3Q4NA

Crystal structure of hypothetical protein mj0754 from methanococcus jannaschii dsm 2661
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
169
structure length
169
Chain Sequence
PISEEEKEGLIEMREEEKLARDVYLTLYNKWKLQIFKNIAESEQTHMDAVKYLLEKYNIPDPVKNDSIGVFSNPKFEELYKKLVEKGDKSEVDALKVGATIEDLDIADLEKWINKTDNEDIKFVYENLMKGSRNHMRAFVRMLNNYGSNYTPQYISKEEYEEIISSSTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein MJ0754
publication title Structural insights into the metal binding properties of hypothetical protein MJ0754 from Methanococcus jannaschii DSM 2661
doi rcsb
source organism Methanocaldococcus jannaschii
total genus 77
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09968 DUF2202 Uncharacterized protein domain (DUF2202)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3q4nA00
5GOUA 4TOEA 5FFCA 2YJKA 3RAVA 1IESA 2V2SA 3BVIA 2XKQA 1SQ3A 1RCIA 4ZL5A 1TJOA 5E2DA 5LBHA 2IY4A 4IWJA 5FFBA 1AEWA 3Q4RA 1MOJA 3QD8A 1FHAA 2XJNA 3AF9X 2XJMA 4AM5A 1NF6A 4M32A 3QHBA 4RC6B 1QYBA 4OYNA 3O7SA 4LYUA 4MUDA 2V2NA 3BVEA 4MY7A 2G4HA 2XGWA 3U90A 1SOFA 2CLUA 2F7NA 1O9RA 3PWFA 5JKLG 4M33A 5JKMG 5J8WA 4ZKHA 3SH6A 4KVQA 4LPJA 2ZG8X 4RC6A 3RE7A 4QUWA 4EVEA 5E1UA 4LQHA 4KVRA 3PVYB 2FJCA 3PVTB 5CZUA 3F32A 3RGDA 3SIDA 4CMYA 4XKSA 3R2HA 2Z5QA 2GS4A 5GN8B 3UOIA 2C2UA 3AK8A 5HJHA 1VLGA 4P18A 5I4JA 5HJFA 3IS8A 1JKVA 3RBCA 3QHCA 1MFRA 2BW1A 1ZS3A 2QQYA 2UX1A 3PVYA 3F36A 1JGCA 4LPMA 2OH3A 2YW6A 1JTSA 1YUXA 3AF7X 1TK6A 3R2RA 2Z6MA 1QGHA 2CN6A 2ZA8A 2HTNA 4LQNA 4II4B 2IB0A 5D8YA 3NP2X 2FZFA 3TA8A 3GVYA 3H7GA 2W0OA 1VEIA 1DPSA 2BKCA 4CMYV 1GWGA 3OJ5A 3R2MA 5FFAA 4DASA 1Z6OM 5LG8A 3EZ0A 3F35A 3NP0X 4LYXA 1Z6OA 4LPNA 4A25A 2V2IA 2CHPA 3KA4A 4PGIA 2PYBA 3R2SA 1R03A 4II4A 4TOFA 3E1JA 4AM2A 4REUA 3KA3A 3GE4A 3AF8X 4MJYA 4PG1A 3BVLA 2JD70 2HR5A 1RCCA 5LG2A 2XJOA 2Z5RA 4TO9A 3E1MA 3QZ3A 5AXSA 1Z4AA 2C6RA 4RC5B 4TOCA 4XKTA 2QF9A 4CY9A 1S30A 1L8IA 2V2PA 2Y3QA 3F39A 3T9JA 3WNWA 3KWOA 4RC8A 1ZUJA 3IQ1A 5CMQA 3HIUA 2FHAA 4DYZA 2V2LA 4YKHA 5GU3X 4Z3BA 4XKUA 3EGMA 4U3GA 5ERKA 4CYAA 4RC5A 3AJQA 1O9IA 3BVKA 3O7RA 2IU2A 3E1QA 4M34A 3Q4OA 4ISPA 1TKPA 1NFVA 2CN7A 1NNQA 2ITBA 3ISEA 4IWKA 2CLBA 5D8PA 3EZUA 3PWQA 3GHQA 5J8SA 3ERZA 2V2RA 3F34A 4CVPA 3SE1A 2GYDA 2V2MA 4IXKA 4PGKA 3E2CA 3PZAA 3WVUA 1UVHA 2WTLA 1YV1A 5D8OA 4ITWA 2CHIA 3F37A 4TW3A 1LKPA 3IS7A 3E1NA 3KA9A 1J30A 4Z5SA 4DI0A 3BVFA 1JIGA 2Z90A 1L8HA 3FSEA 2FL0A 3KX9A 1RCDA 3R2LA 3UOFA 3AJOA 5GU0X 2YJJA 3Q4QA 4ETRA 3WVVA 3MPSA 4ISMA 1S3QA 2YW7A 3UNOA 3KA8A 1JI4A 1RYTA 1F33A 2VXXA 4AM4A 1VJXA 4MKUA 2ZA7A 3WVWA 3ES3A 4TOBA 4EVBA 4E6KA 4CVRA 3QVDA 1BFRA 2Z5PA 3NOZX 5K53A 2JD60 1JYBA 4DYYA 3PVRB 2C2JA 1XZ3A 5J9VA 2D5KA 1F30A 2FG8A 1IERA 3F38A 3E6SA 1LKOA 2V2JA 3PW1B 1OTKA 4DYUA 4TOHA 4EVDA 3R2OA 1EUMA 3KXUA 3PVRA 5K52A 