4Z5SA

Crystal structure of apo-form of aldehyde deformylating oxygenase from synechocystis sp.pcc 6803
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
223
structure length
223
Chain Sequence
VRTEFDYSSEIYKDAYSRINAIVIEGEQEAYSNYLQMAELLPEDKEELTRLAKMENRHKKGFQACGNNLQVNPDMPYAQEFFAGLHGNFQHAFSEGKVVTCLLIQALIIEAFAIAAYNIYIPVADDFARKITEGVVKDEYTHLNYGEEWLKANFATAKEELEQANKENLPLVWKMLNQVQGDAKVLGMEKEALVEDFMISYGEALSNIGFSTREIMRMSSYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Aldehyde decarbonylase
publication title Identification of residues important for the activity of aldehyde-deformylating oxygenase through investigation into the structure-activity relationship
pubmed doi rcsb
source organism Synechocystis sp. (strain pcc 6803 / kazusa)
total genus 102
structure length 223
sequence length 223
ec nomenclature ec 4.1.99.5: Aldehyde oxygenase (deformylating).
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11266 Ald_deCOase Long-chain fatty aldehyde decarbonylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4z5sA01
1EUMA 3PW8A 3PVRB 2RBDA 1KRQA 1RCCA 4TOAA 3E6RA 3UOFA 4PG1A 4PG0A 1S2ZA 2Z5PA 5E1UA 2CHPA 4MN9A 5GU1X 1UMNA 2X170 3WVUA 5ERKA 5JKMA 3E1MA 2FKZA 3GHQA 2FG8A 3RD0A 2HTNA 4XKTA 4ZKHA 1RCIA 3Q4NA 3QHCA 3U90A 4EVEA 3R2SA 4KVSA 4EVCA 3E1JA 5CZUA 3AJOA 3PWFA 2W0OA 4II4A 2V2MA 1NF6A 3F38A 1BG7A 4RC6B 1MOJA 2IU2A 4Z5SA 1BFRA 2CLBA 4RC5A 3KA6A 1F30A 4M32A 3NP2X 3SHXA 4Z3BA 2V2PA 5J8SA 2PYBA 4DYUA 4CVPA 1UVHA 5JKLA 1TJOA 2OC5A 3E6SA 3PW1B 5LG2A 5GU0X 4LPNA 3WNWA 2IB0A 2ZA6A 2D5KA 4MKUA 2YW6A 2QF9A 3KA3A 3PVRA 3PVYB 2JD80 1XZ3A 3BT5A 2V2LA 1YUXA 1QYBA 1S30A 3IS7A 4CMYV 4EVDA 2VXIA 5GU3X 1IERA 3SH6A 5GU2X 1BCFA 2VXXA 1LB3A 3E1OA 1SQ3A 1RYTA 2CEIA 1LKMA 1H96A 3Q4RA 5D8PA 4REUA 5GN8B 4LQVA 5D8OA 2YJJA 4PGKA 1DPSA 4R42A 3ISFA 1RCDA 4TOEA 4DYZA 4RC6A 3A9QA 3PW8C 3TA8A 3EGMA 4LQNA 3E1NA 2FZFA 2V2RA 2V15A 1J30A 2CIHA 3AF8X 1TKOA 4CVSA 2Z5QA 4AM4A 2ZA8A 1Z4AA 4MJYA 3AJQA 1YV1A 5IX6A 2JD70 5D8XA 3QD8A 2BJYA 5JKMG 2FHAA 3PW1A 2VZBA 4ZMCA 2CF7A 3AK8A 1LKPA 1LKOA 3EZUA 4XKUA 3IQ1A 5J8WA 1ZS3A 2V2IA 1AEWA 1XZ1A 4EVBA 4QUWA 3AF9X 3PVYA 2UX1A 2V2SA 3E1PA 5CMRA 2GS4A 5J93A 3FI6A 3AJPA 4TOGA 3R2MA 3F32A 3BVLA 4P18A 3SE1A 5LBHA 3E1QA 1NNQA 4DZ0A 4DYYA 5K53A 4DI0A 4ML5A 1F33A 4CVRA 2IY4A 3QB9A 3BVIA 3MPSA 5JKLG 4YKHA 3F34A 5GN8A 1JGCA 5LG8A 2C2UA 4LQJA 4XKSA 3QHBA 4KVQA 5C6FA 1S3QA 3BKNA 5J9VA 5HJHA 4U3GA 1VELA 4ZKXA 4IWJA 2FJCA 1Z6OM 4TW3A 1R03A 3QZ3A 4Y08A 2C2JA 4M35A 2Z6MA 5HJFA 2CN7A 2YW7A 2V2OA 1JREA 4RC7B 5JACA 2WTLA 4CVTA 3ES3A 3RBCA 3OGHA 3HIUA 4ZTTA 2WLAA 3RAVA 3PWQA 5FFBA 2GYDA 4AM2A 4ERUA 3KA8A 4PGIA 1VLGA 1JKUA 4IXKA 5HQOA 1L8HA 1JKVA 1NF4A 2Y3QA 4ISMA 2CLUA 3R2OA 4LPJA 4TOHA 4A25A 5FFDA 1JI5A 1ZUJA 4LQHA 5ERJA 2CN6A 2CHIA 1VEQA 3O7SA 3ERZA 1L8IA 5E2DA 3F36A 2G4HA 3QVDA 3F39A 2XJMA 5D8SA 3FSEA 1O9IA 1JIGA 2ITBA 3E1LA 3FVBA 1JI4A 1YUZA 3UNOA 4DASA 4MUDA 3PVTB 2FL0A 4OYNA 