1NF4A

X-ray structure of the desulfovibrio desulfuricans bacterioferritin: the diiron site in different states (reduced structure)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
169
structure length
169
Chain Sequence
NREDRKAKVIEVLNKARAMELHAIHQYMNQHYSLDDMDYGELAANMKLIAIDEMRHAENFAERIKELGGEPTTQKEGKVVTGQAVPVIYESDADQEDATIEAYSQFLKVCKEQGDIVTARLFERIIEEEQAHLTYYENIGSHIKNLGDTYLAKIAGTPSSTGTASKGFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Iron storage/electron transport
molecule keywords bacterioferritin
publication title The nature of the di-iron site in the bacterioferritin from Desulfovibrio desulfuricans
pubmed doi rcsb
total genus 74
structure length 169
sequence length 169
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2002-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1nf4A00
5GN8A 1L8HA 5FFCA 3Q4OA 4MUDA 1MOJA 4II4B 3WVUA 5D8YA 1SOFA 2XJMA 2WTLA 5AXSA 3RE7A 2Y3QA 3KX9A 3IS8A 3FSEA 1EUMA 3PW8C 3SE1A 2ZG9X 2JD70 3BVFA 2C41A 3F35A 4LQHA 3EZ0A 4IWKA 5D8SA 2ZA6A 3A9QA 1TK6A 3RD0A 4TOFA 4DYUA 3NP0X 4CVRA 4TOGA 3R2MA 4M32A 2VZBA 3EZUA 4EVBA 4OYNA 3BT5A 3PW1B 3PW1A 4R42A 2GYQA 2CLBA 2YW7A 5HJFA 2HR5A 2FHAA 2FL0A 4M34A 1TJOA 4LPJA 4MJYA 3E6RA 4TW3A 2WLAA 3UOFA 3PVTA 2XKQA 2FJCA 3F36A 3AF7X 1VLGA 4CVTA 2RBDA 5D8PA 3T9JA 4TODA 1FHAA 4U3GA 3GE4A 2V15A 1S30A 3OJ5A 4DI0A 3E1LA 1OTKA 5D8OA 1RCIA 3E1NA 5J8WA 4Y08A 3BKNA 3TA8A 2IY4A 1QYBA 3ISFA 4ML5A 5LG8A 2W0OA 2G4HA 4ZJKA 3E6SA 1VEIA 4ISPA 3PWQC 3IS7A 3NP2X 1BG7A 3HL1A 4ZMCA 2OC5A 1VEQA 2V2RA 3AJPA 4DZ0A 4LYUA 4ZKWA 2V2SA 4ZLWA 5E2DA 4DE6A 1F30A 2ZG8X 3SH6A 4KVQA 4RC5A 1BCFA 3PVRA 1R03A 3Q4NA 2PYBA 1QGHA 3O7RA 5HQOA 4ZL5A 4DYXA 1DPSA 3QVDA 3IQ1A 2XJNA 3PZAA 1NFVA 3PWQA 2X170 4XKUA 2Z5PA 1JI4A 4A25A 2V2IA 3PWFA 1AEWA 4LQNA 2YJKA 4PG0A 1J30A 3BVKA 2FG4A 3R2OA 5CZUA 5LS9A 3F38A 1BFRA 1YUZA 3F37A 3AK9A 1B71A 4IWJA 1L8IA 2FKZA 4ZKHA 2ITBA 1NF6A 2ZA8A 1YUXA 2D5KA 4LPMA 2V2OA 2CN6A 1LKMA 4PGKA 4ISMA 5GU1X 3KA4A 3KA6A 3PW8A 1S3QA 3ES3A 2ZA7A 2Z90A 2V2PA 3AF9X 3QHCA 3GVYA 1LB3A 3H7GA 4DASA 1O9RA 5JKMG 1YV1A 1IERA 4ERUA 2XGWA 2CHPA 4REUA 4KVSA 5FEJA 3PVTB 3BVLA 2BJYA 2CIHA 4XKSA 4P18A 1LKOA 2BKCA 4RC7B 3A68A 4RC7A 4Z3BA 3KWOA 4CVPA 5IX6A 5HJHA 1XZ1A 5JACA 1UMNA 3F34A 4CVSA 2UX1A 1RCDA 1JREA 3R2SA 3SIDA 2IB0A 2IU2A 2VXIA 1JKUA 3RAVA 4DYZA 5LBHA 5FFEA 5D8QA 3R2HA 1JTSA 3U90A 4ITWA 4CMYV 4CYBA 3BVEA 4MN9A 4ETRA 4RC6B 4RC6A 4Z5SA 2ZG7X 4CYAA 1JIGA 2CF7A 1Z4AA 4YKHA 2WLUA 3Q4QA 4ZL6A 4TOCA 1XZ3A 3WVWA 3KA8A 4ZTTA 3E1QA 4M35A 2FZFA 2CN7A 5GU3X 1JYBA 4RC5B 5I4JA 3PVRB 2XJOA 3ISEA 2QQYA 4M33A 1HRSA 1Z6OM 4IXKA 4EVDA 4XGSA 5JKLA 4LPNA 3F32A 3KA9A 5ERJA 3RBCA 2CLUA 3R2LA 1UVHA 4TOEA 4AM2A 3R2KA 2YJJA 4TOBA 4ZKXA 2C2JA 2ZURX 3PVYB 3PVYA 5K53A 3BVIA 2FFXJ 3AJOA 2V2LA 1NF4A 3GHQA 4II4A 3UNOA 1H96A 4E6KA 3HIUA 1JKVA 3QHBA 1F33A 1ZUJA 3WVVA 3Q4RA 5D8RA 5FFBA 1TKOA 5ERKA 5LG2A 2Z5RA 2F7NA 2GYDA 1DVBA 5GU0X 