4REUA

Revelation of endogenously bound fe2+ ions in the crystal structure of ferritin from escherichia coli
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
164
structure length
164
Chain Sequence
LKPEMIEKLNEQMNLELYSSLLYQQMSAWCSYHTFEGAAAFLRRHAQEEMTHMQRLFDYLTDTGNLPRINTVESPFAEYSSLDELFQETYKHEQLITQKINELAHAAMTNQDYPTFNFLQWYVSEQHEEEKLFKSIIDKLSLAGKSGEGLYFIDKELSTLDTQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ferritin
publication title Revelation of Endogenously bound Fe(2+) ions in the Crystal Structure of Ferritin from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli str. k-12 substr. mds42
total genus 77
structure length 164
sequence length 164
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2014-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4reuA00
2V15A 4LPMA 2GYDA 2QF9A 1FHAA 4ETRA 3PWQA 1RCCA 1NFVA 1VEIA 4KVQA 5K52A 3AJPA 3WVUA 3RGDA 2FL0A 3E1PA 1GWGA 2Z5PA 4LPJA 4ZL6A 5J93A 1RCIA 2C6RA 4IWJA 4PGIA 4QUWA 2C2UA 5J9VA 3RE7A 3R2SA 4II4A 3RBCA 3AJOA 3R2LA 2FG4A 1Z4AA 3BVFA 3F34A 5D8XA 2VXXA 1UVHA 4DYZA 5LG8A 1IERA 1Z6OA 2XKQA 4CMYA 1OTKA 3PW1B 3PVTB 1S3QA 3AF9X 3PVRA 5E1UA 1JKVA 1SQ3A 5HQOA 1HRSA 4PG0A 3R2HA 4ISMA 3KA4A 1RCDA 2CN6A 4ZL5A 3E6RA 3AK8A 3VNXA 5FFCA 2BK6A 2FG8A 3MPSA 4M34A 2FKZA 3E1LA 1TJOA 5FFBA 1ZS3A 2ZURX 4PG1A 3O7SA 3IQ1A 1R03A 1JGCA 4ZLWA 3UOIA 4MUDA 1MFRA 5GOUA 5HJFA 2BW1A 2V2NA 3BKNA 5FFAA 1LKMA 1S30A 2WTLA 4TOEA 4RC6B 4TOGA 4LQHA 2W0OA 4IXKA 2ZA7A 1UMNA 3PW8A 3A68A 3NP0X 1JIGA 2BKCA 5J8WA 4ZKWA 1L8IA 5GN8B 5CZUA 2D5KA 2X170 3E1NA 4TOBA 5D8YA 1TKOA 3SHXA 4DE6A 1RYTA 2FJCA 1TK6A 4DYYA 4ZTTA 2ZG9X 2ZG8X 3ERZA 3AJQA 3SH6A 4II4B 3FVBA 2CEIA 1L8HA 3OGHA 3KXUA 4MJYA 4EVEA 4AM2A 1DVBA 1YUXA 5GN8A 2C41A 1J30A 3GHQA 3KA8A 3E1QA 2V2PA 2HTNA 3PVRB 2G4HA 2FZFA 3ISEA 2PYBA 3KA9A 3UOFA 3R2MA 1NF4A 1O9IA 2ZA6A 1IESA 3NOZX 3BVEA 4E6KA 4Y08A 5K53A 5GU1X 5D8QA 2Y3QA 5GU0X 4P18A 1O9RA 2WLUA 3EGMA 2CHIA 2XJNA 4EVCA 1TKPA 3EZ0A 1JYBA 5JKLA 2CLUA 3E1JA 3T9JA 4CYBA 1YUZA 4DYUA 5JKMA 1DPSA 2GS4A 3F38A 5CMQA 5D8SA 3E1MA 4XKTA 3QZ3A 4RC8A 3E6SA 3HIUA 2FHAA 2ZA8A 4U3GA 2XGWA 3A9QA 4TOCA 1VELA 1JKUA 3R2KA 4M35A 2CIHA 2HR5A 3KX9A 4ITTA 3F33A 4LYUA 3R2RA 2Z5QA 4M33A 5FFDA 2JD70 2C2JA 5I4JA 2VZBA 3GE4A 1XZ3A 4CVRA 4MN9A 3BVIA 4CMYV 2YJKA 3FI6A 4Z5SA 3WVVA 4Z3BA 2CHPA 1BFRA 5LS9A 3SE1A 3AF7X 2FFXJ 2V2OA 1AEWA 1XZ1A 1NF6A 2ITBA 3IS7A 4A25A 1H96A 1QGHA 2ZG7X 3F32A 5JACA 3QVDA 4CYAA 5CMRA 1EUMA 4AM4A 4CVSA 3QD8A 4CY9A 2GYQA 3AF8X 3PWQC 4EVBA 4ZJKA 3QB9A 4RC7B 1F33A 3UNOA 2YJJA 5C6FA 3BT5A 3NP2X 2V2SA 3TA8A 3BVKA 4KVSA 1LKPA 5AXSA 4TO9A 1JI5A 3QHCA 5LBHA 5J8SA 2Z5RA 5ERJA 1DATA 1LKOA 1VJXA 4PGKA 3E2CA 3WNWA 4TOAA 3EZUA 1QYBA 2UX1A 4RC7A 4ZKXA 4M32A 3ISFA 3Q4RA 4ZKHA 2OC5A 5GU2X 5ERKA 2V2MA 2YW7A 2CF7A 3PVYA 2RBDA 2IB0A 4TODA 4DZ0A 4R42A 2F7NA 1VLGA 4RC5A 2V2IA 4ERUA 2IU2A 3Q4OA 5LG2A 4EVDA 2V2LA 1BG7A 4LPNA 4DI0A 3O7RA 3F35A 