3R2RA

1.65a resolution structure of iron soaked ftna from pseudomonas aeruginosa (ph 6.0)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
154
structure length
154
Chain Sequence
MQGHPEVIDYLNTLLTGELAARDQYFIHSRMYEDWGFSKLYERLNHEMEEETQHADALLRRILLLEGTPRMRPDDIHPGTTVPEMLEADLKLERHVRAALAKGIALCEQHKDFVSRDILKAQLADTEEDHAYWLEQQLGLIARMGLENYLQSQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Bacterioferritin
publication title Two distinct ferritin-like molecules in Pseudomonas aeruginosa: the product of the bfrA gene is a bacterial ferritin (FtnA) and not a bacterioferritin (Bfr).
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 73
structure length 154
sequence length 154
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2011-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3r2rA00
3KA3A 4ETRA 3KA4A 4PGKA 3R2OA 2CLUA 1AEWA 4M33A 5FFBA 1J30A 2JD80 4DE6A 2C41A 4YKHA 5HJFA 2V2MA 1DATA 2YJKA 4CYBA 1N1QA 4CMYA 5AXSA 1JKUA 3Q4QA 3QHBA 1QGHA 3T9JA 4TOFA 3NP2X 3E1LA 1Z6OM 1Z6OA 2V2SA 1VEIA 5LG8A 3QZ3A 3WVWA 2C6RA 3KX9A 2YW7A 2FZFA 4ZJKA 4AM5A 2BK6A 1O9IA 3F37A 1TKPA 3FI6A 4DYYA 4XKTA 3WVUA 3H7GA 1B71A 4E6KA 3AK8A 2YW6A 3PW8A 4ZKXA 5JKMA 1Z4AA 3BVLA 5E2DA 2V2LA 1DVBA 1KRQA 1F33A 3E1OA 3R2HA 3Q4OA 4Z5SA 3KA8A 5HJHA 2X170 1VELA 4ISPA 4CVPA 4CYAA 4RC6A 3E1JA 4DI0A 1S30A 1O9RA 2VXIA 1LKPA 1NF6A 4TOAA 1MFRA 3AJQA 3UNOA 5ERKA 2IU2A 1EUMA 3OGHA 4ZL6A 5JKLG 3RAVA 1YUZA 3HL1A 4TOGA 2CIHA 4QUWA 2CEIA 5LG2A 3QD8A 4LYUA 3BVKA 2IB0A 1BFRA 4RC6B 3EZ0A 1XZ1A 4MJYA 4ITTA 5J9VA 2OH3A 3EGMA 4REUA 1OTKA 3O7RA 3AF9X 5D8XA 2FG8A 5D8SA 1VEQA 3WNWA 5FEJA 2IY4A 2FG4A 1F30A 2CN7A 4ZL5A 5J8SA 4OYNA 3PVYA 3ISFA 4LQNA 4XGSA 2WTLA 4TODA 3PWQA 4KVSA 4LQJA 3ISEA 2D5KA 2FKZA 2BJYA 2WLAA 3E6SA 2Y3QA 3PWFA 4PG0A 1IESA 4P18A 2BW1A 2ZG9X 3SH6A 5D8YA 1RYTA 5GU1X 4LQHA 2V2IA 3PVYB 3MPSA 3A68A 2ZA6A 1SQ3A 4AM4A 3RE7A 2WLUA 1BG7A 4LPMA 3R2LA 2VXXA 2CN6A 3E1PA 1JKVA 4TW3A 5GU2X 4ISMA 4II4A 1JI4A 4TOHA 3KA6A 5J93A 5JACA 4PG1A 5CZUA 3R2KA 2ZA7A 2OC5A 5CMRA 5FFEA 4DYUA 4ZKHA 4EVDA 1JGCA 5GU3X 3WVVA 2HTNA 3O7SA 4EVEA 4II4B 2Z90A 2BKCA 5GN8A 2RBDA 2JD60 5C6FA 1NF4A 2JD70 5GU0X 1RCDA 3F38A 4AM2A 3F32A 4CVTA 3GVYA 1R03A 5CMQA 4M34A 1ZUJA 3Q4RA 2QF9A 4XKSA 3AF8X 3UOIA 2CHIA 2UX1A 4LQVA 5D8RA 4CVSA 1JYBA 2YJJA 3HIUA 4ZKWA 5GN8B 4TOEA 2C2JA 3IQ1A 2XJOA 1YUXA 1JI5A 4RC7A 1DPSA 5ERJA 1MOJA 4KVRA 3FSEA 3R2RA 5E1UA 3UOFA 4R42A 4EVBA 3ERZA 2F7NA 4ZTTA 5IX6A 2Z5PA 4MY7A 3PW1A 2CLBA 4Y08A 5LBHA 2C2UA 1BCFA 3F34A 4TOBA 5D8OA 4RC7B 1TKOA 1VLGA 3F33A 4CMYV 2CHPA 3F35A 3RBCA 3TA8A 3ES3A 3RD0A 4IWKA 3KWOA 1L8HA 3SIDA 5JKLA 2Z5RA 4RC8A 3AJPA 3PW1B 4ERUA 3E1NA 1UVHA 3KA9A 2G4HA 2FHAA 1XZ3A 4M32A 4MKUA 5HQOA 1YV1A 5K52A 1S2ZA 2ZG7X 5K53A 2XKQA 2GYDA 4PGIA 1LKMA 2FFXJ 3KXUA 1JIGA 1RCIA 3E2CA 3PVRA 4DYXA 3GE4A 3BT5A 5JKMG 2FL0A 2V2PA 2ITBA 1GWGA 3E1QA 2ZA8A 1RCEA 2XJMA 4TO9A 2V15A 2Z6MA 4ML5A 4LPJA 4IWJA 