5FFAA 3O7SA 3OGHA 1IESA 1N1QA 1VELA 3E1PA 3KA3A 1SQ3A 1DATA 2FG8A 3NOZX 1JI5A 3AJQA 2JD80 5D8XA 1GWGA 4LQJA 2BK6A 5GU2X 4AM4A 3QZ3A 3WNWA 3AK8A 2VXXA 2YW6A 5C6FA 1TKPA 2V2NA 4XKTA 5J93A 1VJXA 2C6RA 2CEIA 5FFDA 3E1MA 1RCCA 5JKMA 3RGDA 3F39A 3VNXA 4PGIA 2QF9A 4CMYA 5J9VA 3E2CA 5K52A 3ERZA 1KRQA 1Z6OA 1RCGA 3EGMA 3AF8X 4RC8A 5E1UA 3FI6A 3MPSA 2OH3A 3UOIA 4LQVA 4ITTA 1RYTA 3SHXA 3QB9A 3E1JA 4EVCA 1RCEA 2C2UA 3E1OA 2Z5QA 5CMQA 1JGCA 5J8SA 4KVRA 4MKUA 4LYXA 2JD60 4DYYA 4TOHA 4MY7A 2CHIA 4EVEA 1S2ZA 2V2MA 4QUWA 3FVBA 1O9IA 1MFRA 4AM5A 3F33A 3QD8A 5GOUA 2BW1A 4CY9A 5JKLG 1LKPA 1NNQA 2V2JA 3KXUA 5CMRA 4TOAA 2GS4A 2C2FA 4PG1A 2HTNA 2Z6MA 4TO9A 1ZS3A 3R2RA 5GN8B
chains in the Genus database with same CATH superfamily
5GN8A 1L8HA 5FFCA 3FRSA 3Q4OA 4MUDA 1MOJA 4II4B 3WVUA 3VVAA 5D8YA 1SOFA 2XJMA 2WTLA 5AXSA 3RE7A 2Y3QA 3KX9A 3IS8A 3FSEA 1EUMA 3PW8C 3SE1A 2ZG9X 2JD70 3BVFA 2C41A 3C21A 3F35A 4LQHA 3EZ0A 4IWKA 3M6JA 5D8SA 3W54A 2ZA6A 3A9QA 1TK6A 3RD0A 4TOFA 4DYUA 3NP0X 4CVRA 4TOGA 3R2MA 4M32A 2VZBA 3EZUA 3VV9A 4EVBA 4OYNA 3BT5A 3PW1B 3PW1A 4R42A 2GYQA 2CLBA 2YW7A 5HJFA 2HR5A 2FHAA 2FL0A 4M34A 1TJOA 4LPJA 4YXJA 4MJYA 3E6RA 4YXMA 4TW3A 2WLAA 3UOFA 2MGYA 3PVTA 4W4KB 2XKQA 2FJCA 3F36A 3AF7X 1VLGA 4CVTA 2RBDA 2OKCA 5D8PA 3T9JA 4TODA 1FHAA 2V8TA 4U3GA 3GE4A 4WJG4 2V15A 1S30A 3OJ5A 4DI0A 3E1LA 3L0MA 1OTKA 5D8OA 4MXPA 1RCIA 3E1NA 5J8WA 2WWXB 4Y08A 3BKNA 3TA8A 2IY4A 1QYBA 2CWLA 3ISFA 4ML5A 5LG8A 2W0OA 2G4HA 4ZJKA 3E6SA 1VEIA 4ISPA 3PWQC 3IS7A 3NP2X 1BG7A 3HL1A 4ZMCA 2OC5A 3V3KB 1VEQA 3GGZA 2V2RA 3AJPA 4DZ0A 4LYUA 4W4LB 4ZKWA 2V2SA 4ZLWA 5E2DA 4DE6A 1F30A 2ZG8X 3SH6A 4KVQA 4RC5A 1BCFA 3PVRA 1R03A 3Q4NA 2PYBA 1QGHA 3O7RA 5HQOA 4ZL5A 4DYXA 1DPSA 3QVDA 3IQ1A 2XJNA 3PZAA 1NFVA 3PWQA 2X170 4XKUA 2Z5PA 4YVZA 1JI4A 4A25A 2V2IA 3PWFA 1AEWA 4LQNA 2YJKA 4PG0A 1J30A 3BVKA 2FG4A 3R2OA 5CZUA 2AR0A 5LS9A 3F38A 1BFRA 1YUZA 3F37A 5HU6D 3AK9A 1B71A 4IWJA 1L8IA 2FKZA 3FRRA 4ZKHA 2ITBA 1NF6A 2ZA8A 5JDOB 5JDOA 1YUXA 2D5KA 4LPMA 2V2OA 2CN6A 3GGYA 1LKMA 3JZAB 4ISMA 4PGKA 5GU1X 3KA4A 3KA6A 3PW8A 1S3QA 3ES3A 2ZA7A 2Z90A 2V2PA 3AF9X 3QHCA 3GVYA 1LB3A 3H7GA 4DASA 1O9RA 3KHKA 5JKMG 1YV1A 1IERA 4ERUA 2XGWA 2CHPA 4REUA 4KVSA 5FEJA 3PVTB 2Y44A 3BVLA 2BJYA 2CIHA 4XKSA 4P18A 1LKOA 2BKCA 4RC7B 3N6OA 3A68A 3D19A 4RC7A 4Z3BA 3KWOA 4CVPA 5IX6A 3DBYA 5HJHA 1XZ1A 5JACA 1UMNA 3F34A 4CVSA 2UX1A 1RCDA 1JREA 3R2SA 3SIDA 2IB0A 2IU2A 2VXIA 1JKUA 3RAVA 4DYZA 5LBHA 5FFEA 5D8QA 3R2HA 1JTSA 3U90A 4ITWA 4CMYV 4CYBA 3BVEA 4MN9A 4ETRA 4RC6B 4RC6A 4Z5SA 2ZG7X 4CYAA 1JIGA 2CF7A 1Z4AA 4YKHA 2G38B 2WLUA 3Q4QA 4ZL6A 4TOCA 1XZ3A 3WVWA 3KA8A 4ZTTA 3E1QA 4M35A 2FZFA 2CN7A 5GU3X 1JYBA 4RC5B 5I4JA 3PVRB 2XJOA 3ISEA 2QQYA 4M33A 1HRSA 3C1ZA 1Z6OM 4IXKA 4EVDA 4XGSA 5JKLA 4LPNA 3F32A 3KA9A 5ERJA 3RBCA 2CLUA 3R2LA 1UVHA 4TOEA 4AM2A 3R2KA 2YJJA 4TOBA 4ZKXA 2C2JA 2ZURX 3PVYB 3PVYA 5K53A 3BVIA 2FFXJ 3AJOA 2V2LA 1NF4A 3GHQA 4II4A 