1NF6A

X-ray structure of the desulfovibrio desulfuricans bacterioferritin: the diiron site in different catalytic states ("cycled" structure: reduced in solution and allowed to reoxidise before crystallisation)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
170
structure length
170
Chain Sequence
GNREDRKAKVIEVLNKARAMELHAIHQYMNQHYSLDDMDYGELAANMKLIAIDEMRHAENFAERIKELGGEPTTQKEGKVVTGQAVPVIYESDADQEDATIEAYSQFLKVCKEQGDIVTARLFERIIEEEQAHLTYYENIGSHIKNLGDTYLAKIAGTPSSTGTASKGFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords bacterioferritin
publication title The nature of the di-iron site in the bacterioferritin from Desulfovibrio desulfuricans
pubmed doi rcsb
molecule tags Iron storage/electron transport
total genus 77
structure length 170
sequence length 170
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2002-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1nf6A00
4RC6A 3BVFA 2OH3A 3O7RA 3QHBA 2XGWA 1F33A 1VLGA 3HL1A 1S2ZA 1DATA 3AJQA 4CVRA 3E1JA 3E1PA 1Z6OA 4TW3A 3F36A 2HR5A 1BCFA 4LQNA 1J30A 2V2MA 3KA9A 1JGCA 1LKPA 3F34A 5GN8B 2FFXJ 5I4JA 5J9VA 2YJJA 2ZA7A 5D8SA 4TOAA 1XZ3A 2V2PA 3PVTA 3NP2X 1YUZA 2W0OA 5GU1X 3UOFA 1RCDA 3UNOA 3R2MA 4ML5A 4RC7B 1NF6A 3PVRB 2ZG8X 4M33A 2WLUA 2ZURX 2Z90A 4LPJA 4CVSA 2CF7A 1JI5A 4YKHA 2CHIA 5CMRA 4LYXA 2IY4A 2QF9A 5HJFA 4IWKA 1DVBA 3IQ1A 1SOFA 3E1NA 5JACA 4DYXA 4CMYA 4DYZA 1KRQA 5HJHA 4DASA 2FKZA 3MPSA 3FVBA 1JYBA 4DYYA 2WLAA 3R2HA 2QQYA 5FFEA 2Z5RA 3PW1B 4R42A 5GN8A 3PVYA 5D8PA 1S3QA 2V2LA 4M34A 4ZKXA 3BVLA 5JKLA 1NF4A 3AJOA 4MN9A 2YW6A 2ZA8A 3UOIA 4TOCA 5JKMG 5D8YA 4II4A 3PVRA 2FHAA 5K52A 3F39A 3AF7X 4Y08A 3PWQC 1GWGA 2BK6A 1R03A 4Z5SA 4CVPA 5D8RA 1JTSA 3R2KA 4PG1A 5D8XA 2CLBA 1LKOA 2C6RA 5HQOA 3R2OA 3Q4NA 1IESA 3PW1A 1MOJA 2ITBA 3PW8C 1JKVA 1VELA 4OYNA 2GYDA 4ZTTA 1YV1A 2VXIA 3AK8A 4DE6A 2C2JA 4EVEA 4ZLWA 2V2NA 3OJ5A 3ES3A 4RC5B 5FEJA 4QUWA 1LB3A 2V2OA 4E6KA 2FG8A 2D5KA 3Q4RA 1TK6A 2JD70 2V15A 3PZAA 3AF9X 2JD80 3PVYB 4TOGA 4TODA 3QHCA 3HIUA 4P18A 2CN7A 2FG4A 2Z5QA 1JKUA 5LG8A 3SHXA 3RGDA 2X170 3AK9A 2XJNA 1L8IA 3FI6A 3PWQA 4II4B 5FFAA 2C2FA 1QGHA 3NP0X 3R2LA 2XKQA 3E6SA 3AF8X 4KVQA 5D8OA 4TOFA 2GS4A 2G4HA 2ZA6A 2GYQA 3RE7A 1TKOA 2XJMA 3WVUA 4ZL5A 4PG0A 3R2RA 4RC5A 4ZJKA 4ZKHA 2BJYA 3PW8A 3RD0A 3F32A 2PYBA 4XKTA 3F35A 4MY7A 5JKMA 1SQ3A 5CZUA 2CN6A 4AM5A 4AM2A 1L8HA 1BFRA 1UMNA 4DZ0A 3QZ3A 3R2SA 1VJXA 3KA8A 1S30A 2C41A 3TA8A 3ISFA 5J8WA 4LPMA 2VXXA 3AJPA 3BVIA 1RCIA 3ERZA 3E1OA 3RBCA 1H96A 4KVSA 4LQVA 4ISMA 4ITTA 2CEIA 2UX1A 4DI0A 4EVBA 1MFRA 1N1QA 1O9IA 4RC8A 3OGHA 4REUA 4U3GA 4XKSA 2YJKA 1UVHA 5GU2X 3A68A 1RCGA 3E1MA 3Q4OA 3F38A 3GVYA 5LS9A 3EGMA 2IB0A 4AM4A 3IS7A 1O9RA 3SE1A 3KA4A 4PGIA 1XZ1A 1FHAA 3KXUA 2V2JA 5LG2A 4MJYA 1JREA 1JI4A 2CHPA 2V2IA 3KX9A 3IS8A 5GOUA 1AEWA 2RBDA 2FJCA 1ZS3A 4DYUA 3BKNA 4ISPA 3F37A 2Z6MA 1Z4AA 3E2CA 5AXSA 3E1QA 3SIDA 2CIHA 4A25A 5J93A 2C2UA 4CYAA 2F7NA 1VEIA 1TKPA 1F30A 