3E6RA 3E1MA 1NFVA 4U3GA 1TJOA 3NOZX 2QQYA 3F39A 3PVRB 2C2FA 3BVEA 1IERA 4DZ0A 1SOFA 3IS7A 4ZMCA 2GYQA 1QYBA 3PW8C 5J8WA 5LS9A 4ZLWA 3R2SA 1JREA 3A9QA 3AJOA 2ZURX 4DASA 4LPNA 5FFDA 4LYXA 4A25A 4RC5A 1RCGA 3NP0X 3GHQA 5I4JA 4TOCA 4Z3BA 4EVCA 5GOUA 3SHXA 1JTSA 3OJ5A 3QB9A 4RC5B 5D8QA 3SE1A 3PVTA 1L8IA 4CY9A 4DYZA 2VZBA 3EZUA 3BVFA 3VNXA 2FJCA 3AF7X 3F36A 2W0OA 2XJNA 3R2MA 4MN9A 3U90A 1LKOA 1H96A 2XGWA 3Q4NA 1FHAA 1NNQA 2HR5A 2V2RA 2Z5QA 1HRSA 3BKNA 2V2NA 2V2OA 1S3QA 3RGDA 5FFAA 5FFCA 4CVRA 2PYBA 1TK6A 3PVTB 5D8PA 4XKUA 3BVIA 3QHCA 2CF7A 1ZS3A 3FVBA 4KVQA 2ZG8X 1UMNA 3PWQC 4M35A 3PZAA 3IS8A 4IXKA 4MUDA 3AK9A 3QVDA 2V2JA 2GS4A 1RCCA 1VJXA 1LB3A 4ITWA
chains in the Genus database with same CATH superfamily
3KA3A 4ETRA 3KA4A 4PGKA 3R2OA 3GGYA 2CLUA 1AEWA 4M33A 5FFBA 1J30A 2JD80 4DE6A 2C41A 4YKHA 5HJFA 2V2MA 1DATA 2YJKA 4CYBA 1N1QA 4CMYA 5AXSA 1JKUA 3Q4QA 3QHBA 1QGHA 3T9JA 4TOFA 3NP2X 3E1LA 1Z6OM 1Z6OA 2V2SA 1VEIA 4YXJA 5LG8A 3QZ3A 3WVWA 2C6RA 3KX9A 2YW7A 2FZFA 4ZJKA 4AM5A 2BK6A 1O9IA 3F37A 1TKPA 3FI6A 2Y44A 4DYYA 4XKTA 3WVUA 3H7GA 1B71A 4E6KA 3AK8A 2YW6A 3PW8A 4X0JA 4ZKXA 5JKMA 1Z4AA 3BVLA 5E2DA 2V2LA 1DVBA 1KRQA 3UFBA 1F33A 3E1OA 3R2HA 3Q4OA 4Z5SA 3KA8A 3M6JA 5HJHA 2X170 1VELA 4ISPA 4CVPA 4CYAA 4RC6A 3E1JA 4DI0A 1S30A 1O9RA 2VXIA 1LKPA 1NF6A 4TOAA 1MFRA 3AJQA 3UNOA 5ERKA 2IU2A 1EUMA 3OGHA 4ZL6A 5JKLG 3RAVA 1YUZA 3HL1A 4TOGA 2CIHA 3N6OA 4QUWA 2CEIA 5LG2A 3QD8A 4LYUA 3BVKA 2IB0A 1BFRA 4RC6B 3EZ0A 1XZ1A 4MJYA 4ITTA 5J9VA 2OH3A 3EGMA 4REUA 3GGZA 1OTKA 3O7RA 3KDQA 3AF9X 5D8XA 2FG8A 5D8SA 1VEQA 3WNWA 3C21A 5FEJA 2IY4A 2FG4A 1F30A 2CN7A 4ZL5A 3VV9A 5J8SA 3VVAA 4OYNA 3PVYA 3V3KB 3ISFA 4LQNA 4XGSA 2WTLA 4TODA 3PWQA 4KVSA 4LQJA 3ISEA 2D5KA 2FKZA 2BJYA 2WLAA 3E6SA 2WWXB 2Y3QA 3PWFA 3LKDA 4PG0A 1IESA 4P18A 2BW1A 2ZG9X 3SH6A 5D8YA 1RYTA 5GU1X 2N02A 4LQHA 2V2IA 3PVYB 3MPSA 3A68A 3C1ZA 2ZA6A 1SQ3A 4AM4A 3RE7A 2WLUA 1BG7A 4LPMA 3R2LA 2VXXA 2CN6A 3W54A 3E1PA 1JKVA 3FRSA 4TW3A 5GU2X 4ISMA 4E40A 4II4A 2G38B 1JI4A 4TOHA 3KA6A 5J93A 5JACA 4PG1A 5CZUA 3R2KA 2ZA7A 2OC5A 5CMRA 5FFEA 4DYUA 4ZKHA 4EVDA 1JGCA 5GU3X 3WVVA 2HTNA 3O7SA 4EVEA 4II4B 2Z90A 2BKCA 5GN8A 2RBDA 2JD60 5C6FA 1NF4A 2JD70 5GU0X 2V8UA 1RCDA 2AR0A 3F38A 4AM2A 3F32A 4CVTA 3GVYA 1R03A 5CMQA 4M34A 1ZUJA 3Q4RA 3KHKA 2QF9A 4XKSA 3AF8X 3UOIA 2CHIA 2UX1A 4LQVA 5D8RA 4CVSA 1JYBA 2YJJA 3HIUA 4ZKWA 5GN8B 4TOEA 3C1YA 2C2JA 3IQ1A 2XJOA 1YUXA 1JI5A 2CWLA 4RC7A 1DPSA 5ERJA 1MOJA 4KVRA 3FSEA 2OKCA 3R2RA 5E1UA 3UOFA 4R42A 4EVBA 3ERZA 2F7NA 4ZTTA 5IX6A 2Z5PA 4W4KB 4MY7A 3PW1A 2CLBA 4Y08A 5LBHA 3DBYA 2C2UA 1BCFA 3F34A 4TOBA 5D8OA 3D19A 4RC7B 1TKOA 1VLGA 3F33A 4CMYV 2CHPA 3F35A 3RBCA 3TA8A 3ES3A 3RD0A 4IWKA 3KWOA 1L8HA 3SIDA 5JKLA 2Z5RA 4RC8A 3AJPA 3PW1B 5JDOB 4ERUA 4YXMA 3E1NA 1UVHA 3KA9A 2G4HA 2FHAA 1XZ3A 4M32A 4MKUA 5HQOA 1YV1A 5K52A 3L0MA 1S2ZA 2ZG7X 5K53A 4MXPA 2XKQA 2GYDA 4PGIA 1LKMA 2FFXJ 3KXUA 1JIGA 1RCIA 3E2CA 