2C2FA 3IS8A 5FEJA 2WLUA 1OTKA 1HRSA 1Z6OA 2HR5A 3SIDA 3AK9A 4AM5A 4ZKWA 2C41A 3NP0X 3BVKA 4ITTA 4CMYA 3F35A 5FFCA 4DYXA 1IESA 2Z90A 1MFRA 1GWGA 1TKPA 4LYUA 5D8RA 4RC7A 1TK6A 3F37A 3ISEA 4TOBA 2Z5RA 3A68A 2BK6A 4ZLWA 4E6KA 5K52A 4KVRA 3RE7A 4RC8A 2XGWA 4ZL6A 4M34A 2BKCA 2F7NA 4ZL5A 4TOFA 4ETRA 4TOCA 2ZG7X 5D8YA 1NFVA 3GE4A 3KA9A 4CYAA 3NOZX 3GVYA 2JD60 3R2KA 1DVBA 3BVEA 3KWOA 3E2CA 3WVVA 3Q4QA 1DATA 3EZ0A 3R2LA 4TO9A 3H7GA 3KX9A 5FFAA 3PZAA 5D8QA 1SOFA 4LPMA 2ZURX 5AXSA 1VJXA 2FG4A 2C6RA 3AF7X 3F33A 3PVTA 4XGSA 2QQYA 1FHAA 3PWQC 3R2HA 2YJKA 5FFEA 4ITWA 3VNXA 1O9RA 4TODA 1B71A 5CMQA 4M33A 1N1QA 2ZG8X 4IWKA 4MY7A 3O7RA 4DE6A 3OJ5A 1VEIA 4CY9A 3KA4A 2GYQA 3KXUA 2FFXJ 2XJOA 4LYXA 1QGHA 4II4B 4ZJKA 5I4JA 1JTSA 1RCGA 2BW1A 3HL1A 4RC5B 3RGDA 4ISPA 2XJNA 3T9JA 2ZA7A 5LS9A 2ZG9X 2XKQA 3BVFA 3Q4OA 3UOIA 1JYBA 1RCEA 2V2NA 4CYBA 2V2JA 3WVWA 5GOUA 2OH3A 3R2RA
chains in the Genus database with same CATH superfamily
1EUMA 3PW8A 3PVRB 2RBDA 1KRQA 1RCCA 4TOAA 2OKCA 3E6RA 3UOFA 4PG1A 3VV9A 4PG0A 1S2ZA 2Z5PA 5E1UA 2CHPA 4MN9A 5GU1X 1UMNA 2X170 3WVUA 5ERKA 5JKMA 3E1MA 2FKZA 3GHQA 3KDQA 2FG8A 3RD0A 2HTNA 4XKTA 3W54A 4ZKHA 1RCIA 3Q4NA 3QHCA 3U90A 4EVEA 3R2SA 4KVSA 4EVCA 3E1JA 3GGZA 5CZUA 3AJOA 3PWFA 2W0OA 4II4A 2V2MA 1NF6A 3F38A 1BG7A 4RC6B 1MOJA 2WWXB 2IU2A 4Z5SA 1BFRA 2CLBA 4RC5A 3KA6A 1F30A 4M32A 3NP2X 3SHXA 4Z3BA 2V2PA 5J8SA 2PYBA 4DYUA 4CVPA 1UVHA 5JKLA 1TJOA 4WJG4 2OC5A 3E6SA 3PW1B 3C1YA 5LG2A 5GU0X 4LPNA 3WNWA 2IB0A 2ZA6A 2D5KA 4MKUA 2YW6A 2QF9A 3KA3A 3PVRA 3PVYB 2JD80 1XZ3A 3BT5A 2V2LA 1YUXA 1QYBA 1S30A 3IS7A 4YXMA 4CMYV 4EVDA 4W4LB 2VXIA 5GU3X 1IERA 3SH6A 5GU2X 1BCFA 2VXXA 1LB3A 3E1OA 1SQ3A 1RYTA 2CEIA 1LKMA 1H96A 3Q4RA 5D8PA 4REUA 5GN8B 2AR0A 4LQVA 2V8TA 5D8OA 2YJJA 4PGKA 1DPSA 4R42A 3DBYA 3ISFA 1RCDA 4TOEA 4DYZA 4RC6A 3A9QA 3PW8C 3TA8A 3EGMA 4LQNA 3E1NA 4X0JA 2FZFA 2V2RA 2V15A 1J30A 2CIHA 3AF8X 1TKOA 4CVSA 2Z5QA 3V3KB 4AM4A 2ZA8A 1Z4AA 4MJYA 3AJQA 1YV1A 2MGYA 5IX6A 2JD70 5JDOB 5D8XA 3QD8A 2BJYA 5JKMG 2FHAA 3PW1A 2VZBA 4ZMCA 2CF7A 3AK8A 1LKPA 1LKOA 3EZUA 4XKUA 3IQ1A 4E40A 5J8WA 1ZS3A 2V2IA 3UFBA 1AEWA 1XZ1A 4EVBA 4QUWA 3AF9X 3PVYA 2UX1A 2V2SA 3D19A 3E1PA 5CMRA 2GS4A 5J93A 3FI6A 3AJPA 4TOGA 3R2MA 3F32A 3BVLA 4P18A 3SE1A 5LBHA 3E1QA 1NNQA 4DZ0A 4DYYA 5K53A 3JZAB 4DI0A 4ML5A 1F33A 4CVRA 2IY4A 3QB9A 3BVIA 3MPSA 5JKLG 4YKHA 3F34A 5GN8A 1JGCA 5LG8A 2C2UA 4LQJA 4XKSA 3QHBA 4KVQA 5C6FA 1S3QA 3BKNA 5J9VA 5HJHA 4U3GA 1VELA 4ZKXA 3VVAA 4IWJA 2FJCA 1Z6OM 4YVZA 4TW3A 1R03A 3QZ3A 4Y08A 2C2JA 4M35A 2Z6MA 5HJFA 2CN7A 2YW7A 2V2OA 1JREA 4RC7B 5JACA 2WTLA 4CVTA 3ES3A 3RBCA 5JDOA 3OGHA 3HIUA 4ZTTA 2WLAA 3RAVA 3PWQA 5FFBA 2GYDA 4AM2A 4ERUA 3KA8A 4PGIA 1VLGA 1JKUA 4IXKA 5HQOA 1L8HA 1JKVA 1NF4A 2Y3QA 4ISMA 2CLUA 3M6JA 2V8UA 3R2OA 4LPJA 2G38B 4TOHA 5FFDA 4A25A 1JI5A 1ZUJA 4LQHA 5ERJA 2CN6A 2CHIA 1VEQA 3O7SA 3ERZA 1L8IA 5E2DA 3F36A 2G4HA 3QVDA 3F39A 2XJMA 5D8SA 3FSEA 5HU6D 1O9IA 1JIGA 2ITBA 3E1LA 3FVBA 