4M32A 1B71A 4LQJA 3BVKA 3E6RA 2Z5PA 5E1UA 3EZUA 3H7GA 4TOEA 1BG7A 5C6FA 4TOBA 2ZG9X 3RAVA 3T9JA 3FSEA 4MKUA 5GU0X 1HRSA 2V2RA 4CMYV 4CVTA 1RCEA 2JD60 1RCCA 5E2DA 3WNWA 1YUXA 1EUMA 5FFCA 5FFDA 3QD8A 3WVVA 2V2SA 5IX6A 1VEQA 2IU2A 3O7SA 4TOHA 3BVEA 4XGSA 1ZUJA 4ERUA 5LBHA 4LYUA 4MUDA 3PWFA 3Q4QA 4CY9A 1Z6OM 3NOZX 4LPNA 5GU3X 1OTKA 2Y3QA 3KA6A 2YW7A 3WVWA 4ETRA 5CMQA 3GHQA 2VZBA 1NFVA 4RC6B 1DPSA 4ZKWA 4EVDA 2ZG7X 3VNXA 4IXKA 1IERA 1QYBA 3KWOA 4CYBA 1JIGA 3EZ0A 3F33A 3GE4A 4M35A 5J8SA 1NNQA 3QVDA 2XJOA 5ERKA 4ZL6A 3ISEA 4ZMCA 4RC7A 5FFBA 2BKCA 1RYTA 3QB9A 2HTNA 5JKLG 3KA3A 2OC5A 2BW1A 4KVRA 1TJOA 3SH6A 4XKUA 4LQHA 4PGKA 3E1LA 2FL0A 3U90A 2FZFA 5D8QA 3A9QA 2WTLA 4TO9A 4EVCA 3PVTB 5ERJA 4ITWA 4Z3BA 2CLUA 5K53A 4IWJA 3BT5A 1LKMA
chains in the Genus database with same CATH superfamily
4RC6A 3BVFA 2OH3A 3O7RA 3QHBA 2XGWA 1F33A 1VLGA 3HL1A 1S2ZA 1DATA 3AJQA 4CVRA 3E1JA 3E1PA 1Z6OA 4TW3A 3F36A 2Y44A 3M6JA 2HR5A 1BCFA 4LQNA 1J30A 2V2MA 3KA9A 5JDOB 1JGCA 1LKPA 3F34A 5GN8B 2FFXJ 5I4JA 5J9VA 2YJJA 2ZA7A 5D8SA 4YVZA 4TOAA 1XZ3A 2V2PA 3PVTA 3NP2X 1YUZA 2W0OA 5GU1X 3UOFA 1RCDA 3UNOA 3R2MA 4ML5A 4RC7B 1NF6A 3PVRB 2ZG8X 4M33A 2WLUA 2ZURX 2Z90A 4LPJA 4CVSA 2CF7A 1JI5A 4YKHA 2CHIA 5CMRA 4LYXA 2IY4A 2QF9A 5HJFA 4IWKA 1DVBA 4E40A 3FRSA 3IQ1A 1SOFA 3E1NA 5JACA 4DYXA 4CMYA 4DYZA 1KRQA 5HJHA 4DASA 2FKZA 3MPSA 3FVBA 1JYBA 4DYYA 4YXMA 2WLAA 3R2HA 2QQYA 5FFEA 5JDOA 2Z5RA 3PW1B 4R42A 5GN8A 3PVYA 5D8PA 3KDQA 1S3QA 2V2LA 4M34A 4ZKXA 3BVLA 5JKLA 1NF4A 3AJOA 4MN9A 2YW6A 2ZA8A 3UOIA 4TOCA 5JKMG 5D8YA 4II4A 3PVRA 2FHAA 5K52A 3F39A 3AF7X 4Y08A 3PWQC 1GWGA 2BK6A 1R03A 4Z5SA 4CVPA 5D8RA 1JTSA 3R2KA 4PG1A 4KXRB 3GGYA 5D8XA 2CLBA 1LKOA 2C6RA 5HQOA 3R2OA 3Q4NA 1IESA 3PW1A 1MOJA 2ITBA 3PW8C 1JKVA 1VELA 3V3KB 4OYNA 2GYDA 4ZTTA 1YV1A 2VXIA 3AK8A 4DE6A 3JZAB 2C2JA 4EVEA 4ZLWA 2V2NA 3GGZA 3LKDA 3ES3A 3OJ5A 4RC5B 5FEJA 4QUWA 1LB3A 3C21A 2V2OA 4E6KA 3L0MA 2FG8A 2D5KA 3Q4RA 1TK6A 2JD70 2V15A 3PZAA 3AF9X 2JD80 3PVYB 4TOGA 4TODA 3QHCA 3HIUA 4P18A 2CN7A 2FG4A 2Z5QA 1JKUA 5LG8A 3SHXA 3RGDA 2X170 3AK9A 2XJNA 2G38B 4W4LB 1L8IA 3FI6A 3PWQA 4II4B 5FFAA 2C2FA 1QGHA 2WWXB 3NP0X 3R2LA 2XKQA 3E6SA 3AF8X 4KVQA 5D8OA 4TOFA 2GS4A 2G4HA 2ZA6A 2GYQA 3RE7A 1TKOA 2XJMA 3WVUA 4ZL5A 4YXJA 4PG0A 3R2RA 4RC5A 4ZJKA 4ZKHA 2BJYA 3PW8A 3RD0A 3F32A 5HU6D 2PYBA 4XKTA 3F35A 4MY7A 5JKMA 1SQ3A 5CZUA 2CN6A 4AM5A 4AM2A 1L8HA 1BFRA 1UMNA 4DZ0A 3QZ3A 2MGYA 2V8TA 3DBYA 3R2SA 1VJXA 3KA8A 1S30A 2C41A 3TA8A 3ISFA 5J8WA 3D19A 3C1ZA 4LPMA 2VXXA 3AJPA 3BVIA 1RCIA 3ERZA 3E1OA 3RBCA 1H96A 4KVSA 4LQVA 2AR0A 4ISMA 4ITTA 2CEIA 2UX1A 4DI0A 4EVBA 1MFRA 1N1QA 1O9IA 4RC8A 3OGHA 4REUA 4U3GA 4XKSA 2YJKA 1UVHA 5GU2X 3A68A 3N6OA 1RCGA 3E1MA 3Q4OA 3VV9A 3F38A 3GVYA 5LS9A 3EGMA 4W4KB 2IB0A 4AM4A 3JZ9A 3IS7A 1O9RA 3SE1A 3KA4A 4PGIA 1XZ1A 1FHAA 3KXUA 2V2JA 5LG2A 4MJYA 1JREA 1JI4A 2CHPA 2V2IA 3KX9A 3IS8A 5GOUA 1AEWA 2RBDA 2FJCA 1ZS3A 4DYUA 3BKNA 4ISPA 3F37A 