5JKLG 4CVTA 3U90A 3KWOA 1RCGA 5JKMG 4XKUA 1MOJA 1JREA 4IWKA 5IX6A 2JD60 5D8RA 4LYXA 4XKSA 5D8OA 3PW8C 1RCEA 3OJ5A 3AK9A 3QHBA 2YW6A 3Q4NA 4TOFA 5FFEA 2C2FA 2CN7A 4ML5A 4XGSA 3HL1A 4ISPA 4TOHA 1YV1A 3ES3A 2WLAA 5FEJA 4OYNA 2Z6MA 4LQNA 3PW1A 4DYXA 3PVTA 1LB3A 3IS8A 3R2OA 2Z90A 4ITWA 1BCFA 4MKUA 4MY7A 3E1OA 4DASA 2VXIA 2IY4A 4AM5A 4REUA 3F36A 1B71A 4TW3A 3F39A 2V2RA 3PZAA 1Z6OM 1JTSA 3PWFA 2XJOA 3FSEA 5HJHA 3SIDA 4YKHA 2OH3A 3RD0A 3RAVA 1SOFA 5D8PA 3KA3A 1ZUJA 4LQVA 5E2DA 3F37A 1NNQA 1N1QA 1JI4A 4ZMCA 2BJYA 3PVYB 2XJMA 4CVPA 3BVLA 3WVWA 1VEQA 1F30A 1KRQA 4RC5B 1S2ZA 3GVYA 3H7GA 4RC6A 3Q4QA 5GU3X 4KVRA 2CLBA 4LQJA 2QQYA 2JD80 3KA6A 2V2JA
chains in the Genus database with same CATH superfamily
2V15A 4LPMA 2GYDA 2QF9A 1FHAA 4ETRA 3PWQA 4E40A 1RCCA 1NFVA 1VEIA 4KVQA 3GGZA 5K52A 3AJPA 3WVUA 3RGDA 2FL0A 3E1PA 1GWGA 2Z5PA 4LPJA 4MXPA 3FRRA 4ZL6A 5J93A 1RCIA 2C6RA 4IWJA 4PGIA 4QUWA 2C2UA 5J9VA 3RE7A 3JZ9A 3R2SA 4II4A 3RBCA 3AJOA 3R2LA 2FG4A 1Z4AA 3BVFA 3F34A 5D8XA 2VXXA 1UVHA 4DYZA 5LG8A 1IERA 1Z6OA 2XKQA 4CMYA 1OTKA 3PW1B 3PVTB 1S3QA 3AF9X 3PVRA 3W54A 5E1UA 1JKVA 1SQ3A 5HQOA 1HRSA 4PG0A 3R2HA 2OKCA 4ISMA 3KA4A 1RCDA 2CN6A 4ZL5A 3E6RA 3AK8A 3VNXA 5FFCA 2BK6A 2FG8A 3MPSA 4M34A 2FKZA 3E1LA 4W4KB 3KDQA 1TJOA 5FFBA 1ZS3A 2ZURX 4PG1A 3N6OA 3O7SA 3IQ1A 1R03A 1JGCA 4ZLWA 3UOIA 4MUDA 2WWXB 1MFRA 5GOUA 5HJFA 2BW1A 2V2NA 3BKNA 5FFAA 1LKMA 1S30A 2WTLA 4TOEA 4RC6B 4TOGA 4LQHA 2W0OA 4IXKA 2ZA7A 1UMNA 3PW8A 3A68A 3NP0X 1JIGA 2BKCA 5J8WA 4ZKWA 1L8IA 5GN8B 5CZUA 2D5KA 2X170 3E1NA 4TOBA 5D8YA 1TKOA 4KXRB 3SHXA 4DE6A 3C1ZA 1RYTA 2FJCA 1TK6A 4DYYA 4ZTTA 2ZG9X 2ZG8X 3C21A 3AJQA 3ERZA 3SH6A 4II4B 3M6JA 3FVBA 2CEIA 1L8HA 3OGHA 3KXUA 4MJYA 4EVEA 4AM2A 1DVBA 3VV9A 1YUXA 5GN8A 2C41A 1J30A 3GHQA 3KA8A 3E1QA 2V2PA 2HTNA 3PVRB 2G4HA 2FZFA 3ISEA 2PYBA 3KA9A 3UOFA 3R2MA 1NF4A 1O9IA 2ZA6A 1IESA 3NOZX 3BVEA 4E6KA 4Y08A 5K53A 5GU1X 3DBYA 5D8QA 2Y3QA 5GU0X 4P18A 1O9RA 2WLUA 3EGMA 2CHIA 5JDOB 3UFBA 2XJNA 4EVCA 1TKPA 3EZ0A 1JYBA 5JKLA 2CLUA 3E1JA 3T9JA 4CYBA 1YUZA 4DYUA 5JKMA 1DPSA 2GS4A 3F38A 5CMQA 5D8SA 3E1MA 4XKTA 3QZ3A 4RC8A 3E6SA 3HIUA 2FHAA 2ZA8A 4U3GA 2XGWA 3A9QA 4TOCA 1VELA 1JKUA 4YVZA 3R2KA 4M35A 3JZAB 2CIHA 3LKDA 2HR5A 3KX9A 4ITTA 5JDOA 3F33A 4LYUA 3R2RA 2Z5QA 3GGYA 4M33A 5FFDA 2JD70 2C2JA 5I4JA 2VZBA 3GE4A 1XZ3A 4CVRA 4MN9A 3BVIA 4CMYV 2YJKA 3FI6A 4Z5SA 3WVVA 4Z3BA 2CHPA 1BFRA 5LS9A 3SE1A 3AF7X 2FFXJ 2V2OA 1AEWA 1XZ1A 1NF6A 2ITBA 3IS7A 4A25A 3VVAA 1H96A 4X0JA 1QGHA 2ZG7X 3F32A 5JACA 3QVDA 4CYAA 5CMRA 1EUMA 4AM4A 4CVSA 3QD8A 4CY9A 2GYQA 3AF8X 3PWQC 4EVBA 4ZJKA 3QB9A 4RC7B 1F33A 3UNOA 2YJJA 3C23A 5C6FA 3BT5A 2AR0A 3NP2X 2V2SA 3TA8A 3BVKA 4KVSA 1LKPA 5AXSA 4TO9A 1JI5A 3QHCA 5LBHA 5J8SA 2Z5RA 5ERJA 1DATA 1LKOA 1VJXA 4PGKA 3E2CA 3WNWA 4TOAA 3EZUA 1QYBA 2UX1A 4RC7A 4ZKXA 4M32A 3ISFA 3Q4RA 4ZKHA 2OC5A 5GU2X 5ERKA 2V2MA 2YW7A 2CF7A 3PVYA 2RBDA 2IB0A 4TODA 4DZ0A 4R42A 2F7NA 1VLGA 