1JI4A 1YUZA 3UNOA 4DASA 4MUDA 3PVTB 2FL0A 4OYNA 2C2FA 3IS8A 5FEJA 2WLUA 1OTKA 1HRSA 1Z6OA 2HR5A 3SIDA 3AK9A 4AM5A 4ZKWA 2C41A 3NP0X 3BVKA 4ITTA 4CMYA 3F35A 5FFCA 4DYXA 1IESA 2Z90A 1MFRA 1GWGA 1TKPA 4LYUA 5D8RA 4RC7A 1TK6A 3F37A 3ISEA 4TOBA 2Z5RA 3A68A 2BK6A 4ZLWA 4E6KA 5K52A 3KHKA 4KVRA 3RE7A 3FRRA 4RC8A 2XGWA 4ZL6A 4M34A 2BKCA 2F7NA 4ZL5A 4TOFA 4ETRA 4TOCA 2ZG7X 5D8YA 1NFVA 3GE4A 3KA9A 4CYAA 3NOZX 3GVYA 2JD60 3R2KA 3GGYA 1DVBA 3BVEA 3KWOA 3E2CA 3WVVA 3Q4QA 1DATA 3EZ0A 3R2LA 4TO9A 3H7GA 3KX9A 5FFAA 3PZAA 5D8QA 3FRSA 1SOFA 4LPMA 2ZURX 5AXSA 1VJXA 2FG4A 2C6RA 3AF7X 3F33A 3PVTA 4XGSA 2Y44A 3C21A 2QQYA 3L0MA 1FHAA 3PWQC 3R2HA 2YJKA 5FFEA 4KXRB 4ITWA 3VNXA 3C23A 1O9RA 4TODA 3LKDA 1B71A 5CMQA 4M33A 1N1QA 2ZG8X 4IWKA 4MY7A 3O7RA 4DE6A 3OJ5A 1VEIA 4CY9A 3KA4A 2GYQA 3KXUA 2FFXJ 2XJOA 4LYXA 1QGHA 4II4B 4ZJKA 5I4JA 1JTSA 1RCGA 2BW1A 4YXJA 3HL1A 2CWLA 4RC5B 3RGDA 4ISPA 4MXPA 3N6OA 3C1ZA 2XJNA 3T9JA 2ZA7A 5LS9A 2ZG9X 2XKQA 3BVFA 4W4KB 3JZ9A 3Q4OA 3UOIA 1JYBA 1RCEA 2N02A 2V2NA 4CYBA 2V2JA 3WVWA 5GOUA 2OH3A 3R2RA
chains in the Genus database with same CATH topology
1EUMA 3PW8A 3PVRB 2RBDA 1KRQA 1RCCA 4TOAA 2OKCA 3E6RA 3UOFA 4PG1A 3VV9A 4PG0A 1S2ZA 2Z5PA 5E1UA 2CHPA 4MN9A 5GU1X 1UMNA 2X170 3WVUA 5ERKA 5JKMA 3E1MA 2FKZA 3GHQA 3KDQA 2FG8A 3RD0A 2HTNA 4XKTA 3W54A 4ZKHA 1RCIA 3Q4NA 3QHCA 3U90A 4EVEA 3R2SA 4KVSA 4EVCA 3E1JA 3GGZA 5CZUA 3AJOA 3PWFA 2W0OA 4II4A 2V2MA 1NF6A 3F38A 1BG7A 4RC6B 1MOJA 2WWXB 2IU2A 4Z5SA 1BFRA 2CLBA 4RC5A 3KA6A 1F30A 4M32A 3NP2X 3SHXA 4Z3BA 2V2PA 5J8SA 2PYBA 4DYUA 4CVPA 1UVHA 5JKLA 1TJOA 4WJG4 2OC5A 3E6SA 3PW1B 3C1YA 5LG2A 5GU0X 4LPNA 3WNWA 2IB0A 2ZA6A 2D5KA 4MKUA 2YW6A 2QF9A 3KA3A 3PVRA 3PVYB 2JD80 1XZ3A 3BT5A 2V2LA 1YUXA 1QYBA 1S30A 3IS7A 4YXMA 4CMYV 4EVDA 4W4LB 2VXIA 5GU3X 1IERA 3SH6A 5GU2X 1BCFA 2VXXA 1LB3A 3E1OA 1SQ3A 1RYTA 2CEIA 1LKMA 1H96A 3Q4RA 5D8PA 4REUA 5GN8B 2AR0A 4LQVA 2V8TA 5D8OA 2YJJA 4PGKA 1DPSA 4R42A 3DBYA 3ISFA 1RCDA 4TOEA 4DYZA 4RC6A 3A9QA 3PW8C 3TA8A 3EGMA 4LQNA 3E1NA 4X0JA 2FZFA 2V2RA 2V15A 1J30A 2CIHA 3AF8X 1TKOA 4CVSA 2Z5QA 3V3KB 4AM4A 2ZA8A 1Z4AA 4MJYA 3AJQA 1YV1A 2MGYA 5IX6A 2JD70 5JDOB 5D8XA 3QD8A 2BJYA 5JKMG 2FHAA 3PW1A 2VZBA 4ZMCA 2CF7A 3AK8A 1LKPA 1LKOA 3EZUA 4XKUA 3IQ1A 4E40A 5J8WA 1ZS3A 2V2IA 3UFBA 1AEWA 1XZ1A 4EVBA 4QUWA 3AF9X 3PVYA 2UX1A 2V2SA 3D19A 3E1PA 5CMRA 2GS4A 5J93A 3FI6A 3AJPA 4TOGA 3R2MA 3F32A 3BVLA 4P18A 3SE1A 5LBHA 3E1QA 1NNQA 4DZ0A 4DYYA 5K53A 3JZAB 4DI0A 4ML5A 1F33A 4CVRA 2IY4A 3QB9A 3BVIA 3MPSA 5JKLG 4YKHA 3F34A 5GN8A 1JGCA 5LG8A 2C2UA 4LQJA 4XKSA 3QHBA 4KVQA 5C6FA 1S3QA 3BKNA 5J9VA 5HJHA 4U3GA 1VELA 4ZKXA 3VVAA 4IWJA 2FJCA 1Z6OM 4YVZA 4TW3A 1R03A 3QZ3A 4Y08A 2C2JA 4M35A 2Z6MA 5HJFA 2CN7A 2YW7A 2V2OA 1JREA 4RC7B 5JACA 2WTLA 4CVTA 3ES3A 3RBCA 5JDOA 3OGHA 3HIUA 4ZTTA 2WLAA 3RAVA 3PWQA 5FFBA 2GYDA 4AM2A 4ERUA 3KA8A 4PGIA 1VLGA 1JKUA 4IXKA 5HQOA 1L8HA 1JKVA 1NF4A 2Y3QA 4ISMA 2CLUA 3M6JA 2V8UA 3R2OA 4LPJA 2G38B 4TOHA 5FFDA 