3UNOA 1H96A 4E6KA 3HIUA 1JKVA 3QHBA 1F33A 1ZUJA 3WVVA 3Q4RA 5D8RA 5FFBA 4E40A 1TKOA 5ERKA 5LG2A 2Z5RA 2F7NA 2GYDA 1DVBA 4KXRB 3C1YA 5GU0X 5FFAA 3O7SA 3OGHA 1IESA 1N1QA 1VELA 3E1PA 3KA3A 1SQ3A 1DATA 2FG8A 3NOZX 3KDQA 1JI5A 3AJQA 2JD80 5D8XA 1GWGA 4LQJA 2BK6A 5GU2X 4AM4A 3QZ3A 3WNWA 3AK8A 2VXXA 2YW6A 5C6FA 2N02A 1TKPA 2V2NA 4XKTA 5J93A 1VJXA 2C6RA 2CEIA 5FFDA 3E1MA 1RCCA 3LKDA 5JKMA 3RGDA 3F39A 3VNXA 4PGIA 2QF9A 4CMYA 5J9VA 3E2CA 5K52A 3ERZA 1KRQA 1Z6OA 1RCGA 3EGMA 3AF8X 4RC8A 5E1UA 3UFBA 3FI6A 3MPSA 2OH3A 3UOIA 4LQVA 4ITTA 1RYTA 3SHXA 3QB9A 3E1JA 4EVCA 1RCEA 2C2UA 3E1OA 2Z5QA 5CMQA 1JGCA 3C23A 5J8SA 4KVRA 4MKUA 4LYXA 2JD60 4DYYA 4TOHA 4MY7A 2CHIA 4EVEA 1S2ZA 2V2MA 4QUWA 3FVBA 1O9IA 1MFRA 4AM5A 3F33A 3QD8A 4X0JA 5GOUA 2BW1A 4CY9A 5JKLG 2V8UA 1LKPA 1NNQA 2V2JA 3KXUA 5CMRA 4TOAA 2GS4A 2C2FA 4PG1A 2HTNA 2Z6MA 4TO9A 1ZS3A 3R2RA 3JZ9A 5GN8B
chains in the Genus database with same CATH topology
5GN8A 1L8HA 5FFCA 3FRSA 3Q4OA 4MUDA 1MOJA 4II4B 3WVUA 3VVAA 5D8YA 1SOFA 2XJMA 2WTLA 5AXSA 3RE7A 2Y3QA 3KX9A 3IS8A 3FSEA 1EUMA 3PW8C 3SE1A 2ZG9X 2JD70 3BVFA 2C41A 3C21A 3F35A 4LQHA 3EZ0A 4IWKA 3M6JA 5D8SA 3W54A 2ZA6A 3A9QA 1TK6A 3RD0A 4TOFA 4DYUA 3NP0X 4CVRA 4TOGA 3R2MA 4M32A 2VZBA 3EZUA 3VV9A 4EVBA 4OYNA 3BT5A 3PW1B 3PW1A 4R42A 2GYQA 2CLBA 2YW7A 5HJFA 2HR5A 2FHAA 2FL0A 4M34A 1TJOA 4LPJA 4YXJA 4MJYA 3E6RA 4YXMA 4TW3A 2WLAA 3UOFA 2MGYA 3PVTA 4W4KB 2XKQA 2FJCA 3F36A 3AF7X 1VLGA 4CVTA 2RBDA 2OKCA 5D8PA 3T9JA 4TODA 1FHAA 2V8TA 4U3GA 3GE4A 4WJG4 2V15A 1S30A 3OJ5A 4DI0A 3E1LA 3L0MA 1OTKA 5D8OA 4MXPA 1RCIA 3E1NA 5J8WA 2WWXB 4Y08A 3BKNA 3TA8A 2IY4A 1QYBA 2CWLA 3ISFA 4ML5A 5LG8A 2W0OA 2G4HA 4ZJKA 3E6SA 1VEIA 4ISPA 3PWQC 3IS7A 3NP2X 1BG7A 3HL1A 4ZMCA 2OC5A 3V3KB 1VEQA 3GGZA 2V2RA 3AJPA 4DZ0A 4LYUA 4W4LB 4ZKWA 2V2SA 4ZLWA 5E2DA 4DE6A 1F30A 2ZG8X 3SH6A 4KVQA 4RC5A 1BCFA 3PVRA 1R03A 3Q4NA 2PYBA 1QGHA 3O7RA 5HQOA 4ZL5A 4DYXA 1DPSA 3QVDA 3IQ1A 2XJNA 3PZAA 1NFVA 3PWQA 2X170 4XKUA 2Z5PA 4YVZA 1JI4A 4A25A 2V2IA 3PWFA 1AEWA 4LQNA 2YJKA 4PG0A 1J30A 3BVKA 2FG4A 3R2OA 5CZUA 2AR0A 5LS9A 3F38A 1BFRA 1YUZA 3F37A 5HU6D 3AK9A 1B71A 4IWJA 1L8IA 2FKZA 3FRRA 4ZKHA 2ITBA 1NF6A 2ZA8A 5JDOB 5JDOA 1YUXA 2D5KA 4LPMA 2V2OA 2CN6A 3GGYA 1LKMA 3JZAB 4ISMA 4PGKA 5GU1X 3KA4A 3KA6A 3PW8A 1S3QA 3ES3A 2ZA7A 2Z90A 2V2PA 3AF9X 3QHCA 3GVYA 1LB3A 3H7GA 4DASA 1O9RA 3KHKA 5JKMG 1YV1A 1IERA 4ERUA 2XGWA 2CHPA 4REUA 4KVSA 5FEJA 3PVTB 2Y44A 3BVLA 2BJYA 2CIHA 4XKSA 4P18A 1LKOA 2BKCA 4RC7B 3N6OA 3A68A 3D19A 4RC7A 4Z3BA 3KWOA 4CVPA 5IX6A 3DBYA 5HJHA 1XZ1A 5JACA 1UMNA 3F34A 4CVSA 2UX1A 1RCDA 1JREA 3R2SA 3SIDA 2IB0A 2IU2A 2VXIA 1JKUA 3RAVA 4DYZA 5LBHA 5FFEA 5D8QA 3R2HA 1JTSA 3U90A 4ITWA 4CMYV 4CYBA 3BVEA 4MN9A 4ETRA 4RC6B 4RC6A 4Z5SA 2ZG7X 4CYAA 1JIGA 2CF7A 1Z4AA 4YKHA 2G38B 2WLUA 3Q4QA 4ZL6A 4TOCA 1XZ3A 3WVWA 3KA8A 4ZTTA 3E1QA 4M35A 2FZFA 2CN7A 5GU3X 1JYBA 4RC5B 5I4JA 3PVRB 2XJOA 3ISEA 2QQYA 4M33A 1HRSA 3C1ZA 1Z6OM 