3FRSA 4RC5A 2V2IA 4ERUA 3D19A 2IU2A 3Q4OA 5LG2A 4EVDA 2V2LA 1BG7A 4LPNA 4DI0A 3O7RA 3F35A 2Y44A 5JKLG 4CVTA 3U90A 3KWOA 3C1YA 1RCGA 5JKMG 4XKUA 2CWLA 1MOJA 1JREA 4IWKA 3L0MA 5IX6A 2JD60 5D8RA 4LYXA 4XKSA 2G38B 5D8OA 3PW8C 1RCEA 2V8TA 4WJG4 3OJ5A 3AK9A 3QHBA 2YW6A 4W4LB 3Q4NA 4TOFA 5FFEA 3V3KB 2C2FA 2CN7A 4ML5A 4XGSA 3HL1A 4ISPA 4TOHA 1YV1A 3ES3A 4YXMA 2WLAA 5FEJA 4OYNA 2Z6MA 4LQNA 3PW1A 4DYXA 3PVTA 1LB3A 3IS8A 3R2OA 5HU6D 2Z90A 4ITWA 1BCFA 4MKUA 4MY7A 3E1OA 4DASA 2VXIA 3KHKA 2IY4A 4AM5A 4REUA 3F36A 1B71A 4TW3A 3F39A 2V2RA 3PZAA 1Z6OM 1JTSA 3PWFA 2XJOA 3FSEA 5HJHA 3SIDA 4YKHA 2V8UA 2OH3A 3RD0A 3RAVA 1SOFA 5D8PA 3KA3A 1ZUJA 4LQVA 5E2DA 3F37A 1NNQA 1N1QA 1JI4A 4ZMCA 2BJYA 3PVYB 2XJMA 4CVPA 3BVLA 3WVWA 1VEQA 1F30A 1KRQA 4RC5B 1S2ZA 3GVYA 3H7GA 4RC6A 2N02A 3Q4QA 5GU3X 4KVRA 2CLBA 2MGYA 4LQJA 4YXJA 2QQYA 2JD80 3KA6A 2V2JA
chains in the Genus database with same CATH topology
2V15A 4LPMA 2GYDA 2QF9A 1FHAA 4ETRA 3PWQA 4E40A 1RCCA 1NFVA 1VEIA 4KVQA 3GGZA 5K52A 3AJPA 3WVUA 3RGDA 2FL0A 3E1PA 1GWGA 2Z5PA 4LPJA 4MXPA 3FRRA 4ZL6A 5J93A 1RCIA 2C6RA 4IWJA 4PGIA 4QUWA 2C2UA 5J9VA 3RE7A 3JZ9A 3R2SA 4II4A 3RBCA 3AJOA 3R2LA 2FG4A 1Z4AA 3BVFA 3F34A 5D8XA 2VXXA 1UVHA 4DYZA 5LG8A 1IERA 1Z6OA 2XKQA 4CMYA 1OTKA 3PW1B 3PVTB 1S3QA 3AF9X 3PVRA 3W54A 5E1UA 1JKVA 1SQ3A 5HQOA 1HRSA 4PG0A 3R2HA 2OKCA 4ISMA 3KA4A 1RCDA 2CN6A 4ZL5A 3E6RA 3AK8A 3VNXA 5FFCA 2BK6A 2FG8A 3MPSA 4M34A 2FKZA 3E1LA 4W4KB 3KDQA 1TJOA 5FFBA 1ZS3A 2ZURX 4PG1A 3N6OA 3O7SA 3IQ1A 1R03A 1JGCA 4ZLWA 3UOIA 4MUDA 2WWXB 1MFRA 5GOUA 5HJFA 2BW1A 2V2NA 3BKNA 5FFAA 1LKMA 1S30A 2WTLA 4TOEA 4RC6B 4TOGA 4LQHA 2W0OA 4IXKA 2ZA7A 1UMNA 3PW8A 3A68A 3NP0X 1JIGA 2BKCA 5J8WA 4ZKWA 1L8IA 5GN8B 5CZUA 2D5KA 2X170 3E1NA 4TOBA 5D8YA 1TKOA 4KXRB 3SHXA 4DE6A 3C1ZA 1RYTA 2FJCA 1TK6A 4DYYA 4ZTTA 2ZG9X 2ZG8X 3C21A 3AJQA 3ERZA 3SH6A 4II4B 3M6JA 3FVBA 2CEIA 1L8HA 3OGHA 3KXUA 4MJYA 4EVEA 4AM2A 1DVBA 3VV9A 1YUXA 5GN8A 2C41A 1J30A 3GHQA 3KA8A 3E1QA 2V2PA 2HTNA 3PVRB 2G4HA 2FZFA 3ISEA 2PYBA 3KA9A 3UOFA 3R2MA 1NF4A 1O9IA 2ZA6A 1IESA 3NOZX 3BVEA 4E6KA 4Y08A 5K53A 5GU1X 3DBYA 5D8QA 2Y3QA 5GU0X 4P18A 1O9RA 2WLUA 3EGMA 2CHIA 5JDOB 3UFBA 2XJNA 4EVCA 1TKPA 3EZ0A 1JYBA 5JKLA 2CLUA 3E1JA 3T9JA 4CYBA 1YUZA 4DYUA 5JKMA 1DPSA 2GS4A 3F38A 5CMQA 5D8SA 3E1MA 4XKTA 3QZ3A 4RC8A 3E6SA 3HIUA 2FHAA 2ZA8A 4U3GA 2XGWA 3A9QA 4TOCA 1VELA 1JKUA 4YVZA 3R2KA 4M35A 3JZAB 2CIHA 3LKDA 2HR5A 3KX9A 4ITTA 5JDOA 3F33A 4LYUA 3R2RA 2Z5QA 3GGYA 4M33A 5FFDA 2JD70 2C2JA 5I4JA 2VZBA 3GE4A 1XZ3A 4CVRA 4MN9A 3BVIA 4CMYV 2YJKA 3FI6A 4Z5SA 3WVVA 4Z3BA 2CHPA 1BFRA 5LS9A 3SE1A 3AF7X 2FFXJ 2V2OA 1AEWA 1XZ1A 1NF6A 2ITBA 3IS7A 4A25A 3VVAA 1H96A 4X0JA 1QGHA 2ZG7X 3F32A 5JACA 3QVDA 4CYAA 5CMRA 1EUMA 4AM4A 4CVSA 3QD8A 4CY9A 2GYQA 3AF8X 3PWQC 4EVBA 4ZJKA 3QB9A 4RC7B 1F33A 3UNOA 2YJJA 3C23A 5C6FA 3BT5A 2AR0A 3NP2X 2V2SA 3TA8A 3BVKA 4KVSA 1LKPA 5AXSA 4TO9A 1JI5A 3QHCA 5LBHA 5J8SA 2Z5RA 5ERJA 