4A25A 1JI5A 1ZUJA 4LQHA 5ERJA 2CN6A 2CHIA 1VEQA 3O7SA 3ERZA 1L8IA 5E2DA 3F36A 2G4HA 3QVDA 3F39A 2XJMA 5D8SA 3FSEA 5HU6D 1O9IA 1JIGA 2ITBA 3E1LA 3FVBA 1JI4A 1YUZA 3UNOA 4DASA 4MUDA 3PVTB 2FL0A 4OYNA 2C2FA 3IS8A 5FEJA 2WLUA 1OTKA 1HRSA 1Z6OA 2HR5A 3SIDA 3AK9A 4AM5A 4ZKWA 2C41A 3NP0X 3BVKA 4ITTA 4CMYA 3F35A 5FFCA 4DYXA 1IESA 2Z90A 1MFRA 1GWGA 1TKPA 4LYUA 5D8RA 4RC7A 1TK6A 3F37A 3ISEA 4TOBA 2Z5RA 3A68A 2BK6A 4ZLWA 4E6KA 5K52A 3KHKA 4KVRA 3RE7A 3FRRA 4RC8A 2XGWA 4ZL6A 4M34A 2BKCA 2F7NA 4ZL5A 4TOFA 4ETRA 4TOCA 2ZG7X 5D8YA 1NFVA 3GE4A 3KA9A 4CYAA 3NOZX 3GVYA 2JD60 3R2KA 3GGYA 1DVBA 3BVEA 3KWOA 3E2CA 3WVVA 3Q4QA 1DATA 3EZ0A 3R2LA 4TO9A 3H7GA 3KX9A 5FFAA 3PZAA 5D8QA 3FRSA 1SOFA 4LPMA 2ZURX 5AXSA 1VJXA 2FG4A 2C6RA 3AF7X 3F33A 3PVTA 4XGSA 2Y44A 3C21A 2QQYA 3L0MA 1FHAA 3PWQC 3R2HA 2YJKA 5FFEA 4KXRB 4ITWA 3VNXA 3C23A 1O9RA 4TODA 3LKDA 1B71A 5CMQA 4M33A 1N1QA 2ZG8X 4IWKA 4MY7A 3O7RA 4DE6A 3OJ5A 1VEIA 4CY9A 3KA4A 2GYQA 3KXUA 2FFXJ 2XJOA 4LYXA 1QGHA 4II4B 4ZJKA 5I4JA 1JTSA 1RCGA 2BW1A 4YXJA 3HL1A 2CWLA 4RC5B 3RGDA 4ISPA 4MXPA 3N6OA 3C1ZA 2XJNA 3T9JA 2ZA7A 5LS9A 2ZG9X 2XKQA 3BVFA 4W4KB 3JZ9A 3Q4OA 3UOIA 1JYBA 1RCEA 2N02A 2V2NA 4CYBA 2V2JA 3WVWA 5GOUA 2OH3A 3R2RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EUM A;  3PW8 A;  3PVR B;  2RBD A;  1KRQ A;  1RCC A;  4TOA A;  3E6R A;  3UOF A;  4PG1 A;  4PG0 A;  1S2Z A;  2Z5P A;  5E1U A;  2CHP A;  4MN9 A;  5GU1 X;  1UMN A;  2X17 0;  3WVU A;  5ERK A;  5JKM A;  3E1M A;  2FKZ A;  3GHQ A;  2FG8 A;  3RD0 A;  2HTN A;  4XKT A;  4ZKH A;  1RCI A;  3Q4N A;  3QHC A;  3U90 A;  4EVE A;  3R2S A;  4KVS A;  4EVC A;  3E1J A;  5CZU A;  3AJO A;  3PWF A;  2W0O A;  4II4 A;  2V2M A;  1NF6 A;  3F38 A;  1BG7 A;  4RC6 B;  1MOJ A;  2IU2 A;  4Z5S A;  1BFR A;  2CLB A;  4RC5 A;  3KA6 A;  1F30 A;  4M32 A;  3NP2 X;  3SHX A;  4Z3B A;  2V2P A;  5J8S A;  2PYB A;  4DYU A;  4CVP A;  1UVH A;  5JKL A;  1TJO A;  2OC5 A;  3E6S A;  3PW1 B;  5LG2 A;  5GU0 X;  4LPN A;  3WNW A;  2IB0 A;  2ZA6 A;  2D5K A;  4MKU A;  2YW6 A;  2QF9 A;  3KA3 A;  3PVR A;  3PVY B;  2JD8 0;  1XZ3 A;  3BT5 A;  2V2L A;  1YUX A;  1QYB A;  1S30 A;  3IS7 A;  4CMY V;  4EVD A;  2VXI A;  5GU3 X;  1IER A;  3SH6 A;  5GU2 X;  1BCF A;  2VXX A;  1LB3 A;  3E1O A;  1SQ3 A;  1RYT A;  2CEI A;  1LKM A;  1H96 A;  3Q4R A;  5D8P A;  4REU A;  5GN8 B;  4LQV A;  5D8O A;  2YJJ A;  4PGK A;  1DPS A;  4R42 A;  3ISF A;  1RCD A;  4TOE A;  4DYZ A;  4RC6 A;  3A9Q A;  3PW8 C;  3TA8 A;  3EGM A;  4LQN A;  3E1N A;  2FZF A;  2V2R A;  2V15 A;  1J30 A;  2CIH A;  3AF8 X;  1TKO A;  4CVS A;  2Z5Q A;  4AM4 A;  2ZA8 A;  1Z4A A;  4MJY A;  3AJQ A;  1YV1 A;  5IX6 A;  2JD7 0;  5D8X A;  3QD8 A;  2BJY A;  5JKM G;  2FHA A;  3PW1 A;  2VZB A;  4ZMC A;  2CF7 A;  3AK8 A;  1LKP A;  1LKO A;  3EZU A;  4XKU A;  3IQ1 A;  5J8W A;  1ZS3 A;  2V2I A;  1AEW A;  1XZ1 A;  4EVB A;  4QUW A;  3AF9 X;  3PVY A;  2UX1 A;  2V2S A;  3E1P A;  5CMR A;  2GS4 A;  5J93 A;  3FI6 A;  