2Z6MA 1Z4AA 3E2CA 5AXSA 3E1QA 3SIDA 2CIHA 4A25A 5J93A 2C2UA 4CYAA 2F7NA 1VEIA 1TKPA 1F30A 4M32A 1B71A 4LQJA 3BVKA 3E6RA 2Z5PA 5E1UA 3EZUA 3H7GA 4TOEA 1BG7A 5C6FA 4TOBA 2ZG9X 3RAVA 3T9JA 3FSEA 4MKUA 5GU0X 1HRSA 2V2RA 4CMYV 4CVTA 2N02A 1RCEA 2JD60 1RCCA 5E2DA 3WNWA 1YUXA 3C23A 3FRRA 1EUMA 5FFCA 5FFDA 3QD8A 3WVVA 3KHKA 2V2SA 2OKCA 5IX6A 1VEQA 2IU2A 3O7SA 4TOHA 3BVEA 3VVAA 4XGSA 3UFBA 1ZUJA 4ERUA 5LBHA 4LYUA 4MUDA 3PWFA 3Q4QA 4MXPA 4CY9A 1Z6OM 3NOZX 4LPNA 5GU3X 1OTKA 2Y3QA 3KA6A 2YW7A 3WVWA 4ETRA 5CMQA 3GHQA 2VZBA 1NFVA 3W54A 4RC6B 1DPSA 4ZKWA 4EVDA 2ZG7X 3VNXA 4IXKA 1IERA 1QYBA 3KWOA 4CYBA 1JIGA 3EZ0A 3F33A 2CWLA 3GE4A 4M35A 5J8SA 1NNQA 3QVDA 2XJOA 5ERKA 4ZL6A 3ISEA 4ZMCA 4RC7A 5FFBA 2BKCA 1RYTA 3QB9A 2HTNA 5JKLG 3KA3A 2OC5A 2BW1A 4KVRA 1TJOA 3SH6A 4XKUA 4LQHA 4PGKA 3E1LA 2FL0A 3U90A 2FZFA 3C1YA 5D8QA 3A9QA 2WTLA 4TO9A 4EVCA 3PVTB 5ERJA 4ITWA 4Z3BA 2CLUA 5K53A 2V8UA 4X0JA 4IWJA 4WJG4 3BT5A 1LKMA
chains in the Genus database with same CATH topology
4RC6A 3BVFA 2OH3A 3O7RA 3QHBA 2XGWA 1F33A 1VLGA 3HL1A 1S2ZA 1DATA 3AJQA 4CVRA 3E1JA 3E1PA 1Z6OA 4TW3A 3F36A 2Y44A 3M6JA 2HR5A 1BCFA 4LQNA 1J30A 2V2MA 3KA9A 5JDOB 1JGCA 1LKPA 3F34A 5GN8B 2FFXJ 5I4JA 5J9VA 2YJJA 2ZA7A 5D8SA 4YVZA 4TOAA 1XZ3A 2V2PA 3PVTA 3NP2X 1YUZA 2W0OA 5GU1X 3UOFA 1RCDA 3UNOA 3R2MA 4ML5A 4RC7B 1NF6A 3PVRB 2ZG8X 4M33A 2WLUA 2ZURX 2Z90A 4LPJA 4CVSA 2CF7A 1JI5A 4YKHA 2CHIA 5CMRA 4LYXA 2IY4A 2QF9A 5HJFA 4IWKA 1DVBA 4E40A 3FRSA 3IQ1A 1SOFA 3E1NA 5JACA 4DYXA 4CMYA 4DYZA 1KRQA 5HJHA 4DASA 2FKZA 3MPSA 3FVBA 1JYBA 4DYYA 4YXMA 2WLAA 3R2HA 2QQYA 5FFEA 5JDOA 2Z5RA 3PW1B 4R42A 5GN8A 3PVYA 5D8PA 3KDQA 1S3QA 2V2LA 4M34A 4ZKXA 3BVLA 5JKLA 1NF4A 3AJOA 4MN9A 2YW6A 2ZA8A 3UOIA 4TOCA 5JKMG 5D8YA 4II4A 3PVRA 2FHAA 5K52A 3F39A 3AF7X 4Y08A 3PWQC 1GWGA 2BK6A 1R03A 4Z5SA 4CVPA 5D8RA 1JTSA 3R2KA 4PG1A 4KXRB 3GGYA 5D8XA 2CLBA 1LKOA 2C6RA 5HQOA 3R2OA 3Q4NA 1IESA 3PW1A 1MOJA 2ITBA 3PW8C 1JKVA 1VELA 3V3KB 4OYNA 2GYDA 4ZTTA 1YV1A 2VXIA 3AK8A 4DE6A 3JZAB 2C2JA 4EVEA 4ZLWA 2V2NA 3GGZA 3LKDA 3ES3A 3OJ5A 4RC5B 5FEJA 4QUWA 1LB3A 3C21A 2V2OA 4E6KA 3L0MA 2FG8A 2D5KA 3Q4RA 1TK6A 2JD70 2V15A 3PZAA 3AF9X 2JD80 3PVYB 4TOGA 4TODA 3QHCA 3HIUA 4P18A 2CN7A 2FG4A 2Z5QA 1JKUA 5LG8A 3SHXA 3RGDA 2X170 3AK9A 2XJNA 2G38B 4W4LB 1L8IA 3FI6A 3PWQA 4II4B 5FFAA 2C2FA 1QGHA 2WWXB 3NP0X 3R2LA 2XKQA 3E6SA 3AF8X 4KVQA 5D8OA 4TOFA 2GS4A 2G4HA 2ZA6A 2GYQA 3RE7A 1TKOA 2XJMA 3WVUA 4ZL5A 4YXJA 4PG0A 3R2RA 4RC5A 4ZJKA 4ZKHA 2BJYA 3PW8A 3RD0A 3F32A 5HU6D 2PYBA 4XKTA 3F35A 4MY7A 5JKMA 1SQ3A 5CZUA 2CN6A 4AM5A 4AM2A 1L8HA 1BFRA 1UMNA 4DZ0A 3QZ3A 2MGYA 2V8TA 3DBYA 3R2SA 1VJXA 3KA8A 1S30A 2C41A 3TA8A 3ISFA 5J8WA 3D19A 3C1ZA 4LPMA 2VXXA 3AJPA 3BVIA 1RCIA 3ERZA 3E1OA 3RBCA 1H96A 4KVSA 4LQVA 2AR0A 4ISMA 4ITTA 2CEIA 2UX1A 4DI0A 4EVBA 1MFRA 1N1QA 1O9IA 4RC8A 3OGHA 4REUA 4U3GA 4XKSA 2YJKA 1UVHA 5GU2X 3A68A 3N6OA 1RCGA 3E1MA 3Q4OA 3VV9A 3F38A 3GVYA 5LS9A 3EGMA 4W4KB 2IB0A 