1DATA 1LKOA 1VJXA 4PGKA 3E2CA 3WNWA 4TOAA 3EZUA 1QYBA 2UX1A 4RC7A 4ZKXA 4M32A 3ISFA 3Q4RA 4ZKHA 2OC5A 5GU2X 5ERKA 2V2MA 2YW7A 2CF7A 3PVYA 2RBDA 2IB0A 4TODA 4DZ0A 4R42A 2F7NA 1VLGA 3FRSA 4RC5A 2V2IA 4ERUA 3D19A 2IU2A 3Q4OA 5LG2A 4EVDA 2V2LA 1BG7A 4LPNA 4DI0A 3O7RA 3F35A 2Y44A 5JKLG 4CVTA 3U90A 3KWOA 3C1YA 1RCGA 5JKMG 4XKUA 2CWLA 1MOJA 1JREA 4IWKA 3L0MA 5IX6A 2JD60 5D8RA 4LYXA 4XKSA 2G38B 5D8OA 3PW8C 1RCEA 2V8TA 4WJG4 3OJ5A 3AK9A 3QHBA 2YW6A 4W4LB 3Q4NA 4TOFA 5FFEA 3V3KB 2C2FA 2CN7A 4ML5A 4XGSA 3HL1A 4ISPA 4TOHA 1YV1A 3ES3A 4YXMA 2WLAA 5FEJA 4OYNA 2Z6MA 4LQNA 3PW1A 4DYXA 3PVTA 1LB3A 3IS8A 3R2OA 5HU6D 2Z90A 4ITWA 1BCFA 4MKUA 4MY7A 3E1OA 4DASA 2VXIA 3KHKA 2IY4A 4AM5A 4REUA 3F36A 1B71A 4TW3A 3F39A 2V2RA 3PZAA 1Z6OM 1JTSA 3PWFA 2XJOA 3FSEA 5HJHA 3SIDA 4YKHA 2V8UA 2OH3A 3RD0A 3RAVA 1SOFA 5D8PA 3KA3A 1ZUJA 4LQVA 5E2DA 3F37A 1NNQA 1N1QA 1JI4A 4ZMCA 2BJYA 3PVYB 2XJMA 4CVPA 3BVLA 3WVWA 1VEQA 1F30A 1KRQA 4RC5B 1S2ZA 3GVYA 3H7GA 4RC6A 2N02A 3Q4QA 5GU3X 4KVRA 2CLBA 2MGYA 4LQJA 4YXJA 2QQYA 2JD80 3KA6A 2V2JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V15 A;  4LPM A;  2GYD A;  2QF9 A;  1FHA A;  4ETR A;  3PWQ A;  1RCC A;  1NFV A;  1VEI A;  4KVQ A;  5K52 A;  3AJP A;  3WVU A;  3RGD A;  2FL0 A;  3E1P A;  1GWG A;  2Z5P A;  4LPJ A;  4ZL6 A;  5J93 A;  1RCI A;  2C6R A;  4IWJ A;  4PGI A;  4QUW A;  2C2U A;  5J9V A;  3RE7 A;  3R2S A;  4II4 A;  3RBC A;  3AJO A;  3R2L A;  2FG4 A;  1Z4A A;  3BVF A;  3F34 A;  5D8X A;  2VXX A;  1UVH A;  4DYZ A;  5LG8 A;  1IER A;  1Z6O A;  2XKQ A;  4CMY A;  1OTK A;  3PW1 B;  3PVT B;  1S3Q A;  3AF9 X;  3PVR A;  5E1U A;  1JKV A;  1SQ3 A;  5HQO A;  1HRS A;  4PG0 A;  3R2H A;  4ISM A;  3KA4 A;  1RCD A;  2CN6 A;  4ZL5 A;  3E6R A;  3AK8 A;  3VNX A;  5FFC A;  2BK6 A;  2FG8 A;  3MPS A;  4M34 A;  2FKZ A;  3E1L A;  1TJO A;  5FFB A;  1ZS3 A;  2ZUR X;  4PG1 A;  3O7S A;  3IQ1 A;  1R03 A;  1JGC A;  4ZLW A;  3UOI A;  4MUD A;  1MFR A;  5GOU A;  5HJF A;  2BW1 A;  2V2N A;  3BKN A;  5FFA A;  1LKM A;  1S30 A;  2WTL A;  4TOE A;  4RC6 B;  4TOG A;  4LQH A;  2W0O A;  4IXK A;  2ZA7 A;  1UMN A;  3PW8 A;  3A68 A;  3NP0 X;  1JIG A;  2BKC A;  5J8W A;  4ZKW A;  1L8I A;  5GN8 B;  5CZU A;  2D5K A;  2X17 0;  3E1N A;  4TOB A;  5D8Y A;  1TKO A;  3SHX A;  4DE6 A;  1RYT A;  2FJC A;  1TK6 A;  4DYY A;  4ZTT A;  2ZG9 X;  2ZG8 X;  3ERZ A;  3AJQ A;  3SH6 A;  4II4 B;  3FVB A;  2CEI A;  1L8H A;  3OGH A;  3KXU A;  4MJY A;  4EVE A;  4AM2 A;  1DVB A;  1YUX A;  5GN8 A;  2C41 A;  1J30 A;  3GHQ A;  3KA8 A;  3E1Q A;  2V2P A;  2HTN A;  3PVR B;  2G4H A;  2FZF A;  3ISE A;  2PYB A;  3KA9 A;  3UOF A;  3R2M A;  1NF4 A;  1O9I A;  2ZA6 A;  1IES A;  3NOZ X;  3BVE A;  4E6K A;  4Y08 A;  5K53 A;  5GU1 X;  5D8Q A;  2Y3Q A;  5GU0 X;  4P18 A;  1O9R A;  2WLU A;  3EGM A;  2CHI A;  2XJN A;  4EVC A;  1TKP A;  3EZ0 A;  1JYB A;  5JKL A;  2CLU A;  3E1J A;  3T9J A;  4CYB A;  1YUZ A;  4DYU A;  5JKM