2Y3Q A;  1TKP A;  3AK8 A;  2FG8 A;  3QVD A;  3PW1 A;  3WVW A;  1IER A;  1Z4A A;  4AM2 A;  3E1P A;  2V2O A;  3BKN A;  1LB3 A;  1UMN A;  4RC6 A;  3AK9 A;  3Q4Q A;  3RE7 A;  3U90 A;  4XKS A;  3FVB A;  2FKZ A;  3E6S A;  2CHI A;  1O9I A;  4ITW A;  4CMY V;  3O7R A;  2Z5P A;  4IXK A;  4MN9 A;  5GU2 X;  5GU0 X;  2Z5Q A;  3UOF A;  1VEL A;  4EVD A;  4ZKH A;  3AF7 X;  4LYX A;  3QB9 A;  4Z3B A;  3AJQ A;  3R2L A;  4TOG A;  4RC5 A;  3MPS A;  3ES3 A;  3GVY A;  3E1N A;  3A68 A;  5CZU A;  5J9V A;  2YW7 A;  5I4J A;  4A25 A;  5LS9 A;  2JD8 0;  4ZTT A;  1LKP A;  4KVS A;  1RCG A;  4CYA A;  3T9J A;  3EZ0 A;  4EVC A;  1R03 A;  4AM5 A;  5FEJ A;  1XZ3 A;  3F32 A;  1DAT A;  3F36 A;  1N1Q A;  4M35 A;  2OH3 A;  2JD6 0;  3NP0 X;  5D8Q A;  5LBH A;  2BK6 A;  3QD8 A;  5GN8 B;  1Z6O M;  1JYB A;  1NFV A;  2Z6M A;  5D8S A;  4DI0 A;  2V2P A;  3AF8 X;  2F7N A;  3AF9 X;  5D8X A;  2YW6 A;  1VLG A;  4DZ0 A;  1JIG A;  5FFB A;  5D8O A;  5ERJ A;  2FHA A;  3R2M A;  4LQJ A;  5D8Y A;  3R2O A;  2CHP A;  2IU2 A;  4Z5S A;  4IWK A;  2GS4 A;  2V2I A;  1KRQ A;  1J30 A;  2ZG8 X;  3H7G A;  2YJJ A;  5JKL A;  3UOI A;  4LPN A;  3F37 A;  3AJP A;  3AJO A;  3KA4 A;  1UVH A;  3R2R A;  3KWO A;  2C2F A;  2ZG7 X;  2IB0 A;  2JD7 0;  2CN6 A;  3KXU A;  3PWQ C;  2V2M A;  4ML5 A;  2CLB A;  1YUZ A;  4ZJK A;  3F38 A;  5JKL G;  4ETR A;  5D8P A;  1MFR A;  3WNW A;  1OTK A;  2QQY A;  3HIU A;  5GOU A;  4DAS A;  2UX1 A;  1F30 A;  5K53 A;  4ZKX A;  4LQV A;  2VXI A;  2CIH A;  3O7S A;  4TOH A;  1EUM A;  4TOF A;  2XGW A;  4U3G A;  1Z6O A;  4ZL5 A;  4ISM A;  4II4 B;  3PW1 B;  3R2K A;  2C41 A;  3GE4 A;  3QHB A;  4TW3 A;  3RAV A;  2ZUR X;  4XKU A;  2V2N A;  4OYN A;  5FFA A;  2WLU A;  3KA8 A;  2C2U A;  4RC6 B;  3ISE A;  1L8I A;  4TOC A;  5AXS A;  2YJK A;  2GYD A;  1JKU A;  1JKV A;  2BKC A;  4CYB A;  2ITB A;  4M34 A;  4LYU A;  3PVY A;  4MUD A;  3RGD A;  5J8S A;  1QGH A;  1S3Q A;  4LQN A;  3F39 A;  4DYY A;  3OJ5 A;  4RC7 B;  3Q4R A;  3Q4O A;  4LQH A;  3WVV A;  2IY4 A;  1JGC A;  4EVB A;  2XKQ A;  2FG4 A;  5LG2 A;  4KVQ A;  4M33 A;  3F33 A;  4PGK A;  1B71 A;  2X17 0;  2BW1 A;  3KA9 