4IXKA 4EVDA 4XGSA 5JKLA 4LPNA 3F32A 3KA9A 5ERJA 3RBCA 2CLUA 3R2LA 1UVHA 4TOEA 4AM2A 3R2KA 2YJJA 4TOBA 4ZKXA 2C2JA 2ZURX 3PVYB 3PVYA 5K53A 3BVIA 2FFXJ 3AJOA 2V2LA 1NF4A 3GHQA 4II4A 3UNOA 1H96A 4E6KA 3HIUA 1JKVA 3QHBA 1F33A 1ZUJA 3WVVA 3Q4RA 5D8RA 5FFBA 4E40A 1TKOA 5ERKA 5LG2A 2Z5RA 2F7NA 2GYDA 1DVBA 4KXRB 3C1YA 5GU0X 5FFAA 3O7SA 3OGHA 1IESA 1N1QA 1VELA 3E1PA 3KA3A 1SQ3A 1DATA 2FG8A 3NOZX 3KDQA 1JI5A 3AJQA 2JD80 5D8XA 1GWGA 4LQJA 2BK6A 5GU2X 4AM4A 3QZ3A 3WNWA 3AK8A 2VXXA 2YW6A 5C6FA 2N02A 1TKPA 2V2NA 4XKTA 5J93A 1VJXA 2C6RA 2CEIA 5FFDA 3E1MA 1RCCA 3LKDA 5JKMA 3RGDA 3F39A 3VNXA 4PGIA 2QF9A 4CMYA 5J9VA 3E2CA 5K52A 3ERZA 1KRQA 1Z6OA 1RCGA 3EGMA 3AF8X 4RC8A 5E1UA 3UFBA 3FI6A 3MPSA 2OH3A 3UOIA 4LQVA 4ITTA 1RYTA 3SHXA 3QB9A 3E1JA 4EVCA 1RCEA 2C2UA 3E1OA 2Z5QA 5CMQA 1JGCA 3C23A 5J8SA 4KVRA 4MKUA 4LYXA 2JD60 4DYYA 4TOHA 4MY7A 2CHIA 4EVEA 1S2ZA 2V2MA 4QUWA 3FVBA 1O9IA 1MFRA 4AM5A 3F33A 3QD8A 4X0JA 5GOUA 2BW1A 4CY9A 5JKLG 2V8UA 1LKPA 1NNQA 2V2JA 3KXUA 5CMRA 4TOAA 2GS4A 2C2FA 4PG1A 2HTNA 2Z6MA 4TO9A 1ZS3A 3R2RA 3JZ9A 5GN8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GN8 A;  1L8H A;  5FFC A;  3Q4O A;  4MUD A;  1MOJ A;  4II4 B;  3WVU A;  5D8Y A;  1SOF A;  2XJM A;  2WTL A;  5AXS A;  3RE7 A;  2Y3Q A;  3KX9 A;  3IS8 A;  3FSE A;  1EUM A;  3PW8 C;  3SE1 A;  2ZG9 X;  2JD7 0;  3BVF A;  2C41 A;  3F35 A;  4LQH A;  3EZ0 A;  4IWK A;  5D8S A;  2ZA6 A;  3A9Q A;  1TK6 A;  3RD0 A;  4TOF A;  4DYU A;  3NP0 X;  4CVR A;  4TOG A;  3R2M A;  4M32 A;  2VZB A;  3EZU A;  4EVB A;  4OYN A;  3BT5 A;  3PW1 B;  3PW1 A;  4R42 A;  2GYQ A;  2CLB A;  2YW7 A;  5HJF A;  2HR5 A;  2FHA A;  2FL0 A;  4M34 A;  1TJO A;  4LPJ A;  4MJY A;  3E6R A;  4TW3 A;  2WLA A;  3UOF A;  3PVT A;  2XKQ A;  2FJC A;  3F36 A;  3AF7 X;  1VLG A;  4CVT A;  2RBD A;  5D8P A;  3T9J A;  4TOD A;  1FHA A;  4U3G A;  3GE4 A;  2V15 A;  1S30 A;  3OJ5 A;  4DI0 A;  3E1L A;  1OTK A;  5D8O A;  1RCI A;  3E1N A;  5J8W A;  4Y08 A;  3BKN A;  3TA8 A;  2IY4 A;  1QYB A;  3ISF A;  4ML5 A;  5LG8 A;  2W0O A;  2G4H A;  4ZJK A;  3E6S A;  1VEI A;  4ISP A;  3PWQ C;  3IS7 A;  3NP2 X;  1BG7 A;  3HL1 A;  4ZMC A;  2OC5 A;  1VEQ A;  2V2R A;  3AJP A;  4DZ0 A;  4LYU A;  4ZKW A;  2V2S A;  4ZLW A;  5E2D A;  4DE6 A;  1F30 A;  2ZG8 X;  3SH6 A;  4KVQ A;  4RC5 A;  1BCF A;  3PVR A;  1R03 A;  3Q4N A;  2PYB A;  1QGH A;  3O7R A;  5HQO A;  4ZL5 A;  4DYX A;  1DPS A;  3QVD A;  3IQ1 A;  2XJN A;  3PZA A;  1NFV A;  3PWQ A;  2X17 0;  4XKU A;  2Z5P A;  1JI4 A;  4A25 A;  2V2I A;  3PWF A;  1AEW A;  4LQN A;  2YJK A;  4PG0 A;  1J30 A;  3BVK A;  2FG4 A;  3R2O A;  5CZU A;  5LS9 A;  3F38 A;  1BFR A;  1YUZ A;  3F37 A;  3AK9 A;  1B71 A;  4IWJ A;  1L8I A;  2FKZ A;  4ZKH A;  2ITB A;  1NF6 A;  2ZA8 A;  1YUX A;  2D5K A;  4LPM A;  2V2O A;  2CN6 A;  1LKM A;  4PGK A;  4ISM A;  5GU1 X;  3KA4 A;  3KA6 A;  3PW8 A;  1S3Q A;  3ES3 A;  2ZA7 A;  2Z90 A;  2V2P A;  3AF9 X;  3QHC A;  3GVY