3PVRA 4DYXA 3GE4A 3BT5A 5JKMG 2FL0A 2V2PA 2ITBA 1GWGA 3E1QA 2ZA8A 1RCEA 2XJMA 4TO9A 2V15A 2Z6MA 2V8TA 4ML5A 4LPJA 4IWJA 3E6RA 3E1MA 1NFVA 4U3GA 1TJOA 3NOZX 2QQYA 3F39A 3PVRB 2C2FA 3BVEA 1IERA 4KXRB 4DZ0A 1SOFA 3C23A 3IS7A 4ZMCA 2GYQA 1QYBA 2MGYA 3PW8C 5J8WA 5LS9A 4ZLWA 3R2SA 3FRRA 1JREA 3A9QA 3AJOA 2ZURX 4DASA 5HU6D 4LPNA 5FFDA 4LYXA 4A25A 4RC5A 1RCGA 3NP0X 3GHQA 5I4JA 4TOCA 4Z3BA 4EVCA 5GOUA 3SHXA 4WJG4 3JZ9A 4YVZA 1JTSA 3OJ5A 3QB9A 4RC5B 5D8QA 3SE1A 3PVTA 1L8IA 4CY9A 4DYZA 2VZBA 3EZUA 3BVFA 3VNXA 2FJCA 3AF7X 3F36A 2W0OA 2XJNA 3R2MA 5JDOA 4MN9A 3U90A 1LKOA 1H96A 2XGWA 3Q4NA 1FHAA 1NNQA 2HR5A 2V2RA 2Z5QA 1HRSA 3BKNA 2V2NA 2V2OA 1S3QA 3RGDA 5FFAA 5FFCA 4CVRA 2PYBA 1TK6A 3PVTB 5D8PA 4XKUA 3BVIA 3JZAB 3QHCA 2CF7A 1ZS3A 3FVBA 4KVQA 2ZG8X 1UMNA 3PWQC 4M35A 3PZAA 3IS8A 4IXKA 3AK9A 3QVDA 4MUDA 2V2JA 4W4LB 2GS4A 1RCCA 1VJXA 1LB3A 4ITWA
chains in the Genus database with same CATH topology
3KA3A 4ETRA 3KA4A 4PGKA 3R2OA 3GGYA 2CLUA 1AEWA 4M33A 5FFBA 1J30A 2JD80 4DE6A 2C41A 4YKHA 5HJFA 2V2MA 1DATA 2YJKA 4CYBA 1N1QA 4CMYA 5AXSA 1JKUA 3Q4QA 3QHBA 1QGHA 3T9JA 4TOFA 3NP2X 3E1LA 1Z6OM 1Z6OA 2V2SA 1VEIA 4YXJA 5LG8A 3QZ3A 3WVWA 2C6RA 3KX9A 2YW7A 2FZFA 4ZJKA 4AM5A 2BK6A 1O9IA 3F37A 1TKPA 3FI6A 2Y44A 4DYYA 4XKTA 3WVUA 3H7GA 1B71A 4E6KA 3AK8A 2YW6A 3PW8A 4X0JA 4ZKXA 5JKMA 1Z4AA 3BVLA 5E2DA 2V2LA 1DVBA 1KRQA 3UFBA 1F33A 3E1OA 3R2HA 3Q4OA 4Z5SA 3KA8A 3M6JA 5HJHA 2X170 1VELA 4ISPA 4CVPA 4CYAA 4RC6A 3E1JA 4DI0A 1S30A 1O9RA 2VXIA 1LKPA 1NF6A 4TOAA 1MFRA 3AJQA 3UNOA 5ERKA 2IU2A 1EUMA 3OGHA 4ZL6A 5JKLG 3RAVA 1YUZA 3HL1A 4TOGA 2CIHA 3N6OA 4QUWA 2CEIA 5LG2A 3QD8A 4LYUA 3BVKA 2IB0A 1BFRA 4RC6B 3EZ0A 1XZ1A 4MJYA 4ITTA 5J9VA 2OH3A 3EGMA 4REUA 3GGZA 1OTKA 3O7RA 3KDQA 3AF9X 5D8XA 2FG8A 5D8SA 1VEQA 3WNWA 3C21A 5FEJA 2IY4A 2FG4A 1F30A 2CN7A 4ZL5A 3VV9A 5J8SA 3VVAA 4OYNA 3PVYA 3V3KB 3ISFA 4LQNA 4XGSA 2WTLA 4TODA 3PWQA 4KVSA 4LQJA 3ISEA 2D5KA 2FKZA 2BJYA 2WLAA 3E6SA 2WWXB 2Y3QA 3PWFA 3LKDA 4PG0A 1IESA 4P18A 2BW1A 2ZG9X 3SH6A 5D8YA 1RYTA 5GU1X 2N02A 4LQHA 2V2IA 3PVYB 3MPSA 3A68A 3C1ZA 2ZA6A 1SQ3A 4AM4A 3RE7A 2WLUA 1BG7A 4LPMA 3R2LA 2VXXA 2CN6A 3W54A 3E1PA 1JKVA 3FRSA 4TW3A 5GU2X 4ISMA 4E40A 4II4A 2G38B 1JI4A 4TOHA 3KA6A 5J93A 5JACA 4PG1A 5CZUA 3R2KA 2ZA7A 2OC5A 5CMRA 5FFEA 4DYUA 4ZKHA 4EVDA 1JGCA 5GU3X 3WVVA 2HTNA 3O7SA 4EVEA 4II4B 2Z90A 2BKCA 5GN8A 2RBDA 2JD60 5C6FA 1NF4A 2JD70 5GU0X 2V8UA 1RCDA 2AR0A 3F38A 4AM2A 3F32A 4CVTA 3GVYA 1R03A 5CMQA 4M34A 1ZUJA 3Q4RA 3KHKA 2QF9A 4XKSA 3AF8X 3UOIA 2CHIA 2UX1A 4LQVA 5D8RA 4CVSA 1JYBA 2YJJA 3HIUA 4ZKWA 5GN8B 4TOEA 3C1YA 2C2JA 3IQ1A 2XJOA 1YUXA 1JI5A 2CWLA 4RC7A 1DPSA 5ERJA 1MOJA 4KVRA 3FSEA 2OKCA 3R2RA 5E1UA 3UOFA 4R42A 4EVBA 3ERZA 2F7NA 4ZTTA 5IX6A 2Z5PA 4W4KB 4MY7A 3PW1A 2CLBA 4Y08A 5LBHA 3DBYA 2C2UA 1BCFA 3F34A 4TOBA 5D8OA 3D19A 4RC7B 1TKOA 1VLGA 3F33A 4CMYV 2CHPA 3F35A 3RBCA 3TA8A 3ES3A 3RD0A 4IWKA 3KWOA 1L8HA 3SIDA 5JKLA 2Z5RA 4RC8A 