4AM4A 3JZ9A 3IS7A 1O9RA 3SE1A 3KA4A 4PGIA 1XZ1A 1FHAA 3KXUA 2V2JA 5LG2A 4MJYA 1JREA 1JI4A 2CHPA 2V2IA 3KX9A 3IS8A 5GOUA 1AEWA 2RBDA 2FJCA 1ZS3A 4DYUA 3BKNA 4ISPA 3F37A 2Z6MA 1Z4AA 3E2CA 5AXSA 3E1QA 3SIDA 2CIHA 4A25A 5J93A 2C2UA 4CYAA 2F7NA 1VEIA 1TKPA 1F30A 4M32A 1B71A 4LQJA 3BVKA 3E6RA 2Z5PA 5E1UA 3EZUA 3H7GA 4TOEA 1BG7A 5C6FA 4TOBA 2ZG9X 3RAVA 3T9JA 3FSEA 4MKUA 5GU0X 1HRSA 2V2RA 4CMYV 4CVTA 2N02A 1RCEA 2JD60 1RCCA 5E2DA 3WNWA 1YUXA 3C23A 3FRRA 1EUMA 5FFCA 5FFDA 3QD8A 3WVVA 3KHKA 2V2SA 2OKCA 5IX6A 1VEQA 2IU2A 3O7SA 4TOHA 3BVEA 3VVAA 4XGSA 3UFBA 1ZUJA 4ERUA 5LBHA 4LYUA 4MUDA 3PWFA 3Q4QA 4MXPA 4CY9A 1Z6OM 3NOZX 4LPNA 5GU3X 1OTKA 2Y3QA 3KA6A 2YW7A 3WVWA 4ETRA 5CMQA 3GHQA 2VZBA 1NFVA 3W54A 4RC6B 1DPSA 4ZKWA 4EVDA 2ZG7X 3VNXA 4IXKA 1IERA 1QYBA 3KWOA 4CYBA 1JIGA 3EZ0A 3F33A 2CWLA 3GE4A 4M35A 5J8SA 1NNQA 3QVDA 2XJOA 5ERKA 4ZL6A 3ISEA 4ZMCA 4RC7A 5FFBA 2BKCA 1RYTA 3QB9A 2HTNA 5JKLG 3KA3A 2OC5A 2BW1A 4KVRA 1TJOA 3SH6A 4XKUA 4LQHA 4PGKA 3E1LA 2FL0A 3U90A 2FZFA 3C1YA 5D8QA 3A9QA 2WTLA 4TO9A 4EVCA 3PVTB 5ERJA 4ITWA 4Z3BA 2CLUA 5K53A 2V8UA 4X0JA 4IWJA 4WJG4 3BT5A 1LKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RC6 A;  3BVF A;  2OH3 A;  3O7R A;  3QHB A;  2XGW A;  1F33 A;  1VLG A;  3HL1 A;  1S2Z A;  1DAT A;  3AJQ A;  4CVR A;  3E1J A;  3E1P A;  1Z6O A;  4TW3 A;  3F36 A;  2HR5 A;  1BCF A;  4LQN A;  1J30 A;  2V2M A;  3KA9 A;  1JGC A;  1LKP A;  3F34 A;  5GN8 B;  2FFX J;  5I4J A;  5J9V A;  2YJJ A;  2ZA7 A;  5D8S A;  4TOA A;  1XZ3 A;  2V2P A;  3PVT A;  3NP2 X;  1YUZ A;  2W0O A;  5GU1 X;  3UOF A;  1RCD A;  3UNO A;  3R2M A;  4ML5 A;  4RC7 B;  1NF6 A;  3PVR B;  2ZG8 X;  4M33 A;  2WLU A;  2ZUR X;  2Z90 A;  4LPJ A;  4CVS A;  2CF7 A;  1JI5 A;  4YKH A;  2CHI A;  5CMR A;  4LYX A;  2IY4 A;  2QF9 A;  5HJF A;  4IWK A;  1DVB A;  3IQ1 A;  1SOF A;  3E1N A;  5JAC A;  4DYX A;  4CMY A;  4DYZ A;  1KRQ A;  5HJH A;  4DAS A;  2FKZ A;  3MPS A;  3FVB A;  1JYB A;  4DYY A;  2WLA A;  3R2H A;  2QQY A;  5FFE A;  2Z5R A;  3PW1 B;  4R42 A;  5GN8 A;  3PVY A;  5D8P A;  1S3Q A;  2V2L A;  4M34 A;  4ZKX A;  3BVL A;  5JKL A;  1NF4 A;  3AJO A;  4MN9 A;  2YW6 A;  2ZA8 A;  3UOI A;  4TOC A;  5JKM G;  5D8Y A;  4II4 A;  3PVR A;  2FHA A;  5K52 A;  3F39 A;  3AF7 X;  4Y08 A;  3PWQ C;  1GWG A;  2BK6 A;  1R03 A;  4Z5S A;  4CVP A;  5D8R A;  1JTS A;  3R2K A;  4PG1 A;  5D8X A;  2CLB A;  1LKO A;  2C6R A;  5HQO A;  3R2O A;  3Q4N A;  1IES A;  3PW1 A;  1MOJ A;  2ITB A;  3PW8 C;  1JKV A;  1VEL A;  4OYN A;  2GYD A;  4ZTT A;  1YV1 A;  2VXI A;  3AK8 A;  4DE6 A;  2C2J A;  4EVE A;  4ZLW A;  2V2N A;  3OJ5 A;  3ES3 A;  4RC5 B;  5FEJ A;  4QUW A;  1LB3 A;  2V2O A;  4E6K A;  2FG8 A;  2D5K A;  3Q4R A;  1TK6 A;  2JD7 0;  2V15 A;  3PZA A;  3AF9 X;  2JD8 0;  3PVY B;  4TOG A;  4TOD A;  3QHC A;  3HIU A;  4P18 A;  2CN7 A;  2FG4 A;  2Z5Q A;  1JKU A;  5LG8 A;  3SHX A;  3RGD A;  2X17 0;  3AK9 A;  2XJN A;  1L8I A;  3FI6 A;  3PWQ A;  