1RCGA 1VEQA 4KVSA 1KRQA 2WLUA 4TOGA 4TOAA 3RD0A 2X170 4ITTA 5D8RA 1LB3A 2ZG7X 3SHXA 1BG7A 5LS9A 3Q4NA 3R2KA 3PW1A 2CIHA 2GYQA 3QB9A 5JACA 5ERJA 5C6FA 3VNXA 4ZJKA 1JKUA 2VZBA 2BJYA 5D8XA 4LQJA 4ML5A 1YUZA 1NF4A 3KA6A 5CMRA 5D8QA 2V2OA 4Y08A 5GU1X 2WLAA 2FG4A 5FFDA 1RCEA 2CF7A 3PWQC 4DZ0A 3A9QA 3AK9A 1VELA 4PG0A 5JKLA 3E1LA 4RC7B 2ZA6A 3PW8A 4M35A 5FEJA 5JKMA 2VXIA 2FKZA 1S2ZA 3BT5A 1N1QA 5HQOA 2C41A 2OC5A 1LKMA 4ZTTA 5FFEA 3PW8C 3FVBA 4EVCA 4DYXA 3AJPA 3E1OA 4DE6A 1XZ1A 3F33A 3E1PA 3E6RA 1JREA 4ZMCA 3HL1A 1HRSA 3PVTA 1UMNA 4ZKWA 1H96A 4ZLWA 4CYBA 3ISFA 4TODA 2JD80 4CVSA 5D8SA 4RC7A 4CVTA 2BK6A 4ZKXA 1DATA 3FI6A 5GN8A 4LQVA 3A68A 2C2FA 2ZG9X 2V15A 4XGSA 4MN9A 1DVBA 1BCFA 3BKNA 3OGHA 5J93A 5GU2X 1B71A 4R42A 1TKOA 2CEIA 5IX6A 2RBDA 2FFXJ 4ZL6A 4ERUA 1JI5A 2ZURX
chains in the Genus database with same CATH superfamily
5GOUA 4TOEA 5FFCA 2YJKA 3RAVA 3UFBA 1IESA 2V2SA 3BVIA 2XKQA 3W54A 1SQ3A 1RCIA 4ZL5A 1TJOA 5E2DA 5LBHA 2IY4A 4IWJA 5FFBA 1AEWA 3Q4RA 1MOJA 3QD8A 1FHAA 2XJNA 3AF9X 2XJMA 4AM5A 1NF6A 4M32A 3M6JA 3QHBA 4RC6B 1QYBA 4OYNA 3O7SA 4LYUA 4MUDA 2V2NA 3BVEA 4MY7A 2G4HA 2XGWA 3U90A 1SOFA 2CLUA 2F7NA 1O9RA 3PWFA 5JKLG 4M33A 5JKMG 5J8WA 4ZKHA 3SH6A 4KVQA 4LPJA 2ZG8X 4RC6A 3RE7A 4QUWA 5JDOB 4EVEA 4W4LB 4LQHA 5E1UA 4KVRA 3PVYB 3JZ9A 2FJCA 3PVTB 5CZUA 3F32A 3RGDA 3SIDA 4CMYA 3C1YA 4XKSA 3R2HA 2Z5QA 2GS4A 4X0JA 5GN8B 3UOIA 2C2UA 3AK8A 5HJHA 1VLGA 4P18A 5I4JA 3L0MA 5HJFA 3IS8A 5JDOA 1JKVA 3RBCA 3QHCA 1MFRA 2BW1A 1ZS3A 2QQYA 2UX1A 3PVYA 3V3KB 5HU6D 4MXPA 3F36A 2V8UA 1JGCA 2OH3A 2YW6A 4LPMA 1JTSA 1YUXA 3AF7X 1TK6A 3R2RA 2Z6MA 1QGHA 2CN6A 2ZA8A 2HTNA 4LQNA 4II4B 2IB0A 5D8YA 3NP2X 2FZFA 3TA8A 3GVYA 3H7GA 2W0OA 1VEIA 1DPSA 3FRRA 2BKCA 4CMYV 1GWGA 3OJ5A 3R2MA 5FFAA 4DASA 3DBYA 1Z6OM 5LG8A 3EZ0A 3F35A 3NP0X 4LYXA 1Z6OA 4LPNA 4A25A 2V2IA 2CHPA 3KA4A 4PGIA 2PYBA 3R2SA 1R03A 4II4A 4TOFA 3E1JA 4AM2A 4REUA 3KA3A 2V8TA 3GE4A 3AF8X 4MJYA 4PG1A 3BVLA 2JD70 2HR5A 1RCCA 5LG2A 2XJOA 2Z5RA 4TO9A 3E1MA 3GGYA 3QZ3A 3C1ZA 5AXSA 1Z4AA 2C6RA 4RC5B 4TOCA 4XKTA 2QF9A 4CY9A 1S30A 1L8IA 2V2PA 2Y3QA 3F39A 3T9JA 3WNWA 3KWOA 4RC8A 2G38B 1ZUJA 3IQ1A 5CMQA 3HIUA 4WJG4 2CWLA 2FHAA 4DYZA 2V2LA 4YKHA 5GU3X 3JZAB 4Z3BA 3FRSA 2MGYA 4XKUA 3EGMA 4U3GA 5ERKA 4CYAA 4RC5A 3AJQA 1O9IA 3BVKA 3O7RA 2IU2A 3E1QA 3Q4OA 4ISPA 4M34A 1TKPA 1NFVA 2CN7A 1NNQA 2ITBA 3ISEA 4IWKA 2CLBA 5D8PA 3EZUA 3PWQA 3GHQA 3D19A 5J8SA 3ERZA 2V2RA 3F34A 4CVPA 3SE1A 2GYDA 2V2MA 4IXKA 4PGKA 3E2CA 3PZAA 3WVUA 1UVHA 2WTLA 1YV1A 5D8OA 4ITWA 2CHIA 3F37A 3KDQA 4TW3A 1LKPA 3IS7A 3E1NA 3KA9A 1J30A 4Z5SA 4DI0A 3BVFA 3C21A 1JIGA 2Z90A 1L8HA 3FSEA 2FL0A 3KX9A 1RCDA 3R2LA 3UOFA 3AJOA 5GU0X 2YJJA 3Q4QA 4ETRA 3C23A 4KXRB 3WVVA 3MPSA 4ISMA 1S3QA 2YW7A 3UNOA 3VV9A 4YXMA 3KA8A 1JI4A 1RYTA 1F33A 2VXXA 4AM4A 1VJXA 4MKUA 2ZA7A 