A;  1LB3 A;  3H7G A;  4DAS A;  1O9R A;  5JKM G;  1YV1 A;  1IER A;  4ERU A;  2XGW A;  2CHP A;  4REU A;  4KVS A;  5FEJ A;  3PVT B;  3BVL A;  2BJY A;  2CIH A;  4XKS A;  4P18 A;  1LKO A;  2BKC A;  4RC7 B;  3A68 A;  4RC7 A;  4Z3B A;  3KWO A;  4CVP A;  5IX6 A;  5HJH A;  1XZ1 A;  5JAC A;  1UMN A;  3F34 A;  4CVS A;  2UX1 A;  1RCD A;  1JRE A;  3R2S A;  3SID A;  2IB0 A;  2IU2 A;  2VXI A;  1JKU A;  3RAV A;  4DYZ A;  5LBH A;  5FFE A;  5D8Q A;  3R2H A;  1JTS A;  3U90 A;  4ITW A;  4CMY V;  4CYB A;  3BVE A;  4MN9 A;  4ETR A;  4RC6 B;  4RC6 A;  4Z5S A;  2ZG7 X;  4CYA A;  1JIG A;  2CF7 A;  1Z4A A;  4YKH A;  2WLU A;  3Q4Q A;  4ZL6 A;  4TOC A;  1XZ3 A;  3WVW A;  3KA8 A;  4ZTT A;  3E1Q A;  4M35 A;  2FZF A;  2CN7 A;  5GU3 X;  1JYB A;  4RC5 B;  5I4J A;  3PVR B;  2XJO A;  3ISE A;  2QQY A;  4M33 A;  1HRS A;  1Z6O M;  4IXK A;  4EVD A;  4XGS A;  5JKL A;  4LPN A;  3F32 A;  3KA9 A;  5ERJ A;  3RBC A;  2CLU A;  3R2L A;  1UVH A;  4TOE A;  4AM2 A;  3R2K A;  2YJJ A;  4TOB A;  4ZKX A;  2C2J A;  2ZUR X;  3PVY B;  3PVY A;  5K53 A;  3BVI A;  2FFX J;  3AJO A;  2V2L A;  1NF4 A;  3GHQ A;  4II4 A;  3UNO A;  1H96 A;  4E6K A;  3HIU A;  1JKV A;  3QHB A;  1F33 A;  1ZUJ A;  3WVV A;  3Q4R A;  5D8R A;  5FFB A;  1TKO A;  5ERK A;  5LG2 A;  2Z5R A;  2F7N A;  2GYD A;  1DVB A;  5GU0 X;  5FFA A;  3O7S A;  3OGH A;  1IES A;  1N1Q A;  1VEL A;  3E1P A;  3KA3 A;  1SQ3 A;  1DAT A;  2FG8 A;  3NOZ X;  1JI5 A;  3AJQ A;  2JD8 0;  5D8X A;  1GWG A;  4LQJ A;  2BK6 A;  5GU2 X;  4AM4 A;  3QZ3 A;  3WNW A;  3AK8 A;  2VXX A;  2YW6 A;  5C6F A;  1TKP A;  2V2N A;  4XKT A;  5J93 A;  1VJX A;  2C6R A;  2CEI A;  5FFD A;  3E1M A;  1RCC A;  5JKM A;  3RGD A;  3F39 A;  3VNX A;  4PGI A;  2QF9 A;  4CMY A;  5J9V A;  3E2C A;  5K52 A;  3ERZ A;  1KRQ A;  1Z6O A;  1RCG A;  3EGM A;  3AF8 X;  4RC8 A;  5E1U A;  3FI6 A;  3MPS A;  2OH3 A;  3UOI A;  4LQV A;  4ITT A;  1RYT A;  3SHX A;  3QB9 A;  3E1J A;  4EVC A;  1RCE A;  2C2U A;  3E1O A;  2Z5Q A;  5CMQ A;  1JGC A;  5J8S A;  4KVR A;  4MKU A;  4LYX A;  2JD6 0;  4DYY A;  4TOH A;  4MY7 A;  2CHI A;  4EVE A;  1S2Z A;  2V2M A;  4QUW A;  3FVB A;  1O9I A;  1MFR A;  4AM5 A;  3F33 A;  3QD8 A;  5GOU A;  2BW1 A;  4CY9 A;  5JKL G;  1LKP A;  1NNQ A;  2V2J A;  3KXU A;  5CMR A;  4TOA A;  2GS4 A;  2C2F A;  4PG1 A;  2HTN A;  2Z6M A;  4TO9 A;  1ZS3 A;  3R2R A;  5GN8 B; 
#chains in the Genus database with same CATH topology
 5GN8 A;  1L8H A;  5FFC A;  3FRS A;  3Q4O A;  4MUD A;  1MOJ A;  4II4 B;  3WVU A;  3VVA A;  5D8Y A;  1SOF A;  2XJM A;  2WTL A;  5AXS A;  3RE7 A;  2Y3Q A;  3KX9 A;  3IS8 A;  3FSE A;  1EUM A;  3PW8 C;  3SE1 A;  2ZG9 X;  2JD7 0;  3BVF A;  2C41 A;  3C21 A;  3F35 A;  4LQH A;  3EZ0 A;  4IWK A;  3M6J A;  5D8S A;  3W54 A;  2ZA6 A;  3A9Q A;  1TK6 A;  3RD0 A;  4TOF A;  4DYU A;  3NP0 X;  4CVR A;  4TOG A;  3R2M A;  4M32 A;  2VZB A;  3EZU A;  3VV9 A;  4EVB A;  4OYN A;  3BT5 A;  3PW1 B;  3PW1 A;  