4II4 B;  5FFA A;  2C2F A;  1QGH A;  3NP0 X;  3R2L A;  2XKQ A;  3E6S A;  3AF8 X;  4KVQ A;  5D8O A;  4TOF A;  2GS4 A;  2G4H A;  2ZA6 A;  2GYQ A;  3RE7 A;  1TKO A;  2XJM A;  3WVU A;  4ZL5 A;  4PG0 A;  3R2R A;  4RC5 A;  4ZJK A;  4ZKH A;  2BJY A;  3PW8 A;  3RD0 A;  3F32 A;  2PYB A;  4XKT A;  3F35 A;  4MY7 A;  5JKM A;  1SQ3 A;  5CZU A;  2CN6 A;  4AM5 A;  4AM2 A;  1L8H A;  1BFR A;  1UMN A;  4DZ0 A;  3QZ3 A;  3R2S A;  1VJX A;  3KA8 A;  1S30 A;  2C41 A;  3TA8 A;  3ISF A;  5J8W A;  4LPM A;  2VXX A;  3AJP A;  3BVI A;  1RCI A;  3ERZ A;  3E1O A;  3RBC A;  1H96 A;  4KVS A;  4LQV A;  4ISM A;  4ITT A;  2CEI A;  2UX1 A;  4DI0 A;  4EVB A;  1MFR A;  1N1Q A;  1O9I A;  4RC8 A;  3OGH A;  4REU A;  4U3G A;  4XKS A;  2YJK A;  1UVH A;  5GU2 X;  3A68 A;  1RCG A;  3E1M A;  3Q4O A;  3F38 A;  3GVY A;  5LS9 A;  3EGM A;  2IB0 A;  4AM4 A;  3IS7 A;  1O9R A;  3SE1 A;  3KA4 A;  4PGI A;  1XZ1 A;  1FHA A;  3KXU A;  2V2J A;  5LG2 A;  4MJY A;  1JRE A;  1JI4 A;  2CHP A;  2V2I A;  3KX9 A;  3IS8 A;  5GOU A;  1AEW A;  2RBD A;  2FJC A;  1ZS3 A;  4DYU A;  3BKN A;  4ISP A;  3F37 A;  2Z6M A;  1Z4A A;  3E2C A;  5AXS A;  3E1Q A;  3SID A;  2CIH A;  4A25 A;  5J93 A;  2C2U A;  4CYA A;  2F7N A;  1VEI A;  1TKP A;  1F30 A;  4M32 A;  1B71 A;  4LQJ A;  3BVK A;  3E6R A;  2Z5P A;  5E1U A;  3EZU A;  3H7G A;  4TOE A;  1BG7 A;  5C6F A;  4TOB A;  2ZG9 X;  3RAV A;  3T9J A;  3FSE A;  4MKU A;  5GU0 X;  1HRS A;  2V2R A;  4CMY V;  4CVT A;  1RCE A;  2JD6 0;  1RCC A;  5E2D A;  3WNW A;  1YUX A;  1EUM A;  5FFC A;  5FFD A;  3QD8 A;  3WVV A;  2V2S A;  5IX6 A;  1VEQ A;  2IU2 A;  3O7S A;  4TOH A;  3BVE A;  4XGS A;  1ZUJ A;  4ERU A;  5LBH A;  4LYU A;  4MUD A;  3PWF A;  3Q4Q A;  4CY9 A;  1Z6O M;  3NOZ X;  4LPN A;  5GU3 X;  1OTK A;  2Y3Q A;  3KA6 A;  2YW7 A;  3WVW A;  4ETR A;  5CMQ A;  3GHQ A;  2VZB A;  1NFV A;  4RC6 B;  1DPS A;  4ZKW A;  4EVD A;  2ZG7 X;  3VNX A;  4IXK A;  1IER A;  1QYB A;  3KWO A;  4CYB A;  1JIG A;  3EZ0 A;  3F33 A;  3GE4 A;  4M35 A;  5J8S A;  1NNQ A;  3QVD A;  2XJO A;  5ERK A;  4ZL6 A;  3ISE A;  4ZMC A;  4RC7 A;  5FFB A;  2BKC A;  1RYT A;  3QB9 A;  2HTN A;  5JKL G;  3KA3 A;  2OC5 A;  2BW1 A;  4KVR A;  1TJO A;  3SH6 A;  4XKU A;  4LQH A;  4PGK A;  3E1L A;  2FL0 A;  3U90 A;  2FZF A;  5D8Q A;  3A9Q A;  2WTL A;  4TO9 A;  4EVC A;  3PVT B;  5ERJ A;  4ITW A;  4Z3B A;  2CLU A;  5K53 A;  4IWJ A;  3BT5 A;  1LKM A; 
#chains in the Genus database with same CATH topology
 4RC6 A;  3BVF A;  2OH3 A;  3O7R A;  3QHB A;  2XGW A;  1F33 A;  1VLG A;  3HL1 A;  1S2Z A;  1DAT A;  3AJQ A;  4CVR A;  3E1J A;  3E1P A;  1Z6O A;  4TW3 A;  3F36 A;  2Y44 A;  3M6J A;  2HR5 A;  1BCF A;  4LQN A;  1J30 A;  2V2M A;  3KA9 A;  5JDO B;  1JGC A;  1LKP A;  3F34 A;  5GN8 B;  2FFX J;  5I4J A;  5J9V A;  2YJJ A;  2ZA7 A;  5D8S A;  4YVZ A;  4TOA A;  1XZ3 A;  2V2P A;  3PVT A;  3NP2 X;  1YUZ A;  2W0O A;  5GU1 X;  3UOF A;  1RCD A;  3UNO A;  3R2M A;  4ML5 