3WVWA 3ES3A 4TOBA 4EVBA 4E6KA 4CVRA 3QVDA 1BFRA 2Z5PA 3NOZX 5K53A 2JD60 1JYBA 4DYYA 3PVRB 2C2JA 1XZ3A 5J9VA 2D5KA 1F30A 2FG8A 1IERA 3F38A 3E6SA 1LKOA 2V2JA 3PW1B 1OTKA 4DYUA 4TOHA 2Y44A 4EVDA 3R2OA 1EUMA 3KXUA 3PVRA 5K52A 3N6OA 1RCGA 1VEQA 4KVSA 1KRQA 2WLUA 4TOGA 4TOAA 3RD0A 2X170 4ITTA 5D8RA 1LB3A 2ZG7X 3SHXA 1BG7A 5LS9A 3Q4NA 3R2KA 3PW1A 2CIHA 3LKDA 2GYQA 3QB9A 3GGZA 5JACA 5ERJA 5C6FA 2OKCA 3VNXA 4ZJKA 1JKUA 2VZBA 4YXJA 2BJYA 5D8XA 4LQJA 4ML5A 1YUZA 1NF4A 3KA6A 5CMRA 5D8QA 2V2OA 4Y08A 5GU1X 2WLAA 2FG4A 5FFDA 3VVAA 1RCEA 2CF7A 3PWQC 4DZ0A 3A9QA 2WWXB 3AK9A 1VELA 4PG0A 5JKLA 3E1LA 4RC7B 2ZA6A 4E40A 3KHKA 3PW8A 4M35A 5FEJA 5JKMA 2VXIA 2FKZA 1S2ZA 3BT5A 1N1QA 5HQOA 2C41A 2OC5A 1LKMA 4ZTTA 5FFEA 3PW8C 3FVBA 4EVCA 4DYXA 3AJPA 3E1OA 4DE6A 1XZ1A 4W4KB 3F33A 3E1PA 3E6RA 4YVZA 1JREA 4ZMCA 3HL1A 1HRSA 3PVTA 1UMNA 4ZKWA 1H96A 4ZLWA 4CYBA 3ISFA 4TODA 2JD80 4CVSA 5D8SA 4RC7A 4CVTA 2BK6A 4ZKXA 1DATA 2AR0A 3FI6A 5GN8A 4LQVA 3A68A 2C2FA 2ZG9X 2V15A 4XGSA 4MN9A 1DVBA 1BCFA 3BKNA 3OGHA 5J93A 5GU2X 1B71A 4R42A 1TKOA 2CEIA 5IX6A 2RBDA 2N02A 2FFXJ 4ZL6A 4ERUA 1JI5A 2ZURX
chains in the Genus database with same CATH topology
5GOUA 4TOEA 5FFCA 2YJKA 3RAVA 3UFBA 1IESA 2V2SA 3BVIA 2XKQA 3W54A 1SQ3A 1RCIA 4ZL5A 1TJOA 5E2DA 5LBHA 2IY4A 4IWJA 5FFBA 1AEWA 3Q4RA 1MOJA 3QD8A 1FHAA 2XJNA 3AF9X 2XJMA 4AM5A 1NF6A 4M32A 3M6JA 3QHBA 4RC6B 1QYBA 4OYNA 3O7SA 4LYUA 4MUDA 2V2NA 3BVEA 4MY7A 2G4HA 2XGWA 3U90A 1SOFA 2CLUA 2F7NA 1O9RA 3PWFA 5JKLG 4M33A 5JKMG 5J8WA 4ZKHA 3SH6A 4KVQA 4LPJA 2ZG8X 4RC6A 3RE7A 4QUWA 5JDOB 4EVEA 4W4LB 4LQHA 5E1UA 4KVRA 3PVYB 3JZ9A 2FJCA 3PVTB 5CZUA 3F32A 3RGDA 3SIDA 4CMYA 3C1YA 4XKSA 3R2HA 2Z5QA 2GS4A 4X0JA 5GN8B 3UOIA 2C2UA 3AK8A 5HJHA 1VLGA 4P18A 5I4JA 3L0MA 5HJFA 3IS8A 5JDOA 1JKVA 3RBCA 3QHCA 1MFRA 2BW1A 1ZS3A 2QQYA 2UX1A 3PVYA 3V3KB 5HU6D 4MXPA 3F36A 2V8UA 1JGCA 2OH3A 2YW6A 4LPMA 1JTSA 1YUXA 3AF7X 1TK6A 3R2RA 2Z6MA 1QGHA 2CN6A 2ZA8A 2HTNA 4LQNA 4II4B 2IB0A 5D8YA 3NP2X 2FZFA 3TA8A 3GVYA 3H7GA 2W0OA 1VEIA 1DPSA 3FRRA 2BKCA 4CMYV 1GWGA 3OJ5A 3R2MA 5FFAA 4DASA 3DBYA 1Z6OM 5LG8A 3EZ0A 3F35A 3NP0X 4LYXA 1Z6OA 4LPNA 4A25A 2V2IA 2CHPA 3KA4A 4PGIA 2PYBA 3R2SA 1R03A 4II4A 4TOFA 3E1JA 4AM2A 4REUA 3KA3A 2V8TA 3GE4A 3AF8X 4MJYA 4PG1A 3BVLA 2JD70 2HR5A 1RCCA 5LG2A 2XJOA 2Z5RA 4TO9A 3E1MA 3GGYA 3QZ3A 3C1ZA 5AXSA 1Z4AA 2C6RA 4RC5B 4TOCA 4XKTA 2QF9A 4CY9A 1S30A 1L8IA 2V2PA 2Y3QA 3F39A 3T9JA 3WNWA 3KWOA 4RC8A 2G38B 1ZUJA 3IQ1A 5CMQA 3HIUA 4WJG4 2CWLA 2FHAA 4DYZA 2V2LA 4YKHA 5GU3X 3JZAB 4Z3BA 3FRSA 2MGYA 4XKUA 3EGMA 4U3GA 5ERKA 4CYAA 4RC5A 3AJQA 1O9IA 3BVKA 3O7RA 2IU2A 3E1QA 3Q4OA 4ISPA 4M34A 1TKPA 1NFVA 2CN7A 1NNQA 2ITBA 3ISEA 4IWKA 2CLBA 5D8PA 3EZUA 3PWQA 3GHQA 3D19A 5J8SA 3ERZA 2V2RA 3F34A 4CVPA 3SE1A 2GYDA 2V2MA 4IXKA 4PGKA 3E2CA 3PZAA 3WVUA 1UVHA 2WTLA 