A;  1JRE A;  1NNQ A;  3Q4N A;  4IWJ A;  5JAC A;  4TOD A;  2WTL A;  1ZS3 A;  2VZB A;  3ISF A;  1RYT A;  4TO9 A;  4DYU A;  1VEQ A;  5LG8 A;  1JI5 A;  1BFR A;  1BCF A;  4CVS A;  3E1O A;  3FI6 A;  3NP2 X;  3BVL A;  2PYB A;  2ZA8 A;  3BVF A;  1RCI A;  4EVE A;  3PVT A;  2FZF A;  3E2C A;  2FL0 A;  3SH6 A;  4CVT A;  2HR5 A;  3PVR A;  4PGI A;  1L8H A;  2CN7 A;  4Y08 A;  5D8R A;  1S2Z A;  1NF4 A;  4CMY A;  3PWQ A;  4ZKW A;  4RC8 A;  3BVK A;  1GWG A;  3E1Q A;  3F34 A;  2G4H A;  1BG7 A;  2C6R A;  3E6R A;  5HQO A;  1SQ3 A;  3PW8 A;  1AEW A;  1TK6 A;  3PW8 C;  2XJM A;  5FFC A;  4XKT A;  1RCD A;  2WLA A;  1IES A;  2Z5R A;  3PZA A;  1TKO A;  4II4 A;  5FFE A;  1YV1 A;  1RCE A;  4MKU A;  5JKM A;  3SHX A;  4LPM A;  1QYB A;  4MJY A;  1VJX A;  1VEI A;  3QHC A;  1H96 A;  3VNX A;  5K52 A;  1NF6 A;  3PWF A;  3KX9 A;  3WVU A;  2ZG9 X;  1JI4 A;  1DPS A;  4KVR A;  5GU1 X;  4DE6 A;  4ISP A;  5JKM G;  5CMQ A;  4ERU A;  4DYZ A;  2CEI A;  1DVB A;  2V2J A;  3GHQ A;  4YKH A;  3UNO A;  3E1J A;  2ZA6 A;  3E1M A;  4ZL6 A;  1RCC A;  4RC7 A;  1F33 A;  4XGS A;  4RC5 B;  1FHA A;  3EGM A;  4CVR A;  1ZUJ A;  1JTS A;  5GN8 A;  4E6K A;  3PVY B;  3IS7 A;  3TA8 A;  1O9R A;  5CMR A;  2GYQ A;  3EZU A;  2HTN A;  3IQ1 A;  2ZA7 A;  1LKM A;  3HL1 A;  4PG1 A;  2V2R A;  2OC5 A; 
#chains in the Genus database with same CATH topology
 1XZ1 A;  2V8U A;  5GU3 X;  4M32 A;  3JZA B;  4REU A;  3BT5 A;  1YUX A;  1LKO A;  1SOF A;  3IS8 A;  3R2H A;  4QUW A;  5E1U A;  3C21 A;  2QF9 A;  4ZMC A;  3SID A;  3KA3 A;  2BJY A;  2RBD A;  3OGH A;  3A9Q A;  4TOB A;  1HRS A;  4R42 A;  1MOJ A;  4E40 A;  4ZLW A;  1TJO A;  2V2S A;  3R2S A;  5J93 A;  4PG0 A;  1S30 A;  2CLU A;  3QZ3 A;  3KA6 A;  3FSE A;  2XJO A;  2W0O A;  4CVP A;  5HJF A;  5FFD A;  4DYX A;  3JZ9 A;  2C2J A;  2G38 B;  5IX6 A;  3BVE A;  5J8W A;  4TOA A;  5E2D A;  4MY7 A;  4P18 A;  3C23 A;  3NOZ X;  5HU6 D;  3E1L A;  5C6F A;  2FFX J;  4ITT A;  3PVT B;  3ERZ A;  3F35 A;  3SE1 A;  3BVI A;  2XJN A;  3PVR B;  4CY9 A;  2FJC A;  2VXX A;  4AM4 A;  2V2L A;  3RD0 A;  5HJH A;  3RBC A;  2V15 A;  2D5K A;  5ERK A;  4LPJ A;  