A;  1DPS A;  2GS4 A;  3F38 A;  5CMQ A;  5D8S A;  3E1M A;  4XKT A;  3QZ3 A;  4RC8 A;  3E6S A;  3HIU A;  2FHA A;  2ZA8 A;  4U3G A;  2XGW A;  3A9Q A;  4TOC A;  1VEL A;  1JKU A;  3R2K A;  4M35 A;  2CIH A;  2HR5 A;  3KX9 A;  4ITT A;  3F33 A;  4LYU A;  3R2R A;  2Z5Q A;  4M33 A;  5FFD A;  2JD7 0;  2C2J A;  5I4J A;  2VZB A;  3GE4 A;  1XZ3 A;  4CVR A;  4MN9 A;  3BVI A;  4CMY V;  2YJK A;  3FI6 A;  4Z5S A;  3WVV A;  4Z3B A;  2CHP A;  1BFR A;  5LS9 A;  3SE1 A;  3AF7 X;  2FFX J;  2V2O A;  1AEW A;  1XZ1 A;  1NF6 A;  2ITB A;  3IS7 A;  4A25 A;  1H96 A;  1QGH A;  2ZG7 X;  3F32 A;  5JAC A;  3QVD A;  4CYA A;  5CMR A;  1EUM A;  4AM4 A;  4CVS A;  3QD8 A;  4CY9 A;  2GYQ A;  3AF8 X;  3PWQ C;  4EVB A;  4ZJK A;  3QB9 A;  4RC7 B;  1F33 A;  3UNO A;  2YJJ A;  5C6F A;  3BT5 A;  3NP2 X;  2V2S A;  3TA8 A;  3BVK A;  4KVS A;  1LKP A;  5AXS A;  4TO9 A;  1JI5 A;  3QHC A;  5LBH A;  5J8S A;  2Z5R A;  5ERJ A;  1DAT A;  1LKO A;  1VJX A;  4PGK A;  3E2C A;  3WNW A;  4TOA A;  3EZU A;  1QYB A;  2UX1 A;  4RC7 A;  4ZKX A;  4M32 A;  3ISF A;  3Q4R A;  4ZKH A;  2OC5 A;  5GU2 X;  5ERK A;  2V2M A;  2YW7 A;  2CF7 A;  3PVY A;  2RBD A;  2IB0 A;  4TOD A;  4DZ0 A;  4R42 A;  2F7N A;  1VLG A;  4RC5 A;  2V2I A;  4ERU A;  2IU2 A;  3Q4O A;  5LG2 A;  4EVD A;  2V2L A;  1BG7 A;  4LPN A;  4DI0 A;  3O7R A;  3F35 A;  5JKL G;  4CVT A;  3U90 A;  3KWO A;  1RCG A;  5JKM G;  4XKU A;  1MOJ A;  1JRE A;  4IWK A;  5IX6 A;  2JD6 0;  5D8R A;  4LYX A;  4XKS A;  5D8O A;  3PW8 C;  1RCE A;  3OJ5 A;  3AK9 A;  3QHB A;  2YW6 A;  3Q4N A;  4TOF A;  5FFE A;  2C2F A;  2CN7 A;  4ML5 A;  4XGS A;  3HL1 A;  4ISP A;  4TOH A;  1YV1 A;  3ES3 A;  2WLA A;  5FEJ A;  4OYN A;  2Z6M A;  4LQN A;  3PW1 A;  4DYX A;  3PVT A;  1LB3 A;  3IS8 A;  3R2O A;  2Z90 A;  4ITW A;  1BCF A;  4MKU A;  4MY7 A;  3E1O A;  4DAS A;  2VXI A;  2IY4 A;  4AM5 A;  4REU A;  3F36 A;  1B71 A;  4TW3 A;  3F39 A;  2V2R A;  3PZA A;  1Z6O M;  1JTS A;  3PWF A;  2XJO A;  3FSE A;  5HJH A;  3SID A;  4YKH A;  2OH3 A;  3RD0 A;  3RAV A;  1SOF A;  5D8P A;  3KA3 A;  1ZUJ A;  4LQV A;  5E2D A;  3F37 A;  1NNQ A;  1N1Q A;  1JI4 A;  4ZMC A;  2BJY A;  3PVY B;  2XJM A;  4CVP A;  3BVL A;  3WVW A;  1VEQ A;  1F30 A;  1KRQ A;  4RC5 B;  1S2Z A;  3GVY A;  3H7G A;  4RC6 A;  3Q4Q A;  5GU3 X;  4KVR A;  2CLB A;  4LQJ A;  2QQY A;  2JD8 0;  3KA6 A;  2V2J A; 
#chains in the Genus database with same CATH topology
 2V15 A;  4LPM A;  2GYD A;  2QF9 A;  1FHA A;  4ETR A;  3PWQ A;  4E40 A;  1RCC A;  1NFV A;  1VEI A;  4KVQ A;  3GGZ A;  5K52 A;  3AJP A;  3WVU A;  3RGD A;  2FL0 A;  3E1P A;  1GWG A;  2Z5P A;  4LPJ A;  4MXP A;  3FRR A;  4ZL6 A;  5J93 A;  1RCI A;  2C6R A;  4IWJ A;  4PGI A;  4QUW A;  2C2U A;  5J9V A;  3RE7 A;  3JZ9 A;  3R2S A;  4II4 A;  3RBC A;  3AJO A;  3R2L A;  2FG4 A;  1Z4A A;  3BVF A;  3F34 A;  5D8X A;  2VXX A;  1UVH A;  4DYZ A;  5LG8 A;  1IER A;  1Z6O A;  2XKQ A;  4CMY A;  1OTK A;  3PW1 B;  