1YV1A 5D8OA 4ITWA 2CHIA 3F37A 3KDQA 4TW3A 1LKPA 3IS7A 3E1NA 3KA9A 1J30A 4Z5SA 4DI0A 3BVFA 3C21A 1JIGA 2Z90A 1L8HA 3FSEA 2FL0A 3KX9A 1RCDA 3R2LA 3UOFA 3AJOA 5GU0X 2YJJA 3Q4QA 4ETRA 3C23A 4KXRB 3WVVA 3MPSA 4ISMA 1S3QA 2YW7A 3UNOA 3VV9A 4YXMA 3KA8A 1JI4A 1RYTA 1F33A 2VXXA 4AM4A 1VJXA 4MKUA 2ZA7A 3WVWA 3ES3A 4TOBA 4EVBA 4E6KA 4CVRA 3QVDA 1BFRA 2Z5PA 3NOZX 5K53A 2JD60 1JYBA 4DYYA 3PVRB 2C2JA 1XZ3A 5J9VA 2D5KA 1F30A 2FG8A 1IERA 3F38A 3E6SA 1LKOA 2V2JA 3PW1B 1OTKA 4DYUA 4TOHA 2Y44A 4EVDA 3R2OA 1EUMA 3KXUA 3PVRA 5K52A 3N6OA 1RCGA 1VEQA 4KVSA 1KRQA 2WLUA 4TOGA 4TOAA 3RD0A 2X170 4ITTA 5D8RA 1LB3A 2ZG7X 3SHXA 1BG7A 5LS9A 3Q4NA 3R2KA 3PW1A 2CIHA 3LKDA 2GYQA 3QB9A 3GGZA 5JACA 5ERJA 5C6FA 2OKCA 3VNXA 4ZJKA 1JKUA 2VZBA 4YXJA 2BJYA 5D8XA 4LQJA 4ML5A 1YUZA 1NF4A 3KA6A 5CMRA 5D8QA 2V2OA 4Y08A 5GU1X 2WLAA 2FG4A 5FFDA 3VVAA 1RCEA 2CF7A 3PWQC 4DZ0A 3A9QA 2WWXB 3AK9A 1VELA 4PG0A 5JKLA 3E1LA 4RC7B 2ZA6A 4E40A 3KHKA 3PW8A 4M35A 5FEJA 5JKMA 2VXIA 2FKZA 1S2ZA 3BT5A 1N1QA 5HQOA 2C41A 2OC5A 1LKMA 4ZTTA 5FFEA 3PW8C 3FVBA 4EVCA 4DYXA 3AJPA 3E1OA 4DE6A 1XZ1A 4W4KB 3F33A 3E1PA 3E6RA 4YVZA 1JREA 4ZMCA 3HL1A 1HRSA 3PVTA 1UMNA 4ZKWA 1H96A 4ZLWA 4CYBA 3ISFA 4TODA 2JD80 4CVSA 5D8SA 4RC7A 4CVTA 2BK6A 4ZKXA 1DATA 2AR0A 3FI6A 5GN8A 4LQVA 3A68A 2C2FA 2ZG9X 2V15A 4XGSA 4MN9A 1DVBA 1BCFA 3BKNA 3OGHA 5J93A 5GU2X 1B71A 4R42A 1TKOA 2CEIA 5IX6A 2RBDA 2N02A 2FFXJ 4ZL6A 4ERUA 1JI5A 2ZURX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GOU A;  4TOE A;  5FFC A;  2YJK A;  3RAV A;  1IES A;  2V2S A;  3BVI A;  2XKQ A;  1SQ3 A;  1RCI A;  4ZL5 A;  1TJO A;  5E2D A;  5LBH A;  2IY4 A;  4IWJ A;  5FFB A;  1AEW A;  3Q4R A;  1MOJ A;  3QD8 A;  1FHA A;  2XJN A;  3AF9 X;  2XJM A;  4AM5 A;  1NF6 A;  4M32 A;  3QHB A;  4RC6 B;  1QYB A;  4OYN A;  3O7S A;  4LYU A;  4MUD A;  2V2N A;  3BVE A;  4MY7 A;  2G4H A;  2XGW A;  3U90 A;  1SOF A;  2CLU A;  2F7N A;  1O9R A;  3PWF A;  5JKL G;  4M33 A;  5JKM G;  5J8W A;  4ZKH A;  3SH6 A;  4KVQ A;  4LPJ A;  2ZG8 X;  4RC6 A;  3RE7 A;  4QUW A;  4EVE A;  5E1U A;  4LQH A;  4KVR A;  3PVY B;  2FJC A;  3PVT B;  5CZU A;  3F32 A;  3RGD A;  3SID A;  4CMY A;  4XKS A;  3R2H A;  2Z5Q A;  2GS4 A;  5GN8 B;  3UOI A;  2C2U A;  3AK8 A;  5HJH A;  1VLG A;  4P18 A;  5I4J A;  5HJF A;  3IS8 A;  1JKV A;  3RBC A;  3QHC A;  1MFR A;  2BW1 A;  1ZS3 A;  2QQY A;  2UX1 A;  3PVY A;  3F36 A;  1JGC A;  4LPM A;  2OH3 A;  2YW6 A;  1JTS A;  1YUX A;  3AF7 X;  1TK6 A;  3R2R A;  2Z6M A;  1QGH A;  2CN6 A;  2ZA8 A;  2HTN A;  4LQN A;  4II4 B;  2IB0 A;  5D8Y A;  3NP2 X;  2FZF A;  3TA8 A;  3GVY A;  3H7G A;  2W0O A;  1VEI A;  1DPS A;  2BKC A;  4CMY V;  1GWG A;  3OJ5 A;  3R2M A;  5FFA A;  4DAS A;  1Z6O M;  5LG8 A;  3EZ0 A;  3F35 A;  3NP0 X;  4LYX A;  1Z6O A;  4LPN A;  4A25 A;  2V2I A;  2CHP A;  3KA4 A;  