3AJP A;  4TOG A;  3R2M A;  3F32 A;  3BVL A;  4P18 A;  3SE1 A;  5LBH A;  3E1Q A;  1NNQ A;  4DZ0 A;  4DYY A;  5K53 A;  4DI0 A;  4ML5 A;  1F33 A;  4CVR A;  2IY4 A;  3QB9 A;  3BVI A;  3MPS A;  5JKL G;  4YKH A;  3F34 A;  5GN8 A;  1JGC A;  5LG8 A;  2C2U A;  4LQJ A;  4XKS A;  3QHB A;  4KVQ A;  5C6F A;  1S3Q A;  3BKN A;  5J9V A;  5HJH A;  4U3G A;  1VEL A;  4ZKX A;  4IWJ A;  2FJC A;  1Z6O M;  4TW3 A;  1R03 A;  3QZ3 A;  4Y08 A;  2C2J A;  4M35 A;  2Z6M A;  5HJF A;  2CN7 A;  2YW7 A;  2V2O A;  1JRE A;  4RC7 B;  5JAC A;  2WTL A;  4CVT A;  3ES3 A;  3RBC A;  3OGH A;  3HIU A;  4ZTT A;  2WLA A;  3RAV A;  3PWQ A;  5FFB A;  2GYD A;  4AM2 A;  4ERU A;  3KA8 A;  4PGI A;  1VLG A;  1JKU A;  4IXK A;  5HQO A;  1L8H A;  1JKV A;  1NF4 A;  2Y3Q A;  4ISM A;  2CLU A;  3R2O A;  4LPJ A;  4TOH A;  4A25 A;  5FFD A;  1JI5 A;  1ZUJ A;  4LQH A;  5ERJ A;  2CN6 A;  2CHI A;  1VEQ A;  3O7S A;  3ERZ A;  1L8I A;  5E2D A;  3F36 A;  2G4H A;  3QVD A;  3F39 A;  2XJM A;  5D8S A;  3FSE A;  1O9I A;  1JIG A;  2ITB A;  3E1L A;  3FVB A;  1JI4 A;  1YUZ A;  3UNO A;  4DAS A;  4MUD A;  3PVT B;  2FL0 A;  4OYN A;  2C2F A;  3IS8 A;  5FEJ A;  2WLU A;  1OTK A;  1HRS A;  1Z6O A;  2HR5 A;  3SID A;  3AK9 A;  4AM5 A;  4ZKW A;  2C41 A;  3NP0 X;  3BVK A;  4ITT A;  4CMY A;  3F35 A;  5FFC A;  4DYX A;  1IES A;  2Z90 A;  1MFR A;  1GWG A;  1TKP A;  4LYU A;  5D8R A;  4RC7 A;  1TK6 A;  3F37 A;  3ISE A;  4TOB A;  2Z5R A;  3A68 A;  2BK6 A;  4ZLW A;  4E6K A;  5K52 A;  4KVR A;  3RE7 A;  4RC8 A;  2XGW A;  4ZL6 A;  4M34 A;  2BKC A;  2F7N A;  4ZL5 A;  4TOF A;  4ETR A;  4TOC A;  2ZG7 X;  5D8Y A;  1NFV A;  3GE4 A;  3KA9 A;  4CYA A;  3NOZ X;  3GVY A;  2JD6 0;  3R2K A;  1DVB A;  3BVE A;  3KWO A;  3E2C A;  3WVV A;  3Q4Q A;  1DAT A;  3EZ0 A;  3R2L A;  4TO9 A;  3H7G A;  3KX9 A;  5FFA A;  3PZA A;  5D8Q A;  1SOF A;  4LPM A;  2ZUR X;  5AXS A;  1VJX A;  2FG4 A;  2C6R A;  3AF7 X;  3F33 A;  3PVT A;  4XGS A;  2QQY A;  1FHA A;  3PWQ C;  3R2H A;  2YJK A;  5FFE A;  4ITW A;  3VNX A;  1O9R A;  4TOD A;  1B71 A;  5CMQ A;  4M33 A;  1N1Q A;  2ZG8 X;  4IWK A;  4MY7 A;  3O7R A;  4DE6 A;  3OJ5 A;  1VEI A;  4CY9 A;  3KA4 A;  2GYQ A;  3KXU A;  2FFX J;  2XJO A;  4LYX A;  1QGH A;  4II4 B;  4ZJK A;  5I4J A;  1JTS A;  1RCG A;  2BW1 A;  3HL1 A;  4RC5 B;  3RGD A;  4ISP A;  2XJN A;  3T9J A;  2ZA7 A;  5LS9 A;  2ZG9 X;  2XKQ A;  3BVF A;  3Q4O A;  3UOI A;  1JYB A;  1RCE A;  2V2N A;  4CYB A;  2V2J A;  3WVW A;  5GOU A;  2OH3 A;  3R2R A; 
#chains in the Genus database with same CATH topology