3AJPA 3PW1B 5JDOB 4ERUA 4YXMA 3E1NA 1UVHA 3KA9A 2G4HA 2FHAA 1XZ3A 4M32A 4MKUA 5HQOA 1YV1A 5K52A 3L0MA 1S2ZA 2ZG7X 5K53A 4MXPA 2XKQA 2GYDA 4PGIA 1LKMA 2FFXJ 3KXUA 1JIGA 1RCIA 3E2CA 3PVRA 4DYXA 3GE4A 3BT5A 5JKMG 2FL0A 2V2PA 2ITBA 1GWGA 3E1QA 2ZA8A 1RCEA 2XJMA 4TO9A 2V15A 2Z6MA 2V8TA 4ML5A 4LPJA 4IWJA 3E6RA 3E1MA 1NFVA 4U3GA 1TJOA 3NOZX 2QQYA 3F39A 3PVRB 2C2FA 3BVEA 1IERA 4KXRB 4DZ0A 1SOFA 3C23A 3IS7A 4ZMCA 2GYQA 1QYBA 2MGYA 3PW8C 5J8WA 5LS9A 4ZLWA 3R2SA 3FRRA 1JREA 3A9QA 3AJOA 2ZURX 4DASA 5HU6D 4LPNA 5FFDA 4LYXA 4A25A 4RC5A 1RCGA 3NP0X 3GHQA 5I4JA 4TOCA 4Z3BA 4EVCA 5GOUA 3SHXA 4WJG4 3JZ9A 4YVZA 1JTSA 3OJ5A 3QB9A 4RC5B 5D8QA 3SE1A 3PVTA 1L8IA 4CY9A 4DYZA 2VZBA 3EZUA 3BVFA 3VNXA 2FJCA 3AF7X 3F36A 2W0OA 2XJNA 3R2MA 5JDOA 4MN9A 3U90A 1LKOA 1H96A 2XGWA 3Q4NA 1FHAA 1NNQA 2HR5A 2V2RA 2Z5QA 1HRSA 3BKNA 2V2NA 2V2OA 1S3QA 3RGDA 5FFAA 5FFCA 4CVRA 2PYBA 1TK6A 3PVTB 5D8PA 4XKUA 3BVIA 3JZAB 3QHCA 2CF7A 1ZS3A 3FVBA 4KVQA 2ZG8X 1UMNA 3PWQC 4M35A 3PZAA 3IS8A 4IXKA 3AK9A 3QVDA 4MUDA 2V2JA 4W4LB 2GS4A 1RCCA 1VJXA 1LB3A 4ITWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KA3 A;  4ETR A;  3KA4 A;  4PGK A;  3R2O A;  2CLU A;  1AEW A;  4M33 A;  5FFB A;  1J30 A;  2JD8 0;  4DE6 A;  2C41 A;  4YKH A;  5HJF A;  2V2M A;  1DAT A;  2YJK A;  4CYB A;  1N1Q A;  4CMY A;  5AXS A;  1JKU A;  3Q4Q A;  3QHB A;  1QGH A;  3T9J A;  4TOF A;  3NP2 X;  3E1L A;  1Z6O M;  1Z6O A;  2V2S A;  1VEI A;  5LG8 A;  3QZ3 A;  3WVW A;  2C6R A;  3KX9 A;  2YW7 A;  2FZF A;  4ZJK A;  4AM5 A;  2BK6 A;  1O9I A;  3F37 A;  1TKP A;  3FI6 A;  4DYY A;  4XKT A;  3WVU A;  3H7G A;  1B71 A;  4E6K A;  3AK8 A;  2YW6 A;  3PW8 A;  4ZKX A;  5JKM A;  1Z4A A;  3BVL A;  5E2D A;  2V2L A;  1DVB A;  1KRQ A;  1F33 A;  3E1O A;  3R2H A;  3Q4O A;  4Z5S A;  3KA8 A;  5HJH A;  2X17 0;  1VEL A;  4ISP A;  4CVP A;  4CYA A;  4RC6 A;  3E1J A;  4DI0 A;  1S30 A;  1O9R A;  2VXI A;  1LKP A;  1NF6 A;  4TOA A;  1MFR A;  3AJQ A;  3UNO A;  5ERK A;  2IU2 A;  1EUM A;  3OGH A;  4ZL6 A;  5JKL G;  3RAV A;  1YUZ A;  3HL1 A;  4TOG A;  2CIH A;  4QUW A;  2CEI A;  5LG2 A;  3QD8 A;  4LYU A;  3BVK A;  2IB0 A;  1BFR A;  4RC6 B;  3EZ0 A;  1XZ1 A;  4MJY A;  4ITT A;  5J9V A;  2OH3 A;  3EGM A;  4REU A;  1OTK A;  3O7R A;  3AF9 X;  5D8X A;  2FG8 A;  5D8S A;  1VEQ A;  3WNW A;  5FEJ A;  2IY4 A;  2FG4 A;  1F30 A;  2CN7 A;  4ZL5 A;  5J8S A;  4OYN A;  3PVY A;  3ISF A;  4LQN A;  4XGS A;  2WTL A;  4TOD A;  3PWQ A;  4KVS A;  4LQJ A;  3ISE A;  2D5K A;  2FKZ A;  2BJY A;  2WLA A;  3E6S A;  2Y3Q A;  3PWF A;  4PG0 A;  1IES A;  4P18 A;  2BW1 A;  2ZG9 X;  3SH6 A;  5D8Y A;  1RYT A;  5GU1 X;  4LQH A;  2V2I A;  3PVY B;  3MPS A;  3A68 A;  2ZA6 A;  1SQ3 A;  4AM4 A;  3RE7 A;  2WLU A;  1BG7 A;  4LPM A;  3R2L A;  2VXX A;  2CN6 A;  3E1P A;  1JKV A;  4TW3 A;  5GU2 X;  4ISM A;  4II4 A;  1JI4 A;  4TOH A;  3KA6 A;  5J93 A;  5JAC A;  4PG1 A;  5CZU A;  3R2K A;  2ZA7 A;  2OC5 A;  5CMR A;  