2Z90 A;  2CF7 A;  4TOE A;  3C1Z A;  3VVA A;  2Y3Q A;  1TKP A;  3AK8 A;  2FG8 A;  3QVD A;  3PW1 A;  3WVW A;  1IER A;  1Z4A A;  4AM2 A;  3E1P A;  2V2O A;  3BKN A;  3VV9 A;  1LB3 A;  1UMN A;  4RC6 A;  3AK9 A;  3Q4Q A;  3RE7 A;  3U90 A;  4YXJ A;  4XKS A;  3FVB A;  2FKZ A;  3E6S A;  5JDO A;  2CHI A;  1O9I A;  3FRR A;  4ITW A;  4CMY V;  3O7R A;  2Z5P A;  4IXK A;  4MN9 A;  5GU2 X;  5GU0 X;  2Z5Q A;  3UOF A;  1VEL A;  4EVD A;  4ZKH A;  3AF7 X;  4LYX A;  3QB9 A;  4Z3B A;  3AJQ A;  3R2L A;  4TOG A;  4RC5 A;  3MPS A;  3ES3 A;  3GVY A;  3E1N A;  3A68 A;  5CZU A;  5J9V A;  3D19 A;  4W4L B;  2YW7 A;  5I4J A;  4A25 A;  5LS9 A;  2JD8 0;  4ZTT A;  1LKP A;  4KVS A;  1RCG A;  4CYA A;  3GGY A;  3T9J A;  3EZ0 A;  4EVC A;  1R03 A;  4YXM A;  4AM5 A;  5FEJ A;  1XZ3 A;  3F32 A;  1DAT A;  3F36 A;  1N1Q A;  4M35 A;  2OH3 A;  2JD6 0;  3NP0 X;  5D8Q A;  5LBH A;  2BK6 A;  3QD8 A;  5GN8 B;  1Z6O M;  1JYB A;  1NFV A;  2Z6M A;  5D8S A;  4DI0 A;  2V2P A;  3AF8 X;  2F7N A;  3AF9 X;  5D8X A;  2YW6 A;  3GGZ A;  1VLG A;  4DZ0 A;  1JIG A;  5FFB A;  5D8O A;  5ERJ A;  2FHA A;  3R2M A;  4LQJ A;  5D8Y A;  3KDQ A;  3R2O A;  2CHP A;  2IU2 A;  4Z5S A;  4IWK A;  2GS4 A;  2V2I A;  4KXR B;  1KRQ A;  1J30 A;  2ZG8 X;  3H7G A;  2YJJ A;  2CWL A;  5JKL A;  3UOI A;  4LPN A;  3F37 A;  3AJP A;  3AJO A;  3KA4 A;  1UVH A;  3R2R A;  3KWO A;  2C2F A;  2ZG7 X;  2IB0 A;  2JD7 0;  2CN6 A;  3KXU A;  3PWQ C;  2V2M A;  4YVZ A;  4ML5 A;  2CLB A;  1YUZ A;  4ZJK A;  3F38 A;  5JKL G;  4ETR A;  5D8P A;  1MFR A;  3WNW A;  1OTK A;  2QQY A;  3HIU A;  2N02 A;  5GOU A;  4DAS A;  2UX1 A;  1F30 A;  5K53 A;  4ZKX A;  4LQV A;  2VXI A;  2CIH A;  3O7S A;  4TOH A;  1EUM A;  4TOF A;  2XGW A;  3W54 A;  4U3G A;  1Z6O A;  4ZL5 A;  4ISM A;  4II4 B;  3PW1 B;  3R2K A;  2C41 A;  3GE4 A;  3QHB A;  4TW3 A;  3RAV A;  2ZUR X;  4XKU A;  2V2N A;  4OYN A;  3LKD A;  5FFA A;  2WLU A;  3KA8 A;  2C2U A;  4RC6 B;  3ISE A;  1L8I A;  4TOC A;  5AXS A;  2YJK A;  2GYD A;  4WJG 4;  1JKU A;  1JKV A;  2BKC A;  4CYB A;  2ITB A;  4M34 A;  3UFB A;  4LYU A;  3PVY A;  4MUD A;  3RGD A;  5J8S A;  1QGH A;  1S3Q