A;  4RC7 B;  1NF6 A;  3PVR B;  2ZG8 X;  4M33 A;  2WLU A;  2ZUR X;  2Z90 A;  4LPJ A;  4CVS A;  2CF7 A;  1JI5 A;  4YKH A;  2CHI A;  5CMR A;  4LYX A;  2IY4 A;  2QF9 A;  5HJF A;  4IWK A;  1DVB A;  4E40 A;  3FRS A;  3IQ1 A;  1SOF A;  3E1N A;  5JAC A;  4DYX A;  4CMY A;  4DYZ A;  1KRQ A;  5HJH A;  4DAS A;  2FKZ A;  3MPS A;  3FVB A;  1JYB A;  4DYY A;  4YXM A;  2WLA A;  3R2H A;  2QQY A;  5FFE A;  5JDO A;  2Z5R A;  3PW1 B;  4R42 A;  5GN8 A;  3PVY A;  5D8P A;  3KDQ A;  1S3Q A;  2V2L A;  4M34 A;  4ZKX A;  3BVL A;  5JKL A;  1NF4 A;  3AJO A;  4MN9 A;  2YW6 A;  2ZA8 A;  3UOI A;  4TOC A;  5JKM G;  5D8Y A;  4II4 A;  3PVR A;  2FHA A;  5K52 A;  3F39 A;  3AF7 X;  4Y08 A;  3PWQ C;  1GWG A;  2BK6 A;  1R03 A;  4Z5S A;  4CVP A;  5D8R A;  1JTS A;  3R2K A;  4PG1 A;  4KXR B;  3GGY A;  5D8X A;  2CLB A;  1LKO A;  2C6R A;  5HQO A;  3R2O A;  3Q4N A;  1IES A;  3PW1 A;  1MOJ A;  2ITB A;  3PW8 C;  1JKV A;  1VEL A;  3V3K B;  4OYN A;  2GYD A;  4ZTT A;  1YV1 A;  2VXI A;  3AK8 A;  4DE6 A;  3JZA B;  2C2J A;  4EVE A;  4ZLW A;  2V2N A;  3GGZ A;  3LKD A;  3ES3 A;  3OJ5 A;  4RC5 B;  5FEJ A;  4QUW A;  1LB3 A;  3C21 A;  2V2O A;  4E6K A;  3L0M A;  2FG8 A;  2D5K A;  3Q4R A;  1TK6 A;  2JD7 0;  2V15 A;  3PZA A;  3AF9 X;  2JD8 0;  3PVY B;  4TOG A;  4TOD A;  3QHC A;  3HIU A;  4P18 A;  2CN7 A;  2FG4 A;  2Z5Q A;  1JKU A;  5LG8 A;  3SHX A;  3RGD A;  2X17 0;  3AK9 A;  2XJN A;  2G38 B;  4W4L B;  1L8I A;  3FI6 A;  3PWQ A;  4II4 B;  5FFA A;  2C2F A;  1QGH A;  2WWX B;  3NP0 X;  3R2L A;  2XKQ A;  3E6S A;  3AF8 X;  4KVQ A;  5D8O A;  4TOF A;  2GS4 A;  2G4H A;  2ZA6 A;  2GYQ A;  3RE7 A;  1TKO A;  2XJM A;  3WVU A;  4ZL5 A;  4YXJ A;  4PG0 A;  3R2R A;  4RC5 A;  4ZJK A;  4ZKH A;  2BJY A;  3PW8 A;  3RD0 A;  3F32 A;  5HU6 D;  2PYB A;  4XKT A;  3F35 A;  4MY7 A;  5JKM A;  1SQ3 A;  5CZU A;  2CN6 A;  4AM5 A;  4AM2 A;  1L8H A;  1BFR A;  1UMN A;  4DZ0 A;  3QZ3 A;  2MGY A;  2V8T A;  3DBY A;  3R2S A;  1VJX A;  3KA8 A;  1S30 A;  2C41 A;  3TA8 A;  3ISF A;  5J8W A;  3D19 A;  3C1Z A;  4LPM A;  2VXX A;  3AJP A;  3BVI A;  1RCI A;  3ERZ A;  3E1O A;  3RBC A;  1H96 A;  4KVS A;  4LQV A;  2AR0 A;  4ISM A;  4ITT A;  2CEI A;  2UX1 A;  4DI0 A;  4EVB A;  1MFR A;  1N1Q A;  1O9I A;  4RC8 A;  3OGH A;  4REU A;  4U3G A;  4XKS A;  2YJK A;  1UVH A;  5GU2 X;  3A68 A;  3N6O A;  1RCG A;  3E1M A;  3Q4O A;  3VV9 A;  3F38 A;  3GVY A;  5LS9 A;  3EGM A;  4W4K B;  2IB0 A;  4AM4 A;  3JZ9 A;  3IS7 A;  1O9R A;  3SE1 A;  3KA4 A;  4PGI A;  1XZ1 A;  1FHA A;  3KXU A;  2V2J A;  5LG2 A;  4MJY A;  1JRE A;  1JI4 A;  2CHP A;  2V2I A;  3KX9 A;  3IS8 A;  5GOU A;  1AEW A;  2RBD A;  2FJC A;  1ZS3 A;  4DYU A;  3BKN A;  4ISP A;  3F37 A;  2Z6M A;  1Z4A A;  3E2C A;  5AXS A;  3E1Q A;  3SID A;  2CIH A;  4A25 A;  5J93 A;  2C2U A;  4CYA A;  2F7N A;  1VEI A;  1TKP A;  1F30 A;  4M32 A;  1B71 A;  4LQJ A;  3BVK A;  3E6R A;  2Z5P A;  5E1U A;  3EZU A;  3H7G A;  4TOE A;  1BG7 A;  5C6F