 1EUM A;  3PW8 A;  3PVR B;  2RBD A;  1KRQ A;  1RCC A;  4TOA A;  2OKC A;  3E6R A;  3UOF A;  4PG1 A;  3VV9 A;  4PG0 A;  1S2Z A;  2Z5P A;  5E1U A;  2CHP A;  4MN9 A;  5GU1 X;  1UMN A;  2X17 0;  3WVU A;  5ERK A;  5JKM A;  3E1M A;  2FKZ A;  3GHQ A;  3KDQ A;  2FG8 A;  3RD0 A;  2HTN A;  4XKT A;  3W54 A;  4ZKH A;  1RCI A;  3Q4N A;  3QHC A;  3U90 A;  4EVE A;  3R2S A;  4KVS A;  4EVC A;  3E1J A;  3GGZ A;  5CZU A;  3AJO A;  3PWF A;  2W0O A;  4II4 A;  2V2M A;  1NF6 A;  3F38 A;  1BG7 A;  4RC6 B;  1MOJ A;  2WWX B;  2IU2 A;  4Z5S A;  1BFR A;  2CLB A;  4RC5 A;  3KA6 A;  1F30 A;  4M32 A;  3NP2 X;  3SHX A;  4Z3B A;  2V2P A;  5J8S A;  2PYB A;  4DYU A;  4CVP A;  1UVH A;  5JKL A;  1TJO A;  4WJG 4;  2OC5 A;  3E6S A;  3PW1 B;  3C1Y A;  5LG2 A;  5GU0 X;  4LPN A;  3WNW A;  2IB0 A;  2ZA6 A;  2D5K A;  4MKU A;  2YW6 A;  2QF9 A;  3KA3 A;  3PVR A;  3PVY B;  2JD8 0;  1XZ3 A;  3BT5 A;  2V2L A;  1YUX A;  1QYB A;  1S30 A;  3IS7 A;  4YXM A;  4CMY V;  4EVD A;  4W4L B;  2VXI A;  5GU3 X;  1IER A;  3SH6 A;  5GU2 X;  1BCF A;  2VXX A;  1LB3 A;  3E1O A;  1SQ3 A;  1RYT A;  2CEI A;  1LKM A;  1H96 A;  3Q4R A;  5D8P A;  4REU A;  5GN8 B;  2AR0 A;  4LQV A;  2V8T A;  5D8O A;  2YJJ A;  4PGK A;  1DPS A;  4R42 A;  3DBY A;  3ISF A;  1RCD A;  4TOE A;  4DYZ A;  4RC6 A;  3A9Q A;  3PW8 C;  3TA8 A;  3EGM A;  4LQN A;  3E1N A;  4X0J A;  2FZF A;  2V2R A;  2V15 A;  1J30 A;  2CIH A;  3AF8 X;  1TKO A;  4CVS A;  2Z5Q A;  3V3K B;  4AM4 A;  2ZA8 A;  1Z4A A;  4MJY A;  3AJQ A;  1YV1 A;  2MGY A;  5IX6 A;  2JD7 0;  5JDO B;  5D8X A;  3QD8 A;  2BJY A;  5JKM G;  2FHA A;  3PW1 A;  2VZB A;  4ZMC A;  2CF7 A;  3AK8 A;  1LKP A;  1LKO A;  3EZU A;  4XKU A;  3IQ1 A;  4E40 A;  5J8W A;  1ZS3 A;  2V2I A;  3UFB A;  1AEW A;  1XZ1 A;  4EVB A;  4QUW A;  3AF9 X;  3PVY A;  2UX1 A;  2V2S A;  3D19 A;  3E1P A;  5CMR A;  2GS4 A;  5J93 A;  3FI6 A;  3AJP A;  4TOG A;  3R2M A;  3F32 A;  3BVL A;  4P18 A;  3SE1 A;  5LBH A;  3E1Q A;  1NNQ A;  4DZ0 A;  4DYY A;  5K53 A;  3JZA B;  4DI0 A;  4ML5 A;  1F33 A;  4CVR A;  2IY4 A;  3QB9 A;  3BVI A;  3MPS A;  5JKL G;  4YKH A;  3F34 A;  5GN8 A;  1JGC A;  5LG8 A;  2C2U A;  4LQJ A;  4XKS A;  3QHB A;  4KVQ A;  5C6F A;  1S3Q A;  3BKN A;  5J9V A;  5HJH A;  4U3G A;  1VEL A;  4ZKX A;  3VVA A;  4IWJ A;  2FJC A;  1Z6O M;  4YVZ A;  4TW3 A;  1R03 A;  3QZ3 A;  4Y08 A;  2C2J A;  4M35 A;  2Z6M A;  5HJF A;  2CN7 A;  2YW7 A;  2V2O A;  1JRE A;  4RC7 B;  5JAC A;  2WTL A;  4CVT A;  3ES3 A;  3RBC A;  5JDO A;  3OGH A;  3HIU A;  4ZTT A;  2WLA A;  3RAV A;  3PWQ A;  5FFB A;  2GYD A;  4AM2 A;  4ERU A;  3KA8 A;  4PGI A;  1VLG A;  1JKU A;  4IXK A;  5HQO A;  1L8H A;  1JKV A;  1NF4 A;  2Y3Q A;  4ISM A;  2CLU A;  3M6J A;  2V8U A;  3R2O A;  4LPJ A;  2G38 B;  4TOH A;  5FFD A;  4A25 A;  1JI5 A;  1ZUJ A;  4LQH A;  5ERJ A;  2CN6 A;  2CHI A;  1VEQ A;  3O7S A;  3ERZ A;  1L8I A;  5E2D A;  3F36 A;  2G4H A;  3QVD A;  3F39 A;  2XJM A;  5D8S A;  3FSE A;  5HU6 D;  1O9I A;  1JIG A;  2ITB A;  3E1L A;  3FVB A;  1JI4 A;  1YUZ A;  3UNO A;  4DAS A;  4MUD A;  3PVT B;  2FL0 A;  4OYN A;  2C2F A;  3IS8 A;  5FEJ A;  2WLU A;  1OTK A;  1HRS A;  1Z6O A;  2HR5 A;  3SID A;  3AK9 A;  4AM5 A;  4ZKW A;  2C41 A;  3NP0 X;  3BVK A;  4ITT A;  4CMY A;  3F35 A;  5FFC A;  4DYX A;  1IES A;  2Z90 A;  1MFR A;  1GWG A;  1TKP A;  4LYU A;  5D8R A;  4RC7 A;  1TK6 A;  3F37 A;  3ISE A;  4TOB A;  2Z5R A;  