A;  4LQN A;  3F39 A;  4DYY A;  3OJ5 A;  4RC7 B;  3Q4R A;  3Q4O A;  3DBY A;  4LQH A;  3WVV A;  2IY4 A;  3V3K B;  1JGC A;  4EVB A;  2XKQ A;  2FG4 A;  5LG2 A;  4KVQ A;  4M33 A;  3F33 A;  4PGK A;  1B71 A;  4X0J A;  2X17 0;  2BW1 A;  3KA9 A;  1JRE A;  1NNQ A;  3Q4N A;  4IWJ A;  5JAC A;  4TOD A;  2WTL A;  1ZS3 A;  2VZB A;  3ISF A;  1RYT A;  4TO9 A;  4DYU A;  1VEQ A;  3FRS A;  3KHK A;  1JI5 A;  5LG8 A;  1BFR A;  1BCF A;  4CVS A;  3E1O A;  2WWX B;  3FI6 A;  3NP2 X;  3BVL A;  2PYB A;  2ZA8 A;  3BVF A;  1RCI A;  4EVE A;  3PVT A;  2FZF A;  3E2C A;  2FL0 A;  3SH6 A;  4CVT A;  2HR5 A;  3PVR A;  4PGI A;  1L8H A;  2CN7 A;  4Y08 A;  5D8R A;  2MGY A;  1S2Z A;  1NF4 A;  4CMY A;  3PWQ A;  4ZKW A;  4RC8 A;  3BVK A;  1GWG A;  3E1Q A;  2OKC A;  3F34 A;  2G4H A;  1BG7 A;  2C6R A;  3E6R A;  5HQO A;  1SQ3 A;  3PW8 A;  1AEW A;  1TK6 A;  3PW8 C;  2XJM A;  5FFC A;  4XKT A;  1RCD A;  4MXP A;  2WLA A;  1IES A;  2Z5R A;  3PZA A;  1TKO A;  4II4 A;  5FFE A;  1YV1 A;  1RCE A;  2V8T A;  4MKU A;  5JKM A;  3SHX A;  4LPM A;  1QYB A;  4MJY A;  1VJX A;  3C1Y A;  1VEI A;  3QHC A;  1H96 A;  3VNX A;  5K52 A;  1NF6 A;  5JDO B;  3PWF A;  3KX9 A;  3WVU A;  2AR0 A;  2ZG9 X;  1JI4 A;  1DPS A;  4KVR A;  5GU1 X;  4DE6 A;  4ISP A;  5JKM G;  5CMQ A;  4ERU A;  4DYZ A;  2CEI A;  3M6J A;  1DVB A;  2V2J A;  3GHQ A;  4YKH A;  3UNO A;  3E1J A;  2ZA6 A;  3E1M A;  4ZL6 A;  1RCC A;  4RC7 A;  1F33 A;  4XGS A;  4RC5 B;  1FHA A;  3EGM A;  4CVR A;  1ZUJ A;  1JTS A;  3L0M A;  5GN8 A;  4E6K A;  3PVY B;  3N6O A;  4W4K B;  3IS7 A;  3TA8 A;  1O9R A;  5CMR A;  2GYQ A;  3EZU A;  2HTN A;  3IQ1 A;  2ZA7 A;  1LKM A;  3HL1 A;  4PG1 A;  2V2R A;  2Y44 A;  2OC5 A; 
#chains in the Genus database with same CATH homology
 1XZ1 A;  2V8U A;  5GU3 X;  4M32 A;  3JZA B;  4REU A;  3BT5 A;  1YUX A;  1LKO A;  1SOF A;  3IS8 A;  3R2H A;  4QUW A;  5E1U A;  3C21 A;  2QF9 A;  4ZMC A;  3SID A;  3KA3 A;  2BJY A;  2RBD A;  3OGH A;  3A9Q A;  4TOB A;  1HRS A;  4R42 A;  1MOJ A;  4E40 A;  4ZLW A;  1TJO A;  2V2S A;  3R2S A;  5J93 A;  4PG0 A;  1S30 A;  2CLU A;  3QZ3 A;  3KA6 A;  3FSE A;  2XJO A;  2W0O