4R42 A;  2GYQ A;  2CLB A;  2YW7 A;  5HJF A;  2HR5 A;  2FHA A;  2FL0 A;  4M34 A;  1TJO A;  4LPJ A;  4YXJ A;  4MJY A;  3E6R A;  4YXM A;  4TW3 A;  2WLA A;  3UOF A;  2MGY A;  3PVT A;  4W4K B;  2XKQ A;  2FJC A;  3F36 A;  3AF7 X;  1VLG A;  4CVT A;  2RBD A;  2OKC A;  5D8P A;  3T9J A;  4TOD A;  1FHA A;  2V8T A;  4U3G A;  3GE4 A;  4WJG 4;  2V15 A;  1S30 A;  3OJ5 A;  4DI0 A;  3E1L A;  3L0M A;  1OTK A;  5D8O A;  4MXP A;  1RCI A;  3E1N A;  5J8W A;  2WWX B;  4Y08 A;  3BKN A;  3TA8 A;  2IY4 A;  1QYB A;  2CWL A;  3ISF A;  4ML5 A;  5LG8 A;  2W0O A;  2G4H A;  4ZJK A;  3E6S A;  1VEI A;  4ISP A;  3PWQ C;  3IS7 A;  3NP2 X;  1BG7 A;  3HL1 A;  4ZMC A;  2OC5 A;  3V3K B;  1VEQ A;  3GGZ A;  2V2R A;  3AJP A;  4DZ0 A;  4LYU A;  4W4L B;  4ZKW A;  2V2S A;  4ZLW A;  5E2D A;  4DE6 A;  1F30 A;  2ZG8 X;  3SH6 A;  4KVQ A;  4RC5 A;  1BCF A;  3PVR A;  1R03 A;  3Q4N A;  2PYB A;  1QGH A;  3O7R A;  5HQO A;  4ZL5 A;  4DYX A;  1DPS A;  3QVD A;  3IQ1 A;  2XJN A;  3PZA A;  1NFV A;  3PWQ A;  2X17 0;  4XKU A;  2Z5P A;  4YVZ A;  1JI4 A;  4A25 A;  2V2I A;  3PWF A;  1AEW A;  4LQN A;  2YJK A;  4PG0 A;  1J30 A;  3BVK A;  2FG4 A;  3R2O A;  5CZU A;  2AR0 A;  5LS9 A;  3F38 A;  1BFR A;  1YUZ A;  3F37 A;  5HU6 D;  3AK9 A;  1B71 A;  4IWJ A;  1L8I A;  2FKZ A;  3FRR A;  4ZKH A;  2ITB A;  1NF6 A;  2ZA8 A;  5JDO B;  5JDO A;  1YUX A;  2D5K A;  4LPM A;  2V2O A;  2CN6 A;  3GGY A;  1LKM A;  3JZA B;  4ISM A;  4PGK A;  5GU1 X;  3KA4 A;  3KA6 A;  3PW8 A;  1S3Q A;  3ES3 A;  2ZA7 A;  2Z90 A;  2V2P A;  3AF9 X;  3QHC A;  3GVY A;  1LB3 A;  3H7G A;  4DAS A;  1O9R A;  3KHK A;  5JKM G;  1YV1 A;  1IER A;  4ERU A;  2XGW A;  2CHP A;  4REU A;  4KVS A;  5FEJ A;  3PVT B;  2Y44 A;  3BVL A;  2BJY A;  2CIH A;  4XKS A;  4P18 A;  1LKO A;  2BKC A;  4RC7 B;  3N6O A;  3A68 A;  3D19 A;  4RC7 A;  4Z3B A;  3KWO A;  4CVP A;  5IX6 A;  3DBY A;  5HJH A;  1XZ1 A;  5JAC A;  1UMN A;  3F34 A;  4CVS A;  2UX1 A;  1RCD A;  1JRE A;  3R2S A;  3SID A;  2IB0 A;  2IU2 A;  2VXI A;  1JKU A;  3RAV A;  4DYZ A;  5LBH A;  5FFE A;  5D8Q A;  3R2H A;  1JTS A;  3U90 A;  4ITW A;  4CMY V;  4CYB A;  3BVE A;  4MN9 A;  4ETR A;  4RC6 B;  4RC6 A;  4Z5S A;  2ZG7 X;  4CYA A;  1JIG A;  2CF7 A;  1Z4A A;  4YKH A;  2G38 B;  2WLU A;  3Q4Q A;  4ZL6 A;  4TOC A;  1XZ3 A;  3WVW A;  3KA8 A;  4ZTT A;  3E1Q A;  4M35 A;  2FZF A;  2CN7 A;  5GU3 X;  1JYB A;  4RC5 B;  5I4J A;  3PVR B;  2XJO A;  3ISE A;  2QQY A;  4M33 A;  1HRS A;  3C1Z A;  1Z6O M;  4IXK A;  4EVD A;  4XGS A;  5JKL A;  4LPN A;  3F32 A;  3KA9 A;  5ERJ A;  3RBC A;  2CLU A;  3R2L A;  1UVH A;  4TOE A;  4AM2 A;  3R2K A;  2YJJ A;  4TOB A;  4ZKX A;  2C2J A;  2ZUR X;  3PVY B;  3PVY A;  5K53 A;  3BVI A;  2FFX J;  3AJO A;  2V2L A;  1NF4 A;  3GHQ A;  4II4 A;  3UNO A;  1H96 A;  4E6K A;  3HIU A;  1JKV A;  3QHB A;  1F33 A;  1ZUJ A;  3WVV A;  3Q4R A;  5D8R A;  5FFB A;  4E40 A;  1TKO A;  5ERK A;  5LG2 A;  2Z5R A;  2F7N A;  2GYD A;  