3A68 A;  2BK6 A;  4ZLW A;  4E6K A;  5K52 A;  3KHK A;  4KVR A;  3RE7 A;  3FRR A;  4RC8 A;  2XGW A;  4ZL6 A;  4M34 A;  2BKC A;  2F7N A;  4ZL5 A;  4TOF A;  4ETR A;  4TOC A;  2ZG7 X;  5D8Y A;  1NFV A;  3GE4 A;  3KA9 A;  4CYA A;  3NOZ X;  3GVY A;  2JD6 0;  3R2K A;  3GGY A;  1DVB A;  3BVE A;  3KWO A;  3E2C A;  3WVV A;  3Q4Q A;  1DAT A;  3EZ0 A;  3R2L A;  4TO9 A;  3H7G A;  3KX9 A;  5FFA A;  3PZA A;  5D8Q A;  3FRS A;  1SOF A;  4LPM A;  2ZUR X;  5AXS A;  1VJX A;  2FG4 A;  2C6R A;  3AF7 X;  3F33 A;  3PVT A;  4XGS A;  2Y44 A;  3C21 A;  2QQY A;  3L0M A;  1FHA A;  3PWQ C;  3R2H A;  2YJK A;  5FFE A;  4KXR B;  4ITW A;  3VNX A;  3C23 A;  1O9R A;  4TOD A;  3LKD A;  1B71 A;  5CMQ A;  4M33 A;  1N1Q A;  2ZG8 X;  4IWK A;  4MY7 A;  3O7R A;  4DE6 A;  3OJ5 A;  1VEI A;  4CY9 A;  3KA4 A;  2GYQ A;  3KXU A;  2FFX J;  2XJO A;  4LYX A;  1QGH A;  4II4 B;  4ZJK A;  5I4J A;  1JTS A;  1RCG A;  2BW1 A;  4YXJ A;  3HL1 A;  2CWL A;  4RC5 B;  3RGD A;  4ISP A;  4MXP A;  3N6O A;  3C1Z A;  2XJN A;  3T9J A;  2ZA7 A;  5LS9 A;  2ZG9 X;  2XKQ A;  3BVF A;  4W4K B;  3JZ9 A;  3Q4O A;  3UOI A;  1JYB A;  1RCE A;  2N02 A;  2V2N A;  4CYB A;  2V2J A;  3WVW A;  5GOU A;  2OH3 A;  3R2R A; 
#chains in the Genus database with same CATH homology
 1EUM A;  3PW8 A;  3PVR B;  2RBD A;  1KRQ A;  1RCC A;  4TOA A;  2OKC A;  3E6R A;  3UOF A;  4PG1 A;  3VV9 A;  4PG0 A;  1S2Z A;  2Z5P A;  5E1U A;  2CHP A;  4MN9 A;  5GU1 X;  1UMN A;  2X17 0;  3WVU A;  5ERK A;  5JKM A;  3E1M A;  2FKZ A;  3GHQ A;  3KDQ A;  2FG8 A;  3RD0 A;  2HTN A;  4XKT A;  3W54 A;  4ZKH A;  1RCI A;  3Q4N A;  3QHC A;  3U90 A;  4EVE A;  3R2S A;  4KVS A;  4EVC A;  3E1J A;  3GGZ A;  5CZU A;  3AJO A;  3PWF A;  2W0O A;  4II4 A;  2V2M A;  1NF6 A;  3F38 A;  1BG7 A;  4RC6 B;  1MOJ A;  2WWX B;  2IU2 A;  4Z5S A;  1BFR A;  2CLB A;  4RC5 A;  3KA6 A;  1F30 A;  4M32 A;  3NP2 X;  3SHX A;  4Z3B A;  2V2P A;  5J8S A;  2PYB A;  4DYU A;  4CVP A;  1UVH A;  5JKL A;  1TJO A;  4WJG 4;  2OC5 A;  3E6S A;  3PW1 B;  3C1Y A;  5LG2 A;  5GU0 X;  4LPN A;  3WNW A;  2IB0 A;  2ZA6 A;  2D5K A;  4MKU A;  2YW6 A;  2QF9 A;  3KA3 A;  3PVR A;  3PVY B;  2JD8 0;  1XZ3 A;  3BT5 A;  2V2L A;  1YUX A;  1QYB A;  1S30 A;  3IS7 A;  4YXM A;  4CMY V;  4EVD A;  4W4L B;  2VXI A;  5GU3 X;  1IER A;  3SH6 A;  5GU2 X;  1BCF A;  2VXX A;  1LB3 A;  3E1O A;  1SQ3 A;  1RYT A;  2CEI A;  1LKM A;  1H96 A;  3Q4R A;  5D8P A;  4REU A;  5GN8 B;  2AR0 A;  4LQV A;  2V8T A;  5D8O A;  2YJJ A;  4PGK A;  1DPS A;  4R42 A;  3DBY A;  3ISF A;  1RCD A;  4TOE A;  4DYZ A;  4RC6 A;  3A9Q A;  3PW8 C;  3TA8 A;  3EGM A;  4LQN A;  3E1N A;  4X0J A;  2FZF A;  2V2R A;  2V15 A;  1J30 A;  2CIH A;  3AF8 X;  1TKO A;  4CVS A;  2Z5Q A;  3V3K B;  4AM4 A;  2ZA8 A;  1Z4A A;  4MJY A;  3AJQ A;  1YV1 A;  2MGY A;  5IX6 A;  2JD7 0;  5JDO B;  5D8X A;  3QD8 A;  2BJY A;  5JKM G;  2FHA A;  3PW1 A;  2VZB A;  4ZMC A;  2CF7 A;  3AK8 A;  1LKP A;  1LKO A;  3EZU A;  4XKU A;  3IQ1 