A;  4CVP A;  5HJF A;  5FFD A;  4DYX A;  3JZ9 A;  2C2J A;  2G38 B;  5IX6 A;  3BVE A;  5J8W A;  4TOA A;  5E2D A;  4MY7 A;  4P18 A;  3C23 A;  3NOZ X;  5HU6 D;  3E1L A;  5C6F A;  2FFX J;  4ITT A;  3PVT B;  3ERZ A;  3F35 A;  3SE1 A;  3BVI A;  2XJN A;  3PVR B;  4CY9 A;  2FJC A;  2VXX A;  4AM4 A;  2V2L A;  3RD0 A;  5HJH A;  3RBC A;  2V15 A;  2D5K A;  5ERK A;  4LPJ A;  2Z90 A;  2CF7 A;  4TOE A;  3C1Z A;  3VVA A;  2Y3Q A;  1TKP A;  3AK8 A;  2FG8 A;  3QVD A;  3PW1 A;  3WVW A;  1IER A;  1Z4A A;  4AM2 A;  3E1P A;  2V2O A;  3BKN A;  3VV9 A;  1LB3 A;  1UMN A;  4RC6 A;  3AK9 A;  3Q4Q A;  3RE7 A;  3U90 A;  4YXJ A;  4XKS A;  3FVB A;  2FKZ A;  3E6S A;  5JDO A;  2CHI A;  1O9I A;  3FRR A;  4ITW A;  4CMY V;  3O7R A;  2Z5P A;  4IXK A;  4MN9 A;  5GU2 X;  5GU0 X;  2Z5Q A;  3UOF A;  1VEL A;  4EVD A;  4ZKH A;  3AF7 X;  4LYX A;  3QB9 A;  4Z3B A;  3AJQ A;  3R2L A;  4TOG A;  4RC5 A;  3MPS A;  3ES3 A;  3GVY A;  3E1N A;  3A68 A;  5CZU A;  5J9V A;  3D19 A;  4W4L B;  2YW7 A;  5I4J A;  4A25 A;  5LS9 A;  2JD8 0;  4ZTT A;  1LKP A;  4KVS A;  1RCG A;  4CYA A;  3GGY A;  3T9J A;  3EZ0 A;  4EVC A;  1R03 A;  4YXM A;  4AM5 A;  5FEJ A;  1XZ3 A;  3F32 A;  1DAT A;  3F36 A;  1N1Q A;  4M35 A;  2OH3 A;  2JD6 0;  3NP0 X;  5D8Q A;  5LBH A;  2BK6 A;  3QD8 A;  5GN8 B;  1Z6O M;  1JYB A;  1NFV A;  2Z6M A;  5D8S A;  4DI0 A;  2V2P A;  3AF8 X;  2F7N A;  3AF9 X;  5D8X A;  2YW6 A;  3GGZ A;  1VLG A;  4DZ0 A;  1JIG A;  5FFB A;  5D8O A;  5ERJ A;  2FHA A;  3R2M A;  4LQJ A;  5D8Y A;  3KDQ A;  3R2O A;  2CHP A;  2IU2 A;  4Z5S A;  4IWK A;  2GS4 A;  2V2I A;  4KXR B;  1KRQ A;  1J30 A;  2ZG8 X;  3H7G A;  2YJJ A;  2CWL A;  5JKL A;  3UOI A;  4LPN A;  3F37 A;  3AJP A;  3AJO A;  3KA4 A;  1UVH A;  3R2R A;  3KWO A;  2C2F A;  2ZG7 X;  2IB0 A;  2JD7 0;  2CN6 A;  3KXU A;  3PWQ C;  2V2M A;  4YVZ A;  4ML5 A;  2CLB A;  1YUZ A;  4ZJK A;  3F38 A;  5JKL G;  4ETR A;  5D8P A;  1MFR A;  3WNW A;  1OTK A;  2QQY A;  3HIU A;  2N02 A;  5GOU A;  4DAS A;  2UX1 A;  1F30 A;  5K53 A;  4ZKX A;  4LQV A;  2VXI A;  2CIH A;  3O7S A;  4TOH A;  1EUM A;  4TOF A;  2XGW A;  3W54 A;  4U3G A;  1Z6O A;  