4PGI A;  2PYB A;  3R2S A;  1R03 A;  4II4 A;  4TOF A;  3E1J A;  4AM2 A;  4REU A;  3KA3 A;  3GE4 A;  3AF8 X;  4MJY A;  4PG1 A;  3BVL A;  2JD7 0;  2HR5 A;  1RCC A;  5LG2 A;  2XJO A;  2Z5R A;  4TO9 A;  3E1M A;  3QZ3 A;  5AXS A;  1Z4A A;  2C6R A;  4RC5 B;  4TOC A;  4XKT A;  2QF9 A;  4CY9 A;  1S30 A;  1L8I A;  2V2P A;  2Y3Q A;  3F39 A;  3T9J A;  3WNW A;  3KWO A;  4RC8 A;  1ZUJ A;  3IQ1 A;  5CMQ A;  3HIU A;  2FHA A;  4DYZ A;  2V2L A;  4YKH A;  5GU3 X;  4Z3B A;  4XKU A;  3EGM A;  4U3G A;  5ERK A;  4CYA A;  4RC5 A;  3AJQ A;  1O9I A;  3BVK A;  3O7R A;  2IU2 A;  3E1Q A;  4M34 A;  3Q4O A;  4ISP A;  1TKP A;  1NFV A;  2CN7 A;  1NNQ A;  2ITB A;  3ISE A;  4IWK A;  2CLB A;  5D8P A;  3EZU A;  3PWQ A;  3GHQ A;  5J8S A;  3ERZ A;  2V2R A;  3F34 A;  4CVP A;  3SE1 A;  2GYD A;  2V2M A;  4IXK A;  4PGK A;  3E2C A;  3PZA A;  3WVU A;  1UVH A;  2WTL A;  1YV1 A;  5D8O A;  4ITW A;  2CHI A;  3F37 A;  4TW3 A;  1LKP A;  3IS7 A;  3E1N A;  3KA9 A;  1J30 A;  4Z5S A;  4DI0 A;  3BVF A;  1JIG A;  2Z90 A;  1L8H A;  3FSE A;  2FL0 A;  3KX9 A;  1RCD A;  3R2L A;  3UOF A;  3AJO A;  5GU0 X;  2YJJ A;  3Q4Q A;  4ETR A;  3WVV A;  3MPS A;  4ISM A;  1S3Q A;  2YW7 A;  3UNO A;  3KA8 A;  1JI4 A;  1RYT A;  1F33 A;  2VXX A;  4AM4 A;  1VJX A;  4MKU A;  2ZA7 A;  3WVW A;  3ES3 A;  4TOB A;  4EVB A;  4E6K A;  4CVR A;  3QVD A;  1BFR A;  2Z5P A;  3NOZ X;  5K53 A;  2JD6 0;  1JYB A;  4DYY A;  3PVR B;  2C2J A;  1XZ3 A;  5J9V A;  2D5K A;  1F30 A;  2FG8 A;  1IER A;  3F38 A;  3E6S A;  1LKO A;  2V2J A;  3PW1 B;  1OTK A;  4DYU A;  4TOH A;  4EVD A;  3R2O A;  1EUM A;  3KXU A;  3PVR A;  5K52 A;  1RCG A;  1VEQ A;  4KVS A;  1KRQ A;  2WLU A;  4TOG A;  4TOA A;  3RD0 A;  2X17 0;  4ITT A;  5D8R A;  1LB3 A;  2ZG7 X;  3SHX A;  1BG7 A;  5LS9 A;  3Q4N A;  3R2K A;  3PW1 A;  2CIH A;  2GYQ A;  3QB9 A;  5JAC A;  5ERJ A;  5C6F A;  3VNX A;  4ZJK A;  1JKU A;  2VZB A;  2BJY A;  5D8X A;  4LQJ A;  4ML5 A;  1YUZ A;  1NF4 A;  3KA6 A;  5CMR A;  5D8Q A;  2V2O A;  4Y08 A;  5GU1 X;  2WLA A;  2FG4 A;  5FFD A;  1RCE A;  2CF7 A;  3PWQ C;  4DZ0 A;  3A9Q A;  3AK9 A;  1VEL A;  4PG0 A;  5JKL A;  3E1L A;  4RC7 B;  2ZA6 A;  3PW8 A;  4M35 A;  5FEJ A;  5JKM A;  2VXI A;  2FKZ A;  1S2Z A;  3BT5 A;  1N1Q A;  5HQO A;  2C41 A;  2OC5 A;  1LKM A;  4ZTT A;  5FFE A;  3PW8 C;  3FVB A;  4EVC A;  4DYX A;  3AJP A;  3E1O A;  4DE6 A;  1XZ1 A;  3F33 A;  3E1P A;  3E6R A;  1JRE A;  4ZMC A;  3HL1 A;  1HRS A;  3PVT A;  1UMN A;  4ZKW A;  1H96 A;  4ZLW A;  4CYB A;  3ISF A;  4TOD A;  2JD8 0;  4CVS A;  5D8S A;  4RC7 A;  4CVT A;  2BK6 A;  4ZKX A;  1DAT A;  3FI6 A;  5GN8 A;  4LQV A;  3A68 A;  2C2F A;  2ZG9 X;  2V15 A;  4XGS A;  4MN9 A;  1DVB A;  1BCF A;  3BKN A;  3OGH A;  5J93 A;  5GU2 X;  1B71 A;  4R42 A;  1TKO A;  2CEI A;  5IX6 A;  2RBD A;  2FFX J;  4ZL6 A;  4ERU A;  1JI5 A;  2ZUR X; 