1DVB A;  4KXR B;  3C1Y A;  5GU0 X;  5FFA A;  3O7S A;  3OGH A;  1IES A;  1N1Q A;  1VEL A;  3E1P A;  3KA3 A;  1SQ3 A;  1DAT A;  2FG8 A;  3NOZ X;  3KDQ A;  1JI5 A;  3AJQ A;  2JD8 0;  5D8X A;  1GWG A;  4LQJ A;  2BK6 A;  5GU2 X;  4AM4 A;  3QZ3 A;  3WNW A;  3AK8 A;  2VXX A;  2YW6 A;  5C6F A;  2N02 A;  1TKP A;  2V2N A;  4XKT A;  5J93 A;  1VJX A;  2C6R A;  2CEI A;  5FFD A;  3E1M A;  1RCC A;  3LKD A;  5JKM A;  3RGD A;  3F39 A;  3VNX A;  4PGI A;  2QF9 A;  4CMY A;  5J9V A;  3E2C A;  5K52 A;  3ERZ A;  1KRQ A;  1Z6O A;  1RCG A;  3EGM A;  3AF8 X;  4RC8 A;  5E1U A;  3UFB A;  3FI6 A;  3MPS A;  2OH3 A;  3UOI A;  4LQV A;  4ITT A;  1RYT A;  3SHX A;  3QB9 A;  3E1J A;  4EVC A;  1RCE A;  2C2U A;  3E1O A;  2Z5Q A;  5CMQ A;  1JGC A;  3C23 A;  5J8S A;  4KVR A;  4MKU A;  4LYX A;  2JD6 0;  4DYY A;  4TOH A;  4MY7 A;  2CHI A;  4EVE A;  1S2Z A;  2V2M A;  4QUW A;  3FVB A;  1O9I A;  1MFR A;  4AM5 A;  3F33 A;  3QD8 A;  4X0J A;  5GOU A;  2BW1 A;  4CY9 A;  5JKL G;  2V8U A;  1LKP A;  1NNQ A;  2V2J A;  3KXU A;  5CMR A;  4TOA A;  2GS4 A;  2C2F A;  4PG1 A;  2HTN A;  2Z6M A;  4TO9 A;  1ZS3 A;  3R2R A;  3JZ9 A;  5GN8 B; 
#chains in the Genus database with same CATH homology
 5GN8 A;  1L8H A;  5FFC A;  3FRS A;  3Q4O A;  4MUD A;  1MOJ A;  4II4 B;  3WVU A;  3VVA A;  5D8Y A;  1SOF A;  2XJM A;  2WTL A;  5AXS A;  3RE7 A;  2Y3Q A;  3KX9 A;  3IS8 A;  3FSE A;  1EUM A;  3PW8 C;  3SE1 A;  2ZG9 X;  2JD7 0;  3BVF A;  2C41 A;  3C21 A;  3F35 A;  4LQH A;  3EZ0 A;  4IWK A;  3M6J A;  5D8S A;  3W54 A;  2ZA6 A;  3A9Q A;  1TK6 A;  3RD0 A;  4TOF A;  4DYU A;  3NP0 X;  4CVR A;  4TOG A;  3R2M A;  4M32 A;  2VZB A;  3EZU A;  3VV9 A;  4EVB A;  4OYN A;  3BT5 A;  3PW1 B;  3PW1 A;  4R42 A;  2GYQ A;  2CLB A;  2YW7 A;  5HJF A;  2HR5 A;  2FHA A;  2FL0 A;  4M34 A;  1TJO A;  4LPJ A;  4YXJ A;  4MJY A;  3E6R A;  4YXM A;  4TW3 A;  2WLA A;  3UOF A;  2MGY A;  3PVT A;  4W4K B;  2XKQ A;  2FJC A;  3F36 A;  3AF7 X;  1VLG A;  4CVT A;  2RBD A;  2OKC A;  5D8P A;  3T9J A;  4TOD A;  1FHA A;  2V8T A;  4U3G A;  3GE4 A;  4WJG 4;  2V15 A;  1S30 A;  3OJ5 A;  4DI0 A;  3E1L A;  3L0M A;  1OTK A;  5D8O A;  4MXP A;  1RCI A;  3E1N A;  5J8W A;  2WWX B;  4Y08 A;  3BKN A;  3TA8 A;  2IY4 A;  1QYB A;  2CWL A;  3ISF A;  4ML5 A;  5LG8 A;  2W0O A;  2G4H A;  4ZJK A;  3E6S A;  1VEI A;  4ISP A;  3PWQ C;  3IS7 A;  3NP2 X;  1BG7 A;  3HL1 A;  4ZMC A;  2OC5 A;  3V3K B;  1VEQ A;  3GGZ A;  2V2R A;  3AJP A;  4DZ0 A;  4LYU A;  4W4L B;  4ZKW A;  2V2S A;  4ZLW A;  5E2D A;  4DE6 A;  1F30 A;  2ZG8 X;  3SH6 A;  4KVQ A;  4RC5 A;  1BCF A;  3PVR A;  1R03 A;  3Q4N A;  2PYB A;  1QGH A;  3O7R A;  5HQO A;  4ZL5 A;  4DYX A;  1DPS A;  3QVD A;  3IQ1 A;  2XJN A;  3PZA A;  1NFV A;  3PWQ A;  2X17 0;  4XKU A;  2Z5P A;  4YVZ A;  1JI4 A;  4A25 A;  2V2I A;  3PWF A;  1AEW A;  4LQN A;  2YJK A;  4PG0 A;  1J30 A;  3BVK A;  2FG4 A;  3R2O A;  5CZU A;  2AR0 A;  5LS9 A;  3F38 A;  1BFR A;  1YUZ A;  3F37 A;  5HU6 D;  3AK9 A;  1B71 A;  4IWJ A;  1L8I A;  2FKZ A;  3FRR A;  4ZKH A;  2ITB A;  1NF6 A;  2ZA8 A;  5JDO B;  5JDO A;  1YUX A;  2D5K A;  4LPM A;  2V2O A;  2CN6 A;  3GGY A;  1LKM A;  3JZA B;  4ISM A;  4PGK A;  5GU1 X;  3KA4 A;  3KA6 A;  3PW8 A;  1S3Q A;  3ES3 A;  2ZA7 A;  2Z90 A;  2V2P A;  3AF9 X;  3QHC A;  3GVY A;  1LB3 A;  3H7G A;  4DAS A;  1O9R A;  3KHK A;  5JKM G;  1YV1 A;  1IER A;  4ERU A;  2XGW A;  2CHP A;  4REU A;  4KVS A;  5FEJ A;  3PVT B;  2Y44 A;  3BVL A;  2BJY A;  2CIH A;  4XKS A;  4P18 A;  1LKO A;  2BKC A;  4RC7 B;  3N6O A;  3A68 A;  3D19 A;  4RC7 A;  4Z3B A;  3KWO A;  4CVP A;  5IX6 A;  3DBY A;  5HJH A;  1XZ1 A;  5JAC A;  1UMN A;  3F34 A;  4CVS A;  2UX1 A;  1RCD A;  1JRE A;  3R2S A;  3SID A;  2IB0 A;  2IU2 A;  2VXI A;  1JKU A;  3RAV A;  4DYZ A;  5LBH A;  5FFE A;  5D8Q A;  3R2H A;  1JTS A;  3U90 A;  4ITW A;  4CMY V;  4CYB A;  3BVE A;  4MN9 A;  4ETR A;  4RC6 B;  4RC6 A;  4Z5S A;  2ZG7 X;  4CYA A;  1JIG A;  2CF7 A;  1Z4A A;  4YKH A;  2G38 B;  2WLU A;  3Q4Q A;  4ZL6 A;  4TOC A;  1XZ3 A;  3WVW A;  3KA8 A;  4ZTT A;  3E1Q A;  4M35 A;  2FZF A;  2CN7 A;  5GU3 X;  1JYB A;  4RC5 B;  5I4J A;  3PVR B;  2XJO A;  3ISE A;  2QQY A;  4M33 A;  1HRS A;  3C1Z A;  1Z6O M;  4IXK A;  4EVD A;  4XGS A;  5JKL A;  4LPN A;  3F32 A;  3KA9 A;  5ERJ A;  3RBC A;  2CLU A;  3R2L A;  1UVH A;  4TOE A;  4AM2 A;  3R2K A;  2YJJ A;  4TOB A;  4ZKX A;  2C2J A;  2ZUR X;  3PVY B;  3PVY A;  5K53 A;  3BVI A;  2FFX J;  3AJO A;  2V2L A;  1NF4 A;  3GHQ A;  4II4 A;  3UNO A;  1H96 A;  4E6K A;  3HIU A;  1JKV A;  3QHB A;  1F33 A;  1ZUJ A;  3WVV A;  3Q4R A;  5D8R A;  5FFB A;  4E40 A;  1TKO A;  5ERK A;  5LG2 A;  2Z5R A;  2F7N A;  2GYD A;  1DVB A;  4KXR B;  3C1Y A;  5GU0 X;  5FFA A;  3O7S A;  3OGH A;  1IES A;  1N1Q A;  1VEL A;  3E1P A;  3KA3 A;  1SQ3 A;  1DAT A;  2FG8 A;  3NOZ X;  3KDQ A;  1JI5 A;  3AJQ A;  2JD8 0;  5D8X A;  1GWG A;  4LQJ A;  2BK6 A;  5GU2 X;  4AM4 A;  3QZ3 A;  3WNW A;  3AK8 A;  2VXX A;  2YW6 A;  5C6F A;  2N02 A;  1TKP A;  2V2N A;  4XKT A;  5J93 A;  1VJX A;  2C6R A;  2CEI A;  5FFD A;  3E1M A;  1RCC A;  3LKD A;  5JKM A;  3RGD A;  3F39 A;  3VNX A;  4PGI A;  2QF9 A;  4CMY A;  5J9V A;  3E2C A;  5K52 A;  3ERZ A;  1KRQ A;  1Z6O A;  1RCG A;  3EGM A;  3AF8 X;  4RC8 A;  5E1U A;  3UFB A;  3FI6 A;  3MPS A;  2OH3 A;  3UOI A;  4LQV A;  4ITT A;  1RYT A;  3SHX A;  3QB9 A;  3E1J A;  4EVC A;  1RCE A;  2C2U A;  3E1O A;  2Z5Q A;  5CMQ A;  1JGC A;  3C23 A;  5J8S A;  4KVR A;  4MKU A;  4LYX A;  2JD6 0;  4DYY A;  4TOH A;  4MY7 A;  2CHI A;  4EVE A;  1S2Z A;  2V2M A;  4QUW A;  3FVB A;  1O9I A;  1MFR A;  4AM5 A;  3F33 A;  3QD8 A;  4X0J A;  5GOU A;  2BW1 A;  4CY9 A;  5JKL G;  2V8U A;  1LKP A;  1NNQ A;  2V2J A;  3KXU A;  5CMR A;  4TOA A;  2GS4 A;  2C2F A;  4PG1 A;  2HTN A;  2Z6M A;  4TO9 A;  1ZS3 A;  3R2R A;  3JZ9 A;  5GN8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...