5FFE A;  4DYU A;  4ZKH A;  4EVD A;  1JGC A;  5GU3 X;  3WVV A;  2HTN A;  3O7S A;  4EVE A;  4II4 B;  2Z90 A;  2BKC A;  5GN8 A;  2RBD A;  2JD6 0;  5C6F A;  1NF4 A;  2JD7 0;  5GU0 X;  1RCD A;  3F38 A;  4AM2 A;  3F32 A;  4CVT A;  3GVY A;  1R03 A;  5CMQ A;  4M34 A;  1ZUJ A;  3Q4R A;  2QF9 A;  4XKS A;  3AF8 X;  3UOI A;  2CHI A;  2UX1 A;  4LQV A;  5D8R A;  4CVS A;  1JYB A;  2YJJ A;  3HIU A;  4ZKW A;  5GN8 B;  4TOE A;  2C2J A;  3IQ1 A;  2XJO A;  1YUX A;  1JI5 A;  4RC7 A;  1DPS A;  5ERJ A;  1MOJ A;  4KVR A;  3FSE A;  3R2R A;  5E1U A;  3UOF A;  4R42 A;  4EVB A;  3ERZ A;  2F7N A;  4ZTT A;  5IX6 A;  2Z5P A;  4MY7 A;  3PW1 A;  2CLB A;  4Y08 A;  5LBH A;  2C2U A;  1BCF A;  3F34 A;  4TOB A;  5D8O A;  4RC7 B;  1TKO A;  1VLG A;  3F33 A;  4CMY V;  2CHP A;  3F35 A;  3RBC A;  3TA8 A;  3ES3 A;  3RD0 A;  4IWK A;  3KWO A;  1L8H A;  3SID A;  5JKL A;  2Z5R A;  4RC8 A;  3AJP A;  3PW1 B;  4ERU A;  3E1N A;  1UVH A;  3KA9 A;  2G4H A;  2FHA A;  1XZ3 A;  4M32 A;  4MKU A;  5HQO A;  1YV1 A;  5K52 A;  1S2Z A;  2ZG7 X;  5K53 A;  2XKQ A;  2GYD A;  4PGI A;  1LKM A;  2FFX J;  3KXU A;  1JIG A;  1RCI A;  3E2C A;  3PVR A;  4DYX A;  3GE4 A;  3BT5 A;  5JKM G;  2FL0 A;  2V2P A;  2ITB A;  1GWG A;  3E1Q A;  2ZA8 A;  1RCE A;  2XJM A;  4TO9 A;  2V15 A;  2Z6M A;  4ML5 A;  4LPJ A;  4IWJ A;  3E6R A;  3E1M A;  1NFV A;  4U3G A;  1TJO A;  3NOZ X;  2QQY A;  3F39 A;  3PVR B;  2C2F A;  3BVE A;  1IER A;  4DZ0 A;  1SOF A;  3IS7 A;  4ZMC A;  2GYQ A;  1QYB A;  3PW8 C;  5J8W A;  5LS9 A;  4ZLW A;  3R2S A;  1JRE A;  3A9Q A;  3AJO A;  2ZUR X;  4DAS A;  4LPN A;  5FFD A;  4LYX A;  4A25 A;  4RC5 A;  1RCG A;  3NP0 X;  3GHQ A;  5I4J A;  4TOC A;  4Z3B A;  4EVC A;  5GOU A;  3SHX A;  1JTS A;  3OJ5 A;  3QB9 A;  4RC5 B;  5D8Q A;  3SE1 A;  3PVT A;  1L8I A;  4CY9 A;  4DYZ A;  2VZB A;  3EZU A;  3BVF A;  3VNX A;  2FJC A;  3AF7 X;  3F36 A;  2W0O A;  2XJN A;  3R2M A;  4MN9 A;  3U90 A;  1LKO A;  1H96 A;  2XGW A;  3Q4N A;  1FHA A;  1NNQ A;  2HR5 A;  2V2R A;  2Z5Q A;  1HRS A;  3BKN A;  2V2N A;  2V2O A;  1S3Q A;  3RGD A;  5FFA A;  5FFC A;  4CVR A;  2PYB A;  1TK6 A;  3PVT B;  5D8P A;  4XKU A;  3BVI A;  3QHC A;  2CF7 A;  1ZS3 A;  3FVB A;  4KVQ A;  2ZG8 X;  1UMN A;  3PWQ C;  4M35 A;  3PZA A;  3IS8 A;  4IXK A;  4MUD A;  3AK9 A;  3QVD A;  2V2J A;  2GS4 A;  1RCC A;  1VJX A;  1LB3 A;  4ITW A; 
#chains in the Genus database with same CATH topology
 3KA3 A;  4ETR A;  3KA4 A;  4PGK A;  3R2O A;  3GGY A;  2CLU A;  1AEW A;  4M33 A;  5FFB A;  1J30 A;  2JD8 0;  4DE6 A;  2C41 A;  4YKH A;  5HJF A;  2V2M A;  1DAT A;  2YJK A;  4CYB A;  1N1Q A;  4CMY A;  5AXS A;  1JKU A;  3Q4Q A;  3QHB A;  1QGH A;  3T9J A;  4TOF A;  3NP2 X;  3E1L A;  1Z6O M;  1Z6O A;  2V2S A;  1VEI A;  4YXJ A;  5LG8 A;  3QZ3 A;  3WVW A;  2C6R A;  3KX9 A;  2YW7 A;  2FZF A;  4ZJK A;  4AM5 A;  2BK6 A;  1O9I A;  3F37 A;  1TKP A;  3FI6 A;  2Y44 A;  4DYY A;  4XKT A;  3WVU A;  3H7G