#chains in the Genus database with same CATH topology
 5GOU A;  4TOE A;  5FFC A;  2YJK A;  3RAV A;  3UFB A;  1IES A;  2V2S A;  3BVI A;  2XKQ A;  3W54 A;  1SQ3 A;  1RCI A;  4ZL5 A;  1TJO A;  5E2D A;  5LBH A;  2IY4 A;  4IWJ A;  5FFB A;  1AEW A;  3Q4R A;  1MOJ A;  3QD8 A;  1FHA A;  2XJN A;  3AF9 X;  2XJM A;  4AM5 A;  1NF6 A;  4M32 A;  3M6J A;  3QHB A;  4RC6 B;  1QYB A;  4OYN A;  3O7S A;  4LYU A;  4MUD A;  2V2N A;  3BVE A;  4MY7 A;  2G4H A;  2XGW A;  3U90 A;  1SOF A;  2CLU A;  2F7N A;  1O9R A;  3PWF A;  5JKL G;  4M33 A;  5JKM G;  5J8W A;  4ZKH A;  3SH6 A;  4KVQ A;  4LPJ A;  2ZG8 X;  4RC6 A;  3RE7 A;  4QUW A;  5JDO B;  4EVE A;  4W4L B;  4LQH A;  5E1U A;  4KVR A;  3PVY B;  3JZ9 A;  2FJC A;  3PVT B;  5CZU A;  3F32 A;  3RGD A;  3SID A;  4CMY A;  3C1Y A;  4XKS A;  3R2H A;  2Z5Q A;  2GS4 A;  4X0J A;  5GN8 B;  3UOI A;  2C2U A;  3AK8 A;  5HJH A;  1VLG A;  4P18 A;  5I4J A;  3L0M A;  5HJF A;  3IS8 A;  5JDO A;  1JKV A;  3RBC A;  3QHC A;  1MFR A;  2BW1 A;  1ZS3 A;  2QQY A;  2UX1 A;  3PVY A;  3V3K B;  5HU6 D;  4MXP A;  3F36 A;  2V8U A;  1JGC A;  2OH3 A;  2YW6 A;  4LPM A;  1JTS A;  1YUX A;  3AF7 X;  1TK6 A;  3R2R A;  2Z6M A;  1QGH A;  2CN6 A;  2ZA8 A;  2HTN A;  4LQN A;  4II4 B;  2IB0 A;  5D8Y A;  3NP2 X;  2FZF A;  3TA8 A;  3GVY A;  3H7G A;  2W0O A;  1VEI A;  1DPS A;  3FRR A;  2BKC A;  4CMY V;  1GWG A;  3OJ5 A;  3R2M A;  5FFA A;  4DAS A;  3DBY A;  1Z6O M;  5LG8 A;  3EZ0 A;  3F35 A;  3NP0 X;  4LYX A;  1Z6O A;  4LPN A;  4A25 A;  2V2I A;  2CHP A;  3KA4 A;  4PGI A;  2PYB A;  3R2S A;  1R03 A;  4II4 A;  4TOF A;  3E1J A;  4AM2 A;  4REU A;  3KA3 A;  2V8T A;  3GE4 A;  3AF8 X;  4MJY A;  4PG1 A;  3BVL A;  2JD7 0;  2HR5 A;  1RCC A;  5LG2 A;  2XJO A;  2Z5R A;  4TO9 A;  3E1M A;  3GGY A;  3QZ3 A;  3C1Z A;  5AXS A;  1Z4A A;  2C6R A;  4RC5 B;  4TOC A;  4XKT A;  2QF9 A;  4CY9 A;  1S30 A;  1L8I A;  2V2P A;  2Y3Q A;  3F39 A;  3T9J A;  3WNW A;  3KWO A;  4RC8 A;  2G38 B;  1ZUJ A;  3IQ1 A;  5CMQ A;  3HIU A;  4WJG 4;  2CWL A;  2FHA A;  4DYZ A;  2V2L A;  4YKH A;  5GU3 X;  3JZA B;  4Z3B A;  3FRS A;  2MGY A;  4XKU A;  3EGM A;  4U3G A;  5ERK A;  4CYA A;  4RC5 A;  3AJQ A;  1O9I A;  3BVK A;  3O7R A;  2IU2 A;  3E1Q A;  3Q4O A;  4ISP A;  4M34 A;  1TKP A;  1NFV A;  2CN7 A;  1NNQ A;  2ITB A;  3ISE A;  4IWK A;  2CLB A;  5D8P A;  3EZU A;  3PWQ A;  3GHQ A;  3D19 A;  5J8S A;  3ERZ A;  2V2R A;  3F34 A;  4CVP A;  3SE1 A;  2GYD A;  2V2M A;  4IXK A;  4PGK A;  3E2C A;  3PZA A;  3WVU A;  1UVH A;  2WTL A;  1YV1 A;  5D8O A;  4ITW A;  2CHI A;  3F37 A;  3KDQ A;  4TW3 A;  1LKP A;  3IS7 A;  3E1N A;  3KA9 A;  1J30 A;  4Z5S A;  4DI0 A;  3BVF A;  3C21 A;  1JIG A;  2Z90 A;  1L8H A;  3FSE A;  2FL0 A;  3KX9 A;  1RCD A;  3R2L A;  3UOF A;  3AJO A;  5GU0 X;  2YJJ A;  3Q4Q A;  