A;  4TOB A;  2ZG9 X;  3RAV A;  3T9J A;  3FSE A;  4MKU A;  5GU0 X;  1HRS A;  2V2R A;  4CMY V;  4CVT A;  2N02 A;  1RCE A;  2JD6 0;  1RCC A;  5E2D A;  3WNW A;  1YUX A;  3C23 A;  3FRR A;  1EUM A;  5FFC A;  5FFD A;  3QD8 A;  3WVV A;  3KHK A;  2V2S A;  2OKC A;  5IX6 A;  1VEQ A;  2IU2 A;  3O7S A;  4TOH A;  3BVE A;  3VVA A;  4XGS A;  3UFB A;  1ZUJ A;  4ERU A;  5LBH A;  4LYU A;  4MUD A;  3PWF A;  3Q4Q A;  4MXP A;  4CY9 A;  1Z6O M;  3NOZ X;  4LPN A;  5GU3 X;  1OTK A;  2Y3Q A;  3KA6 A;  2YW7 A;  3WVW A;  4ETR A;  5CMQ A;  3GHQ A;  2VZB A;  1NFV A;  3W54 A;  4RC6 B;  1DPS A;  4ZKW A;  4EVD A;  2ZG7 X;  3VNX A;  4IXK A;  1IER A;  1QYB A;  3KWO A;  4CYB A;  1JIG A;  3EZ0 A;  3F33 A;  2CWL A;  3GE4 A;  4M35 A;  5J8S A;  1NNQ A;  3QVD A;  2XJO A;  5ERK A;  4ZL6 A;  3ISE A;  4ZMC A;  4RC7 A;  5FFB A;  2BKC A;  1RYT A;  3QB9 A;  2HTN A;  5JKL G;  3KA3 A;  2OC5 A;  2BW1 A;  4KVR A;  1TJO A;  3SH6 A;  4XKU A;  4LQH A;  4PGK A;  3E1L A;  2FL0 A;  3U90 A;  2FZF A;  3C1Y A;  5D8Q A;  3A9Q A;  2WTL A;  4TO9 A;  4EVC A;  3PVT B;  5ERJ A;  4ITW A;  4Z3B A;  2CLU A;  5K53 A;  2V8U A;  4X0J A;  4IWJ A;  4WJG 4;  3BT5 A;  1LKM A; 
#chains in the Genus database with same CATH homology
 4RC6 A;  3BVF A;  2OH3 A;  3O7R A;  3QHB A;  2XGW A;  1F33 A;  1VLG A;  3HL1 A;  1S2Z A;  1DAT A;  3AJQ A;  4CVR A;  3E1J A;  3E1P A;  1Z6O A;  4TW3 A;  3F36 A;  2Y44 A;  3M6J A;  2HR5 A;  1BCF A;  4LQN A;  1J30 A;  2V2M A;  3KA9 A;  5JDO B;  1JGC A;  1LKP A;  3F34 A;  5GN8 B;  2FFX J;  5I4J A;  5J9V A;  2YJJ A;  2ZA7 A;  5D8S A;  4YVZ A;  4TOA A;  1XZ3 A;  2V2P A;  3PVT A;  3NP2 X;  1YUZ A;  2W0O A;  5GU1 X;  3UOF A;  1RCD A;  3UNO A;  3R2M A;  4ML5 A;  4RC7 B;  1NF6 A;  3PVR B;  2ZG8 X;  4M33 A;  2WLU A;  2ZUR X;  2Z90 A;  4LPJ A;  4CVS A;  2CF7 A;  1JI5 A;  4YKH A;  2CHI A;  5CMR A;  4LYX A;  2IY4 A;  2QF9 A;  5HJF A;  4IWK A;  1DVB A;  4E40 A;  3FRS A;  3IQ1 A;  1SOF A;  3E1N A;  5JAC A;  4DYX A;  4CMY A;  4DYZ A;  1KRQ A;  5HJH A;  4DAS A;  2FKZ A;  3MPS A;  3FVB A;  1JYB A;  4DYY A;  4YXM A;  2WLA A;  3R2H A;  2QQY A;  5FFE A;  5JDO A;  2Z5R A;  3PW1 B;  4R42 A;  5GN8 A;  3PVY A;  5D8P A;  3KDQ A;  1S3Q A;  2V2L A;  4M34 A;  4ZKX A;  3BVL A;  5JKL A;  1NF4 A;  3AJO A;  4MN9 A;  2YW6 A;  2ZA8 A;  3UOI A;  4TOC A;  5JKM G;  5D8Y A;  4II4 A;  3PVR A;  2FHA A;  5K52 A;  3F39 A;  3AF7 X;  4Y08 A;  3PWQ C;  1GWG A;  2BK6 A;  1R03 A;  4Z5S A;  4CVP A;  5D8R A;  1JTS A;  3R2K A;  4PG1 A;  4KXR B;  3GGY A;  5D8X A;  2CLB A;  1LKO A;  2C6R A;  5HQO A;  3R2O A;  3Q4N A;  1IES A;  3PW1 A;  1MOJ A;  2ITB A;  3PW8 C;  1JKV A;  1VEL A;  3V3K B;  4OYN A;  2GYD A;  4ZTT A;  1YV1 A;  2VXI A;  3AK8 A;  4DE6 A;  3JZA B;  2C2J A;  4EVE A;  4ZLW A;  2V2N A;  3GGZ A;  3LKD A;  3ES3 A;  3OJ5 A;  4RC5 B;  5FEJ A;  4QUW A;  1LB3 A;  3C21 A;  2V2O A;  4E6K A;  3L0M A;  2FG8 A;  2D5K A;  3Q4R A;  1TK6 A;  2JD7 0;  2V15 