A;  1B71 A;  4E6K A;  3AK8 A;  2YW6 A;  3PW8 A;  4X0J A;  4ZKX A;  5JKM A;  1Z4A A;  3BVL A;  5E2D A;  2V2L A;  1DVB A;  1KRQ A;  3UFB A;  1F33 A;  3E1O A;  3R2H A;  3Q4O A;  4Z5S A;  3KA8 A;  3M6J A;  5HJH A;  2X17 0;  1VEL A;  4ISP A;  4CVP A;  4CYA A;  4RC6 A;  3E1J A;  4DI0 A;  1S30 A;  1O9R A;  2VXI A;  1LKP A;  1NF6 A;  4TOA A;  1MFR A;  3AJQ A;  3UNO A;  5ERK A;  2IU2 A;  1EUM A;  3OGH A;  4ZL6 A;  5JKL G;  3RAV A;  1YUZ A;  3HL1 A;  4TOG A;  2CIH A;  3N6O A;  4QUW A;  2CEI A;  5LG2 A;  3QD8 A;  4LYU A;  3BVK A;  2IB0 A;  1BFR A;  4RC6 B;  3EZ0 A;  1XZ1 A;  4MJY A;  4ITT A;  5J9V A;  2OH3 A;  3EGM A;  4REU A;  3GGZ A;  1OTK A;  3O7R A;  3KDQ A;  3AF9 X;  5D8X A;  2FG8 A;  5D8S A;  1VEQ A;  3WNW A;  3C21 A;  5FEJ A;  2IY4 A;  2FG4 A;  1F30 A;  2CN7 A;  4ZL5 A;  3VV9 A;  5J8S A;  3VVA A;  4OYN A;  3PVY A;  3V3K B;  3ISF A;  4LQN A;  4XGS A;  2WTL A;  4TOD A;  3PWQ A;  4KVS A;  4LQJ A;  3ISE A;  2D5K A;  2FKZ A;  2BJY A;  2WLA A;  3E6S A;  2WWX B;  2Y3Q A;  3PWF A;  3LKD A;  4PG0 A;  1IES A;  4P18 A;  2BW1 A;  2ZG9 X;  3SH6 A;  5D8Y A;  1RYT A;  5GU1 X;  2N02 A;  4LQH A;  2V2I A;  3PVY B;  3MPS A;  3A68 A;  3C1Z A;  2ZA6 A;  1SQ3 A;  4AM4 A;  3RE7 A;  2WLU A;  1BG7 A;  4LPM A;  3R2L A;  2VXX A;  2CN6 A;  3W54 A;  3E1P A;  1JKV A;  3FRS A;  4TW3 A;  5GU2 X;  4ISM A;  4E40 A;  4II4 A;  2G38 B;  1JI4 A;  4TOH A;  3KA6 A;  5J93 A;  5JAC A;  4PG1 A;  5CZU A;  3R2K A;  2ZA7 A;  2OC5 A;  5CMR A;  5FFE A;  4DYU A;  4ZKH A;  4EVD A;  1JGC A;  5GU3 X;  3WVV A;  2HTN A;  3O7S A;  4EVE A;  4II4 B;  2Z90 A;  2BKC A;  5GN8 A;  2RBD A;  2JD6 0;  5C6F A;  1NF4 A;  2JD7 0;  5GU0 X;  2V8U A;  1RCD A;  2AR0 A;  3F38 A;  4AM2 A;  3F32 A;  4CVT A;  3GVY A;  1R03 A;  5CMQ A;  4M34 A;  1ZUJ A;  3Q4R A;  3KHK A;  2QF9 A;  4XKS A;  3AF8 X;  3UOI A;  2CHI A;  2UX1 A;  4LQV A;  5D8R A;  4CVS A;  1JYB A;  2YJJ A;  3HIU A;  4ZKW A;  5GN8 B;  4TOE A;  3C1Y A;  2C2J A;  3IQ1 A;  2XJO A;  1YUX A;  1JI5 A;  2CWL A;  4RC7 A;  1DPS A;  5ERJ A;  1MOJ A;  4KVR A;  3FSE A;  2OKC A;  3R2R A;  5E1U A;  3UOF A;  4R42 A;  4EVB A;  3ERZ A;  2F7N A;  4ZTT A;  5IX6 A;  2Z5P A;  4W4K B;  4MY7 A;  3PW1 A;  2CLB A;  4Y08 A;  5LBH A;  3DBY A;  2C2U A;  1BCF A;  3F34 A;  4TOB A;  5D8O A;  3D19 A;  4RC7 B;  1TKO A;  1VLG A;  3F33 A;  4CMY V;  2CHP A;  3F35 A;  3RBC A;  3TA8 A;  3ES3 A;  3RD0 A;  4IWK A;  3KWO A;  1L8H A;  3SID A;  5JKL A;  2Z5R A;  4RC8 A;  3AJP A;  3PW1 B;  5JDO B;  4ERU A;  4YXM A;  3E1N A;  1UVH A;  3KA9 A;  2G4H A;  2FHA A;  1XZ3 A;  4M32 A;  4MKU A;  5HQO A;  1YV1 A;  5K52 A;  3L0M A;  1S2Z A;  2ZG7 X;  5K53 A;  4MXP A;  2XKQ A;  2GYD A;  4PGI A;  1LKM A;  2FFX J;  3KXU A;  1JIG A;  1RCI A;  3E2C A;  3PVR A;  4DYX A;  3GE4 A;  3BT5 A;  5JKM G;  2FL0 A;  2V2P A;  2ITB A;  1GWG A;  3E1Q A;  2ZA8 A;  1RCE A;  2XJM A;  4TO9 A;  2V15 A;  2Z6M A;  2V8T A;  4ML5 A;  4LPJ A;  4IWJ A;  3E6R A;  3E1M A;  1NFV A;  4U3G A;  1TJO A;  3NOZ X;  2QQY A;  3F39 A;  3PVR B;  2C2F A;  3BVE A;  1IER A;  4KXR B;  4DZ0 A;  1SOF A;  3C23 A;  3IS7 A;  4ZMC A;  2GYQ A;  1QYB A;  2MGY A;  3PW8 C;  5J8W A;  5LS9 A;  4ZLW A;  3R2S A;  3FRR A;  1JRE A;  3A9Q A;  3AJO A;  2ZUR X;  4DAS A;  5HU6 D;  4LPN A;  5FFD A;  4LYX A;  4A25 A;  4RC5 A;  1RCG A;  3NP0 X;  3GHQ A;  5I4J A;  4TOC A;  4Z3B A;  4EVC A;  5GOU A;  3SHX A;  4WJG 4;  3JZ9 A;  4YVZ A;  1JTS A;  3OJ5 A;  3QB9 A;  4RC5 B;  5D8Q A;  3SE1 A;  3PVT A;  1L8I A;  4CY9 A;  4DYZ A;  2VZB A;  3EZU A;  3BVF A;  3VNX A;  2FJC A;  3AF7 X;  3F36 A;  2W0O A;  2XJN A;  3R2M A;  5JDO A;  4MN9 A;  3U90 A;  1LKO A;  1H96 A;  2XGW A;  3Q4N A;  1FHA A;  1NNQ A;  2HR5 A;  2V2R A;  2Z5Q A;  1HRS A;  3BKN A;  2V2N A;  2V2O A;  1S3Q A;  3RGD A;  5FFA A;  5FFC A;  4CVR A;  2PYB A;  1TK6 A;  3PVT B;  5D8P A;  4XKU A;  3BVI A;  3JZA B;  3QHC A;  2CF7 A;  1ZS3 A;  3FVB A;  4KVQ A;  2ZG8 X;  1UMN A;  3PWQ C;  4M35 A;  3PZA A;  3IS8 A;  4IXK A;  3AK9 A;  3QVD A;  4MUD A;  2V2J A;  4W4L B;  2GS4 A;  1RCC A;  1VJX A;  1LB3 A;  4ITW A; 
#chains in the Genus database with same CATH homology
 3KA3 A;  4ETR A;  3KA4 A;  4PGK A;  3R2O A;  3GGY A;  2CLU A;  1AEW A;  4M33 A;  5FFB A;  1J30 A;  2JD8 0;  4DE6 A;  2C41 A;  4YKH A;  5HJF A;  2V2M A;  1DAT A;  2YJK A;  4CYB A;  1N1Q A;  4CMY A;  5AXS A;  1JKU A;  3Q4Q A;  3QHB A;  1QGH A;  3T9J A;  4TOF A;  3NP2 X;  3E1L A;  1Z6O M;  1Z6O A;  2V2S A;  1VEI A;  4YXJ A;  5LG8 A;  3QZ3 A;  3WVW A;  2C6R A;  3KX9 A;  2YW7 A;  2FZF A;  4ZJK A;  4AM5 A;  2BK6 A;  1O9I A;  3F37 A;  1TKP A;  3FI6 A;  2Y44 A;  4DYY A;  4XKT A;  3WVU A;  3H7G A;  1B71 A;  4E6K A;  3AK8 A;  2YW6 A;  3PW8 A;  4X0J A;  4ZKX A;  5JKM A;  1Z4A A;  3BVL A;  5E2D A;  2V2L A;  1DVB A;  1KRQ A;  3UFB A;  1F33 A;  3E1O A;  3R2H A;  3Q4O A;  4Z5S A;  3KA8 A;  3M6J A;  5HJH A;  2X17 0;  1VEL A;  4ISP A;  4CVP A;  4CYA A;  4RC6 A;  3E1J A;  4DI0 A;  1S30 A;  1O9R A;  2VXI A;  1LKP A;  1NF6 A;  4TOA A;  1MFR A;  3AJQ A;  3UNO A;  5ERK A;  2IU2 A;  1EUM A;  3OGH A;  4ZL6 A;  5JKL G;  3RAV A;  1YUZ A;  3HL1 A;  4TOG A;  2CIH A;  3N6O A;  4QUW A;  2CEI A;  5LG2 A;  3QD8 A;  4LYU A;  3BVK A;  2IB0 A;  1BFR A;  4RC6 B;  3EZ0 A;  1XZ1 A;  4MJY A;  4ITT A;  5J9V A;  2OH3 A;  3EGM A;  4REU A;  3GGZ A;  1OTK A;  3O7R A;  3KDQ A;  3AF9 X;  5D8X A;  2FG8 A;  5D8S A;  1VEQ A;  3WNW A;  3C21 A;  5FEJ A;  2IY4 A;  2FG4 A;  1F30 A;  2CN7 A;  4ZL5 A;  3VV9 A;  5J8S A;  3VVA A;  4OYN A;  3PVY A;  3V3K B;  3ISF A;  4LQN A;  4XGS A;  2WTL A;  4TOD A;  3PWQ A;  4KVS A;  4LQJ A;  3ISE A;  2D5K A;  2FKZ A;  2BJY A;  2WLA A;  3E6S A;  2WWX B;  2Y3Q A;  3PWF A;  3LKD A;  4PG0 A;  1IES A;  4P18 A;  2BW1 A;  2ZG9 X;  3SH6 A;  5D8Y A;  1RYT A;  5GU1 X;  2N02 A;  4LQH A;  2V2I A;  3PVY B;  3MPS A;  3A68 A;  3C1Z A;  2ZA6 A;  