4ZL5 A;  4ISM A;  4II4 B;  3PW1 B;  3R2K A;  2C41 A;  3GE4 A;  3QHB A;  4TW3 A;  3RAV A;  2ZUR X;  4XKU A;  2V2N A;  4OYN A;  3LKD A;  5FFA A;  2WLU A;  3KA8 A;  2C2U A;  4RC6 B;  3ISE A;  1L8I A;  4TOC A;  5AXS A;  2YJK A;  2GYD A;  4WJG 4;  1JKU A;  1JKV A;  2BKC A;  4CYB A;  2ITB A;  4M34 A;  3UFB A;  4LYU A;  3PVY A;  4MUD A;  3RGD A;  5J8S A;  1QGH A;  1S3Q A;  4LQN A;  3F39 A;  4DYY A;  3OJ5 A;  4RC7 B;  3Q4R A;  3Q4O A;  3DBY A;  4LQH A;  3WVV A;  2IY4 A;  3V3K B;  1JGC A;  4EVB A;  2XKQ A;  2FG4 A;  5LG2 A;  4KVQ A;  4M33 A;  3F33 A;  4PGK A;  1B71 A;  4X0J A;  2X17 0;  2BW1 A;  3KA9 A;  1JRE A;  1NNQ A;  3Q4N A;  4IWJ A;  5JAC A;  4TOD A;  2WTL A;  1ZS3 A;  2VZB A;  3ISF A;  1RYT A;  4TO9 A;  4DYU A;  1VEQ A;  3FRS A;  3KHK A;  1JI5 A;  5LG8 A;  1BFR A;  1BCF A;  4CVS A;  3E1O A;  2WWX B;  3FI6 A;  3NP2 X;  3BVL A;  2PYB A;  2ZA8 A;  3BVF A;  1RCI A;  4EVE A;  3PVT A;  2FZF A;  3E2C A;  2FL0 A;  3SH6 A;  4CVT A;  2HR5 A;  3PVR A;  4PGI A;  1L8H A;  2CN7 A;  4Y08 A;  5D8R A;  2MGY A;  1S2Z A;  1NF4 A;  4CMY A;  3PWQ A;  4ZKW A;  4RC8 A;  3BVK A;  1GWG A;  3E1Q A;  2OKC A;  3F34 A;  2G4H A;  1BG7 A;  2C6R A;  3E6R A;  5HQO A;  1SQ3 A;  3PW8 A;  1AEW A;  1TK6 A;  3PW8 C;  2XJM A;  5FFC A;  4XKT A;  1RCD A;  4MXP A;  2WLA A;  1IES A;  2Z5R A;  3PZA A;  1TKO A;  4II4 A;  5FFE A;  1YV1 A;  1RCE A;  2V8T A;  4MKU A;  5JKM A;  3SHX A;  4LPM A;  1QYB A;  4MJY A;  1VJX A;  3C1Y A;  1VEI A;  3QHC A;  1H96 A;  3VNX A;  5K52 A;  1NF6 A;  5JDO B;  3PWF A;  3KX9 A;  3WVU A;  2AR0 A;  2ZG9 X;  1JI4 A;  1DPS A;  4KVR A;  5GU1 X;  4DE6 A;  4ISP A;  5JKM G;  5CMQ A;  4ERU A;  4DYZ A;  2CEI A;  3M6J A;  1DVB A;  2V2J A;  3GHQ A;  4YKH A;  3UNO A;  3E1J A;  2ZA6 A;  3E1M A;  4ZL6 A;  1RCC A;  4RC7 A;  1F33 A;  4XGS A;  4RC5 B;  1FHA A;  3EGM A;  4CVR A;  1ZUJ A;  1JTS A;  3L0M A;  5GN8 A;  4E6K A;  3PVY B;  3N6O A;  4W4K B;  3IS7 A;  3TA8 A;  1O9R A;  5CMR A;  2GYQ A;  3EZU A;  2HTN A;  3IQ1 A;  2ZA7 A;  1LKM A;  3HL1 A;  4PG1 A;  2V2R A;  2Y44 A;  2OC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...