3PVT B;  1S3Q A;  3AF9 X;  3PVR A;  3W54 A;  5E1U A;  1JKV A;  1SQ3 A;  5HQO A;  1HRS A;  4PG0 A;  3R2H A;  2OKC A;  4ISM A;  3KA4 A;  1RCD A;  2CN6 A;  4ZL5 A;  3E6R A;  3AK8 A;  3VNX A;  5FFC A;  2BK6 A;  2FG8 A;  3MPS A;  4M34 A;  2FKZ A;  3E1L A;  4W4K B;  3KDQ A;  1TJO A;  5FFB A;  1ZS3 A;  2ZUR X;  4PG1 A;  3N6O A;  3O7S A;  3IQ1 A;  1R03 A;  1JGC A;  4ZLW A;  3UOI A;  4MUD A;  2WWX B;  1MFR A;  5GOU A;  5HJF A;  2BW1 A;  2V2N A;  3BKN A;  5FFA A;  1LKM A;  1S30 A;  2WTL A;  4TOE A;  4RC6 B;  4TOG A;  4LQH A;  2W0O A;  4IXK A;  2ZA7 A;  1UMN A;  3PW8 A;  3A68 A;  3NP0 X;  1JIG A;  2BKC A;  5J8W A;  4ZKW A;  1L8I A;  5GN8 B;  5CZU A;  2D5K A;  2X17 0;  3E1N A;  4TOB A;  5D8Y A;  1TKO A;  4KXR B;  3SHX A;  4DE6 A;  3C1Z A;  1RYT A;  2FJC A;  1TK6 A;  4DYY A;  4ZTT A;  2ZG9 X;  2ZG8 X;  3C21 A;  3AJQ A;  3ERZ A;  3SH6 A;  4II4 B;  3M6J A;  3FVB A;  2CEI A;  1L8H A;  3OGH A;  3KXU A;  4MJY A;  4EVE A;  4AM2 A;  1DVB A;  3VV9 A;  1YUX A;  5GN8 A;  2C41 A;  1J30 A;  3GHQ A;  3KA8 A;  3E1Q A;  2V2P A;  2HTN A;  3PVR B;  2G4H A;  2FZF A;  3ISE A;  2PYB A;  3KA9 A;  3UOF A;  3R2M A;  1NF4 A;  1O9I A;  2ZA6 A;  1IES A;  3NOZ X;  3BVE A;  4E6K A;  4Y08 A;  5K53 A;  5GU1 X;  3DBY A;  5D8Q A;  2Y3Q A;  5GU0 X;  4P18 A;  1O9R A;  2WLU A;  3EGM A;  2CHI A;  5JDO B;  3UFB A;  2XJN A;  4EVC A;  1TKP A;  3EZ0 A;  1JYB A;  5JKL A;  2CLU A;  3E1J A;  3T9J A;  4CYB A;  1YUZ A;  4DYU A;  5JKM A;  1DPS A;  2GS4 A;  3F38 A;  5CMQ A;  5D8S A;  3E1M A;  4XKT A;  3QZ3 A;  4RC8 A;  3E6S A;  3HIU A;  2FHA A;  2ZA8 A;  4U3G A;  2XGW A;  3A9Q A;  4TOC A;  1VEL A;  1JKU A;  4YVZ A;  3R2K A;  4M35 A;  3JZA B;  2CIH A;  3LKD A;  2HR5 A;  3KX9 A;  4ITT A;  5JDO A;  3F33 A;  4LYU A;  3R2R A;  2Z5Q A;  3GGY A;  4M33 A;  5FFD A;  2JD7 0;  2C2J A;  5I4J A;  2VZB A;  3GE4 A;  1XZ3 A;  4CVR A;  4MN9 A;  3BVI A;  4CMY V;  2YJK A;  3FI6 A;  4Z5S A;  3WVV A;  4Z3B A;  2CHP A;  1BFR A;  5LS9 A;  3SE1 A;  3AF7 X;  2FFX J;  2V2O A;  1AEW A;  1XZ1 A;  1NF6 A;  2ITB A;  3IS7 A;  4A25 A;  3VVA A;  1H96 A;  4X0J A;  1QGH A;  2ZG7 X;  3F32 A;  5JAC A;  3QVD A;  4CYA A;  5CMR A;  1EUM A;  4AM4 A;  4CVS A;  3QD8 A;  4CY9 A;  2GYQ A;  3AF8 X;  3PWQ C;  4EVB A;  4ZJK A;  3QB9 A;  4RC7 B;  1F33 A;  3UNO A;  2YJJ A;  3C23 A;  5C6F A;  3BT5 A;  2AR0 A;  3NP2 X;  2V2S A;  3TA8 A;  3BVK A;  4KVS A;  1LKP A;  5AXS A;  4TO9 A;  1JI5 A;  3QHC A;  5LBH A;  5J8S A;  2Z5R A;  5ERJ A;  1DAT A;  1LKO A;  1VJX A;  4PGK A;  3E2C A;  3WNW A;  4TOA A;  3EZU A;  1QYB A;  2UX1 A;  4RC7 A;  4ZKX A;  4M32 A;  3ISF A;  3Q4R A;  4ZKH A;  2OC5 A;  5GU2 X;  5ERK A;  2V2M A;  2YW7 A;  2CF7 A;  3PVY A;  2RBD A;  2IB0 A;  4TOD A;  4DZ0 A;  4R42 A;  2F7N A;  1VLG A;  3FRS A;  4RC5 A;  2V2I A;  4ERU A;  3D19 A;  2IU2 A;  3Q4O A;  5LG2 A;  4EVD A;  2V2L A;  1BG7 A;  4LPN A;  4DI0 A;  3O7R A;  3F35 A;  2Y44 A;  5JKL