1SQ3 A;  4AM4 A;  3RE7 A;  2WLU A;  1BG7 A;  4LPM A;  3R2L A;  2VXX A;  2CN6 A;  3W54 A;  3E1P A;  1JKV A;  3FRS A;  4TW3 A;  5GU2 X;  4ISM A;  4E40 A;  4II4 A;  2G38 B;  1JI4 A;  4TOH A;  3KA6 A;  5J93 A;  5JAC A;  4PG1 A;  5CZU A;  3R2K A;  2ZA7 A;  2OC5 A;  5CMR A;  5FFE A;  4DYU A;  4ZKH A;  4EVD A;  1JGC A;  5GU3 X;  3WVV A;  2HTN A;  3O7S A;  4EVE A;  4II4 B;  2Z90 A;  2BKC A;  5GN8 A;  2RBD A;  2JD6 0;  5C6F A;  1NF4 A;  2JD7 0;  5GU0 X;  2V8U A;  1RCD A;  2AR0 A;  3F38 A;  4AM2 A;  3F32 A;  4CVT A;  3GVY A;  1R03 A;  5CMQ A;  4M34 A;  1ZUJ A;  3Q4R A;  3KHK A;  2QF9 A;  4XKS A;  3AF8 X;  3UOI A;  2CHI A;  2UX1 A;  4LQV A;  5D8R A;  4CVS A;  1JYB A;  2YJJ A;  3HIU A;  4ZKW A;  5GN8 B;  4TOE A;  3C1Y A;  2C2J A;  3IQ1 A;  2XJO A;  1YUX A;  1JI5 A;  2CWL A;  4RC7 A;  1DPS A;  5ERJ A;  1MOJ A;  4KVR A;  3FSE A;  2OKC A;  3R2R A;  5E1U A;  3UOF A;  4R42 A;  4EVB A;  3ERZ A;  2F7N A;  4ZTT A;  5IX6 A;  2Z5P A;  4W4K B;  4MY7 A;  3PW1 A;  2CLB A;  4Y08 A;  5LBH A;  3DBY A;  2C2U A;  1BCF A;  3F34 A;  4TOB A;  5D8O A;  3D19 A;  4RC7 B;  1TKO A;  1VLG A;  3F33 A;  4CMY V;  2CHP A;  3F35 A;  3RBC A;  3TA8 A;  3ES3 A;  3RD0 A;  4IWK A;  3KWO A;  1L8H A;  3SID A;  5JKL A;  2Z5R A;  4RC8 A;  3AJP A;  3PW1 B;  5JDO B;  4ERU A;  4YXM A;  3E1N A;  1UVH A;  3KA9 A;  2G4H A;  2FHA A;  1XZ3 A;  4M32 A;  4MKU A;  5HQO A;  1YV1 A;  5K52 A;  3L0M A;  1S2Z A;  2ZG7 X;  5K53 A;  4MXP A;  2XKQ A;  2GYD A;  4PGI A;  1LKM A;  2FFX J;  3KXU A;  1JIG A;  1RCI A;  3E2C A;  3PVR A;  4DYX A;  3GE4 A;  3BT5 A;  5JKM G;  2FL0 A;  2V2P A;  2ITB A;  1GWG A;  3E1Q A;  2ZA8 A;  1RCE A;  2XJM A;  4TO9 A;  2V15 A;  2Z6M A;  2V8T A;  4ML5 A;  4LPJ A;  4IWJ A;  3E6R A;  3E1M A;  1NFV A;  4U3G A;  1TJO A;  3NOZ X;  2QQY A;  3F39 A;  3PVR B;  2C2F A;  3BVE A;  1IER A;  4KXR B;  4DZ0 A;  1SOF A;  3C23 A;  3IS7 A;  4ZMC A;  2GYQ A;  1QYB A;  2MGY A;  3PW8 C;  5J8W A;  5LS9 A;  4ZLW A;  3R2S A;  3FRR A;  1JRE A;  3A9Q A;  3AJO A;  2ZUR X;  4DAS A;  5HU6 D;  4LPN A;  5FFD A;  4LYX A;  4A25 A;  4RC5 A;  1RCG A;  3NP0 X;  3GHQ A;  5I4J A;  4TOC A;  4Z3B A;  4EVC A;  5GOU A;  3SHX A;  4WJG 4;  3JZ9 A;  4YVZ A;  1JTS A;  3OJ5 A;  3QB9 A;  4RC5 B;  5D8Q A;  3SE1 A;  3PVT A;  1L8I A;  4CY9 A;  4DYZ A;  2VZB A;  3EZU A;  3BVF A;  3VNX A;  2FJC A;  3AF7 X;  3F36 A;  2W0O A;  2XJN A;  3R2M A;  5JDO A;  4MN9 A;  3U90 A;  1LKO A;  1H96 A;  2XGW A;  3Q4N A;  1FHA A;  1NNQ A;  2HR5 A;  2V2R A;  2Z5Q A;  1HRS A;  3BKN A;  2V2N A;  2V2O A;  1S3Q A;  3RGD A;  5FFA A;  5FFC A;  4CVR A;  2PYB A;  1TK6 A;  3PVT B;  5D8P A;  4XKU A;  3BVI A;  3JZA B;  3QHC A;  2CF7 A;  1ZS3 A;  3FVB A;  4KVQ A;  2ZG8 X;  1UMN A;  3PWQ C;  4M35 A;  3PZA A;  3IS8 A;  4IXK A;  3AK9 A;  3QVD A;  4MUD A;  2V2J A;  4W4L B;  2GS4 A;  1RCC A;  1VJX A;  1LB3 A;  4ITW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...