A;  3PZA A;  3AF9 X;  2JD8 0;  3PVY B;  4TOG A;  4TOD A;  3QHC A;  3HIU A;  4P18 A;  2CN7 A;  2FG4 A;  2Z5Q A;  1JKU A;  5LG8 A;  3SHX A;  3RGD A;  2X17 0;  3AK9 A;  2XJN A;  2G38 B;  4W4L B;  1L8I A;  3FI6 A;  3PWQ A;  4II4 B;  5FFA A;  2C2F A;  1QGH A;  2WWX B;  3NP0 X;  3R2L A;  2XKQ A;  3E6S A;  3AF8 X;  4KVQ A;  5D8O A;  4TOF A;  2GS4 A;  2G4H A;  2ZA6 A;  2GYQ A;  3RE7 A;  1TKO A;  2XJM A;  3WVU A;  4ZL5 A;  4YXJ A;  4PG0 A;  3R2R A;  4RC5 A;  4ZJK A;  4ZKH A;  2BJY A;  3PW8 A;  3RD0 A;  3F32 A;  5HU6 D;  2PYB A;  4XKT A;  3F35 A;  4MY7 A;  5JKM A;  1SQ3 A;  5CZU A;  2CN6 A;  4AM5 A;  4AM2 A;  1L8H A;  1BFR A;  1UMN A;  4DZ0 A;  3QZ3 A;  2MGY A;  2V8T A;  3DBY A;  3R2S A;  1VJX A;  3KA8 A;  1S30 A;  2C41 A;  3TA8 A;  3ISF A;  5J8W A;  3D19 A;  3C1Z A;  4LPM A;  2VXX A;  3AJP A;  3BVI A;  1RCI A;  3ERZ A;  3E1O A;  3RBC A;  1H96 A;  4KVS A;  4LQV A;  2AR0 A;  4ISM A;  4ITT A;  2CEI A;  2UX1 A;  4DI0 A;  4EVB A;  1MFR A;  1N1Q A;  1O9I A;  4RC8 A;  3OGH A;  4REU A;  4U3G A;  4XKS A;  2YJK A;  1UVH A;  5GU2 X;  3A68 A;  3N6O A;  1RCG A;  3E1M A;  3Q4O A;  3VV9 A;  3F38 A;  3GVY A;  5LS9 A;  3EGM A;  4W4K B;  2IB0 A;  4AM4 A;  3JZ9 A;  3IS7 A;  1O9R A;  3SE1 A;  3KA4 A;  4PGI A;  1XZ1 A;  1FHA A;  3KXU A;  2V2J A;  5LG2 A;  4MJY A;  1JRE A;  1JI4 A;  2CHP A;  2V2I A;  3KX9 A;  3IS8 A;  5GOU A;  1AEW A;  2RBD A;  2FJC A;  1ZS3 A;  4DYU A;  3BKN A;  4ISP A;  3F37 A;  2Z6M A;  1Z4A A;  3E2C A;  5AXS A;  3E1Q A;  3SID A;  2CIH A;  4A25 A;  5J93 A;  2C2U A;  4CYA A;  2F7N A;  1VEI A;  1TKP A;  1F30 A;  4M32 A;  1B71 A;  4LQJ A;  3BVK A;  3E6R A;  2Z5P A;  5E1U A;  3EZU A;  3H7G A;  4TOE A;  1BG7 A;  5C6F A;  4TOB A;  2ZG9 X;  3RAV A;  3T9J A;  3FSE A;  4MKU A;  5GU0 X;  1HRS A;  2V2R A;  4CMY V;  4CVT A;  2N02 A;  1RCE A;  2JD6 0;  1RCC A;  5E2D A;  3WNW A;  1YUX A;  3C23 A;  3FRR A;  1EUM A;  5FFC A;  5FFD A;  3QD8 A;  3WVV A;  3KHK A;  2V2S A;  2OKC A;  5IX6 A;  1VEQ A;  2IU2 A;  3O7S A;  4TOH A;  3BVE A;  3VVA A;  4XGS A;  3UFB A;  1ZUJ A;  4ERU A;  5LBH A;  4LYU A;  4MUD A;  3PWF A;  3Q4Q A;  4MXP A;  4CY9 A;  1Z6O M;  3NOZ X;  4LPN A;  5GU3 X;  1OTK A;  2Y3Q A;  3KA6 A;  2YW7 A;  3WVW A;  4ETR A;  5CMQ A;  3GHQ A;  2VZB A;  1NFV A;  3W54 A;  4RC6 B;  1DPS A;  4ZKW A;  4EVD A;  2ZG7 X;  3VNX A;  4IXK A;  1IER A;  1QYB A;  3KWO A;  4CYB A;  1JIG A;  3EZ0 A;  3F33 A;  2CWL A;  3GE4 A;  4M35 A;  5J8S A;  1NNQ A;  3QVD A;  2XJO A;  5ERK A;  4ZL6 A;  3ISE A;  4ZMC A;  4RC7 A;  5FFB A;  2BKC A;  1RYT A;  3QB9 A;  2HTN A;  5JKL G;  3KA3 A;  2OC5 A;  2BW1 A;  4KVR A;  1TJO A;  3SH6 A;  4XKU A;  4LQH A;  4PGK A;  3E1L A;  2FL0 A;  3U90 A;  2FZF A;  3C1Y A;  5D8Q A;  3A9Q A;  2WTL A;  4TO9 A;  4EVC A;  3PVT B;  5ERJ A;  4ITW A;  4Z3B A;  2CLU A;  5K53 A;  2V8U A;  4X0J A;  4IWJ A;  4WJG 4;  3BT5 A;  1LKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...