A;  4E40 A;  5J8W A;  1ZS3 A;  2V2I A;  3UFB A;  1AEW A;  1XZ1 A;  4EVB A;  4QUW A;  3AF9 X;  3PVY A;  2UX1 A;  2V2S A;  3D19 A;  3E1P A;  5CMR A;  2GS4 A;  5J93 A;  3FI6 A;  3AJP A;  4TOG A;  3R2M A;  3F32 A;  3BVL A;  4P18 A;  3SE1 A;  5LBH A;  3E1Q A;  1NNQ A;  4DZ0 A;  4DYY A;  5K53 A;  3JZA B;  4DI0 A;  4ML5 A;  1F33 A;  4CVR A;  2IY4 A;  3QB9 A;  3BVI A;  3MPS A;  5JKL G;  4YKH A;  3F34 A;  5GN8 A;  1JGC A;  5LG8 A;  2C2U A;  4LQJ A;  4XKS A;  3QHB A;  4KVQ A;  5C6F A;  1S3Q A;  3BKN A;  5J9V A;  5HJH A;  4U3G A;  1VEL A;  4ZKX A;  3VVA A;  4IWJ A;  2FJC A;  1Z6O M;  4YVZ A;  4TW3 A;  1R03 A;  3QZ3 A;  4Y08 A;  2C2J A;  4M35 A;  2Z6M A;  5HJF A;  2CN7 A;  2YW7 A;  2V2O A;  1JRE A;  4RC7 B;  5JAC A;  2WTL A;  4CVT A;  3ES3 A;  3RBC A;  5JDO A;  3OGH A;  3HIU A;  4ZTT A;  2WLA A;  3RAV A;  3PWQ A;  5FFB A;  2GYD A;  4AM2 A;  4ERU A;  3KA8 A;  4PGI A;  1VLG A;  1JKU A;  4IXK A;  5HQO A;  1L8H A;  1JKV A;  1NF4 A;  2Y3Q A;  4ISM A;  2CLU A;  3M6J A;  2V8U A;  3R2O A;  4LPJ A;  2G38 B;  4TOH A;  5FFD A;  4A25 A;  1JI5 A;  1ZUJ A;  4LQH A;  5ERJ A;  2CN6 A;  2CHI A;  1VEQ A;  3O7S A;  3ERZ A;  1L8I A;  5E2D A;  3F36 A;  2G4H A;  3QVD A;  3F39 A;  2XJM A;  5D8S A;  3FSE A;  5HU6 D;  1O9I A;  1JIG A;  2ITB A;  3E1L A;  3FVB A;  1JI4 A;  1YUZ A;  3UNO A;  4DAS A;  4MUD A;  3PVT B;  2FL0 A;  4OYN A;  2C2F A;  3IS8 A;  5FEJ A;  2WLU A;  1OTK A;  1HRS A;  1Z6O A;  2HR5 A;  3SID A;  3AK9 A;  4AM5 A;  4ZKW A;  2C41 A;  3NP0 X;  3BVK A;  4ITT A;  4CMY A;  3F35 A;  5FFC A;  4DYX A;  1IES A;  2Z90 A;  1MFR A;  1GWG A;  1TKP A;  4LYU A;  5D8R A;  4RC7 A;  1TK6 A;  3F37 A;  3ISE A;  4TOB A;  2Z5R A;  3A68 A;  2BK6 A;  4ZLW A;  4E6K A;  5K52 A;  3KHK A;  4KVR A;  3RE7 A;  3FRR A;  4RC8 A;  2XGW A;  4ZL6 A;  4M34 A;  2BKC A;  2F7N A;  4ZL5 A;  4TOF A;  4ETR A;  4TOC A;  2ZG7 X;  5D8Y A;  1NFV A;  3GE4 A;  3KA9 A;  4CYA A;  3NOZ X;  3GVY A;  2JD6 0;  3R2K A;  3GGY A;  1DVB A;  3BVE A;  3KWO A;  3E2C A;  3WVV A;  3Q4Q A;  1DAT A;  3EZ0 A;  3R2L A;  4TO9 A;  3H7G A;  3KX9 A;  5FFA A;  3PZA A;  5D8Q A;  3FRS A;  1SOF A;  4LPM A;  2ZUR X;  5AXS A;  1VJX A;  2FG4 A;  2C6R A;  3AF7 X;  3F33 A;  3PVT A;  4XGS A;  2Y44 A;  3C21 A;  2QQY A;  3L0M A;  1FHA A;  3PWQ C;  3R2H A;  2YJK A;  5FFE A;  4KXR B;  4ITW A;  3VNX A;  3C23 A;  1O9R A;  4TOD A;  3LKD A;  1B71 A;  5CMQ A;  4M33 A;  1N1Q A;  2ZG8 X;  4IWK A;  4MY7 A;  3O7R A;  4DE6 A;  3OJ5 A;  1VEI A;  4CY9 A;  3KA4 A;  2GYQ A;  3KXU A;  2FFX J;  2XJO A;  4LYX A;  1QGH A;  4II4 B;  4ZJK A;  5I4J A;  1JTS A;  1RCG A;  2BW1 A;  4YXJ A;  3HL1 A;  2CWL A;  4RC5 B;  3RGD A;  4ISP A;  4MXP A;  3N6O A;  3C1Z A;  2XJN A;  3T9J A;  2ZA7 A;  5LS9 A;  2ZG9 X;  2XKQ A;  3BVF A;  4W4K B;  3JZ9 A;  3Q4O A;  3UOI A;  1JYB A;  1RCE A;  2N02 A;  2V2N A;  4CYB A;  2V2J A;  3WVW A;  5GOU A;  2OH3 A;  3R2R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...