G;  4CVT A;  3U90 A;  3KWO A;  3C1Y A;  1RCG A;  5JKM G;  4XKU A;  2CWL A;  1MOJ A;  1JRE A;  4IWK A;  3L0M A;  5IX6 A;  2JD6 0;  5D8R A;  4LYX A;  4XKS A;  2G38 B;  5D8O A;  3PW8 C;  1RCE A;  2V8T A;  4WJG 4;  3OJ5 A;  3AK9 A;  3QHB A;  2YW6 A;  4W4L B;  3Q4N A;  4TOF A;  5FFE A;  3V3K B;  2C2F A;  2CN7 A;  4ML5 A;  4XGS A;  3HL1 A;  4ISP A;  4TOH A;  1YV1 A;  3ES3 A;  4YXM A;  2WLA A;  5FEJ A;  4OYN A;  2Z6M A;  4LQN A;  3PW1 A;  4DYX A;  3PVT A;  1LB3 A;  3IS8 A;  3R2O A;  5HU6 D;  2Z90 A;  4ITW A;  1BCF A;  4MKU A;  4MY7 A;  3E1O A;  4DAS A;  2VXI A;  3KHK A;  2IY4 A;  4AM5 A;  4REU A;  3F36 A;  1B71 A;  4TW3 A;  3F39 A;  2V2R A;  3PZA A;  1Z6O M;  1JTS A;  3PWF A;  2XJO A;  3FSE A;  5HJH A;  3SID A;  4YKH A;  2V8U A;  2OH3 A;  3RD0 A;  3RAV A;  1SOF A;  5D8P A;  3KA3 A;  1ZUJ A;  4LQV A;  5E2D A;  3F37 A;  1NNQ A;  1N1Q A;  1JI4 A;  4ZMC A;  2BJY A;  3PVY B;  2XJM A;  4CVP A;  3BVL A;  3WVW A;  1VEQ A;  1F30 A;  1KRQ A;  4RC5 B;  1S2Z A;  3GVY A;  3H7G A;  4RC6 A;  2N02 A;  3Q4Q A;  5GU3 X;  4KVR A;  2CLB A;  2MGY A;  4LQJ A;  4YXJ A;  2QQY A;  2JD8 0;  3KA6 A;  2V2J A; 
#chains in the Genus database with same CATH homology
 2V15 A;  4LPM A;  2GYD A;  2QF9 A;  1FHA A;  4ETR A;  3PWQ A;  4E40 A;  1RCC A;  1NFV A;  1VEI A;  4KVQ A;  3GGZ A;  5K52 A;  3AJP A;  3WVU A;  3RGD A;  2FL0 A;  3E1P A;  1GWG A;  2Z5P A;  4LPJ A;  4MXP A;  3FRR A;  4ZL6 A;  5J93 A;  1RCI A;  2C6R A;  4IWJ A;  4PGI A;  4QUW A;  2C2U A;  5J9V A;  3RE7 A;  3JZ9 A;  3R2S A;  4II4 A;  3RBC A;  3AJO A;  3R2L A;  2FG4 A;  1Z4A A;  3BVF A;  3F34 A;  5D8X A;  2VXX A;  1UVH A;  4DYZ A;  5LG8 A;  1IER A;  1Z6O A;  2XKQ A;  4CMY A;  1OTK A;  3PW1 B;  3PVT B;  1S3Q A;  3AF9 X;  3PVR A;  3W54 A;  5E1U A;  1JKV A;  1SQ3 A;  5HQO A;  1HRS A;  4PG0 A;  3R2H A;  2OKC A;  4ISM A;  3KA4 A;  1RCD A;  2CN6 A;  4ZL5 A;  3E6R A;  3AK8 A;  3VNX A;  5FFC A;  2BK6 A;  2FG8 A;  3MPS A;  4M34 A;  2FKZ A;  3E1L A;  4W4K B;  3KDQ A;  1TJO A;  5FFB A;  1ZS3 A;  2ZUR X;  4PG1 A;  3N6O A;  3O7S A;  3IQ1 A;  1R03 A;  1JGC A;  4ZLW A;  3UOI A;  4MUD A;  2WWX B;  1MFR A;  5GOU A;  5HJF A;  2BW1 A;  2V2N A;  3BKN A;  5FFA A;  1LKM A;  1S30 A;  2WTL A;  4TOE A;  4RC6 B;  4TOG A;  4LQH A;  2W0O A;  4IXK A;  2ZA7 A;  1UMN A;  3PW8 A;  3A68 A;  3NP0 X;  1JIG A;  2BKC A;  5J8W A;  4ZKW A;  1L8I A;  5GN8 B;  5CZU A;  2D5K A;  2X17 0;  3E1N A;  4TOB A;  5D8Y A;  1TKO A;  4KXR B;  3SHX A;  4DE6 A;  3C1Z A;  1RYT A;  2FJC A;  1TK6 A;  4DYY A;  4ZTT A;  2ZG9 X;  2ZG8 X;  3C21 A;  3AJQ A;  3ERZ A;  3SH6 A;  4II4 B;  3M6J A;  3FVB A;  2CEI A;  1L8H A;  3OGH A;  3KXU A;  4MJY A;  4EVE A;  4AM2 A;  1DVB A;  3VV9 A;  1YUX A;  5GN8 A;  2C41 A;  1J30 A;  3GHQ A;  3KA8 A;  3E1Q A;  2V2P A;  2HTN A;  3PVR B;  2G4H A;  2FZF A;  3ISE A;  2PYB A;  3KA9 A;  3UOF A;  3R2M A;  1NF4 A;  1O9I A;  2ZA6 A;  1IES A;  3NOZ X;  