4ETR A;  3C23 A;  4KXR B;  3WVV A;  3MPS A;  4ISM A;  1S3Q A;  2YW7 A;  3UNO A;  3VV9 A;  4YXM A;  3KA8 A;  1JI4 A;  1RYT A;  1F33 A;  2VXX A;  4AM4 A;  1VJX A;  4MKU A;  2ZA7 A;  3WVW A;  3ES3 A;  4TOB A;  4EVB A;  4E6K A;  4CVR A;  3QVD A;  1BFR A;  2Z5P A;  3NOZ X;  5K53 A;  2JD6 0;  1JYB A;  4DYY A;  3PVR B;  2C2J A;  1XZ3 A;  5J9V A;  2D5K A;  1F30 A;  2FG8 A;  1IER A;  3F38 A;  3E6S A;  1LKO A;  2V2J A;  3PW1 B;  1OTK A;  4DYU A;  4TOH A;  2Y44 A;  4EVD A;  3R2O A;  1EUM A;  3KXU A;  3PVR A;  5K52 A;  3N6O A;  1RCG A;  1VEQ A;  4KVS A;  1KRQ A;  2WLU A;  4TOG A;  4TOA A;  3RD0 A;  2X17 0;  4ITT A;  5D8R A;  1LB3 A;  2ZG7 X;  3SHX A;  1BG7 A;  5LS9 A;  3Q4N A;  3R2K A;  3PW1 A;  2CIH A;  3LKD A;  2GYQ A;  3QB9 A;  3GGZ A;  5JAC A;  5ERJ A;  5C6F A;  2OKC A;  3VNX A;  4ZJK A;  1JKU A;  2VZB A;  4YXJ A;  2BJY A;  5D8X A;  4LQJ A;  4ML5 A;  1YUZ A;  1NF4 A;  3KA6 A;  5CMR A;  5D8Q A;  2V2O A;  4Y08 A;  5GU1 X;  2WLA A;  2FG4 A;  5FFD A;  3VVA A;  1RCE A;  2CF7 A;  3PWQ C;  4DZ0 A;  3A9Q A;  2WWX B;  3AK9 A;  1VEL A;  4PG0 A;  5JKL A;  3E1L A;  4RC7 B;  2ZA6 A;  4E40 A;  3KHK A;  3PW8 A;  4M35 A;  5FEJ A;  5JKM A;  2VXI A;  2FKZ A;  1S2Z A;  3BT5 A;  1N1Q A;  5HQO A;  2C41 A;  2OC5 A;  1LKM A;  4ZTT A;  5FFE A;  3PW8 C;  3FVB A;  4EVC A;  4DYX A;  3AJP A;  3E1O A;  4DE6 A;  1XZ1 A;  4W4K B;  3F33 A;  3E1P A;  3E6R A;  4YVZ A;  1JRE A;  4ZMC A;  3HL1 A;  1HRS A;  3PVT A;  1UMN A;  4ZKW A;  1H96 A;  4ZLW A;  4CYB A;  3ISF A;  4TOD A;  2JD8 0;  4CVS A;  5D8S A;  4RC7 A;  4CVT A;  2BK6 A;  4ZKX A;  1DAT A;  2AR0 A;  3FI6 A;  5GN8 A;  4LQV A;  3A68 A;  2C2F A;  2ZG9 X;  2V15 A;  4XGS A;  4MN9 A;  1DVB A;  1BCF A;  3BKN A;  3OGH A;  5J93 A;  5GU2 X;  1B71 A;  4R42 A;  1TKO A;  2CEI A;  5IX6 A;  2RBD A;  2N02 A;  2FFX J;  4ZL6 A;  4ERU A;  1JI5 A;  2ZUR X; 
#chains in the Genus database with same CATH homology
 5GOU A;  4TOE A;  5FFC A;  2YJK A;  3RAV A;  3UFB A;  1IES A;  2V2S A;  3BVI A;  2XKQ A;  3W54 A;  1SQ3 A;  1RCI A;  4ZL5 A;  1TJO A;  5E2D A;  5LBH A;  2IY4 A;  4IWJ A;  5FFB A;  1AEW A;  3Q4R A;  1MOJ A;  3QD8 A;  1FHA A;  2XJN A;  3AF9 X;  2XJM A;  4AM5 A;  1NF6 A;  4M32 A;  3M6J A;  3QHB A;  4RC6 B;  1QYB A;  4OYN A;  3O7S A;  4LYU A;  4MUD A;  2V2N A;  3BVE A;  4MY7 A;  2G4H A;  2XGW A;  3U90 A;  1SOF A;  2CLU A;  2F7N A;  1O9R A;  3PWF A;  5JKL G;  4M33 A;  5JKM G;  5J8W A;  4ZKH A;  3SH6 A;  4KVQ A;  4LPJ A;  2ZG8 X;  4RC6 A;  3RE7 A;  4QUW A;  5JDO B;  4EVE A;  4W4L B;  4LQH A;  5E1U A;  4KVR A;  3PVY B;  3JZ9 A;  2FJC A;  3PVT B;  5CZU A;  3F32 A;  3RGD A;  3SID A;  4CMY A;  3C1Y A;  4XKS A;  3R2H A;  2Z5Q A;  2GS4 A;  4X0J A;  5GN8 B;  3UOI A;  2C2U A;  3AK8 A;  5HJH A;  1VLG A;  4P18 A;  5I4J A;  3L0M A;  5HJF