3BVE A;  4E6K A;  4Y08 A;  5K53 A;  5GU1 X;  3DBY A;  5D8Q A;  2Y3Q A;  5GU0 X;  4P18 A;  1O9R A;  2WLU A;  3EGM A;  2CHI A;  5JDO B;  3UFB A;  2XJN A;  4EVC A;  1TKP A;  3EZ0 A;  1JYB A;  5JKL A;  2CLU A;  3E1J A;  3T9J A;  4CYB A;  1YUZ A;  4DYU A;  5JKM A;  1DPS A;  2GS4 A;  3F38 A;  5CMQ A;  5D8S A;  3E1M A;  4XKT A;  3QZ3 A;  4RC8 A;  3E6S A;  3HIU A;  2FHA A;  2ZA8 A;  4U3G A;  2XGW A;  3A9Q A;  4TOC A;  1VEL A;  1JKU A;  4YVZ A;  3R2K A;  4M35 A;  3JZA B;  2CIH A;  3LKD A;  2HR5 A;  3KX9 A;  4ITT A;  5JDO A;  3F33 A;  4LYU A;  3R2R A;  2Z5Q A;  3GGY A;  4M33 A;  5FFD A;  2JD7 0;  2C2J A;  5I4J A;  2VZB A;  3GE4 A;  1XZ3 A;  4CVR A;  4MN9 A;  3BVI A;  4CMY V;  2YJK A;  3FI6 A;  4Z5S A;  3WVV A;  4Z3B A;  2CHP A;  1BFR A;  5LS9 A;  3SE1 A;  3AF7 X;  2FFX J;  2V2O A;  1AEW A;  1XZ1 A;  1NF6 A;  2ITB A;  3IS7 A;  4A25 A;  3VVA A;  1H96 A;  4X0J A;  1QGH A;  2ZG7 X;  3F32 A;  5JAC A;  3QVD A;  4CYA A;  5CMR A;  1EUM A;  4AM4 A;  4CVS A;  3QD8 A;  4CY9 A;  2GYQ A;  3AF8 X;  3PWQ C;  4EVB A;  4ZJK A;  3QB9 A;  4RC7 B;  1F33 A;  3UNO A;  2YJJ A;  3C23 A;  5C6F A;  3BT5 A;  2AR0 A;  3NP2 X;  2V2S A;  3TA8 A;  3BVK A;  4KVS A;  1LKP A;  5AXS A;  4TO9 A;  1JI5 A;  3QHC A;  5LBH A;  5J8S A;  2Z5R A;  5ERJ A;  1DAT A;  1LKO A;  1VJX A;  4PGK A;  3E2C A;  3WNW A;  4TOA A;  3EZU A;  1QYB A;  2UX1 A;  4RC7 A;  4ZKX A;  4M32 A;  3ISF A;  3Q4R A;  4ZKH A;  2OC5 A;  5GU2 X;  5ERK A;  2V2M A;  2YW7 A;  2CF7 A;  3PVY A;  2RBD A;  2IB0 A;  4TOD A;  4DZ0 A;  4R42 A;  2F7N A;  1VLG A;  3FRS A;  4RC5 A;  2V2I A;  4ERU A;  3D19 A;  2IU2 A;  3Q4O A;  5LG2 A;  4EVD A;  2V2L A;  1BG7 A;  4LPN A;  4DI0 A;  3O7R A;  3F35 A;  2Y44 A;  5JKL G;  4CVT A;  3U90 A;  3KWO A;  3C1Y A;  1RCG A;  5JKM G;  4XKU A;  2CWL A;  1MOJ A;  1JRE A;  4IWK A;  3L0M A;  5IX6 A;  2JD6 0;  5D8R A;  4LYX A;  4XKS A;  2G38 B;  5D8O A;  3PW8 C;  1RCE A;  2V8T A;  4WJG 4;  3OJ5 A;  3AK9 A;  3QHB A;  2YW6 A;  4W4L B;  3Q4N A;  4TOF A;  5FFE A;  3V3K B;  2C2F A;  2CN7 A;  4ML5 A;  4XGS A;  3HL1 A;  4ISP A;  4TOH A;  1YV1 A;  3ES3 A;  4YXM A;  2WLA A;  5FEJ A;  4OYN A;  2Z6M A;  4LQN A;  3PW1 A;  4DYX A;  3PVT A;  1LB3 A;  3IS8 A;  3R2O A;  5HU6 D;  2Z90 A;  4ITW A;  1BCF A;  4MKU A;  4MY7 A;  3E1O A;  4DAS A;  2VXI A;  3KHK A;  2IY4 A;  4AM5 A;  4REU A;  3F36 A;  1B71 A;  4TW3 A;  3F39 A;  2V2R A;  3PZA A;  1Z6O M;  1JTS A;  3PWF A;  2XJO A;  3FSE A;  5HJH A;  3SID A;  4YKH A;  2V8U A;  2OH3 A;  3RD0 A;  3RAV A;  1SOF A;  5D8P A;  3KA3 A;  1ZUJ A;  4LQV A;  5E2D A;  3F37 A;  1NNQ A;  1N1Q A;  1JI4 A;  4ZMC A;  2BJY A;  3PVY B;  2XJM A;  4CVP A;  3BVL A;  3WVW A;  1VEQ A;  1F30 A;  1KRQ A;  4RC5 B;  1S2Z A;  3GVY A;  3H7G A;  4RC6 A;  2N02 A;  3Q4Q A;  5GU3 X;  4KVR A;  2CLB A;  2MGY A;  4LQJ A;  4YXJ A;  2QQY A;  2JD8 0;  3KA6 A;  2V2J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...