A;  3IS8 A;  5JDO A;  1JKV A;  3RBC A;  3QHC A;  1MFR A;  2BW1 A;  1ZS3 A;  2QQY A;  2UX1 A;  3PVY A;  3V3K B;  5HU6 D;  4MXP A;  3F36 A;  2V8U A;  1JGC A;  2OH3 A;  2YW6 A;  4LPM A;  1JTS A;  1YUX A;  3AF7 X;  1TK6 A;  3R2R A;  2Z6M A;  1QGH A;  2CN6 A;  2ZA8 A;  2HTN A;  4LQN A;  4II4 B;  2IB0 A;  5D8Y A;  3NP2 X;  2FZF A;  3TA8 A;  3GVY A;  3H7G A;  2W0O A;  1VEI A;  1DPS A;  3FRR A;  2BKC A;  4CMY V;  1GWG A;  3OJ5 A;  3R2M A;  5FFA A;  4DAS A;  3DBY A;  1Z6O M;  5LG8 A;  3EZ0 A;  3F35 A;  3NP0 X;  4LYX A;  1Z6O A;  4LPN A;  4A25 A;  2V2I A;  2CHP A;  3KA4 A;  4PGI A;  2PYB A;  3R2S A;  1R03 A;  4II4 A;  4TOF A;  3E1J A;  4AM2 A;  4REU A;  3KA3 A;  2V8T A;  3GE4 A;  3AF8 X;  4MJY A;  4PG1 A;  3BVL A;  2JD7 0;  2HR5 A;  1RCC A;  5LG2 A;  2XJO A;  2Z5R A;  4TO9 A;  3E1M A;  3GGY A;  3QZ3 A;  3C1Z A;  5AXS A;  1Z4A A;  2C6R A;  4RC5 B;  4TOC A;  4XKT A;  2QF9 A;  4CY9 A;  1S30 A;  1L8I A;  2V2P A;  2Y3Q A;  3F39 A;  3T9J A;  3WNW A;  3KWO A;  4RC8 A;  2G38 B;  1ZUJ A;  3IQ1 A;  5CMQ A;  3HIU A;  4WJG 4;  2CWL A;  2FHA A;  4DYZ A;  2V2L A;  4YKH A;  5GU3 X;  3JZA B;  4Z3B A;  3FRS A;  2MGY A;  4XKU A;  3EGM A;  4U3G A;  5ERK A;  4CYA A;  4RC5 A;  3AJQ A;  1O9I A;  3BVK A;  3O7R A;  2IU2 A;  3E1Q A;  3Q4O A;  4ISP A;  4M34 A;  1TKP A;  1NFV A;  2CN7 A;  1NNQ A;  2ITB A;  3ISE A;  4IWK A;  2CLB A;  5D8P A;  3EZU A;  3PWQ A;  3GHQ A;  3D19 A;  5J8S A;  3ERZ A;  2V2R A;  3F34 A;  4CVP A;  3SE1 A;  2GYD A;  2V2M A;  4IXK A;  4PGK A;  3E2C A;  3PZA A;  3WVU A;  1UVH A;  2WTL A;  1YV1 A;  5D8O A;  4ITW A;  2CHI A;  3F37 A;  3KDQ A;  4TW3 A;  1LKP A;  3IS7 A;  3E1N A;  3KA9 A;  1J30 A;  4Z5S A;  4DI0 A;  3BVF A;  3C21 A;  1JIG A;  2Z90 A;  1L8H A;  3FSE A;  2FL0 A;  3KX9 A;  1RCD A;  3R2L A;  3UOF A;  3AJO A;  5GU0 X;  2YJJ A;  3Q4Q A;  4ETR A;  3C23 A;  4KXR B;  3WVV A;  3MPS A;  4ISM A;  1S3Q A;  2YW7 A;  3UNO A;  3VV9 A;  4YXM A;  3KA8 A;  1JI4 A;  1RYT A;  1F33 A;  2VXX A;  4AM4 A;  1VJX A;  4MKU A;  2ZA7 A;  3WVW A;  3ES3 A;  4TOB A;  4EVB A;  4E6K A;  4CVR A;  3QVD A;  1BFR A;  2Z5P A;  3NOZ X;  5K53 A;  2JD6 0;  1JYB A;  4DYY A;  3PVR B;  2C2J A;  1XZ3 A;  5J9V A;  2D5K A;  1F30 A;  2FG8 A;  1IER A;  3F38 A;  3E6S A;  1LKO A;  2V2J A;  3PW1 B;  1OTK A;  4DYU A;  4TOH A;  2Y44 A;  4EVD A;  3R2O A;  1EUM A;  3KXU A;  3PVR A;  5K52 A;  3N6O A;  1RCG A;  1VEQ A;  4KVS A;  1KRQ A;  2WLU A;  4TOG A;  4TOA A;  3RD0 A;  2X17 0;  4ITT A;  5D8R A;  1LB3 A;  2ZG7 X;  3SHX A;  1BG7 A;  5LS9 A;  3Q4N A;  3R2K A;  3PW1 A;  2CIH A;  3LKD A;  2GYQ A;  3QB9 A;  3GGZ A;  5JAC A;  5ERJ A;  5C6F A;  2OKC A;  3VNX A;  4ZJK A;  1JKU A;  2VZB A;  4YXJ A;  2BJY A;  5D8X A;  4LQJ A;  4ML5 A;  1YUZ A;  1NF4 A;  3KA6 A;  5CMR A;  5D8Q A;  2V2O A;  4Y08 A;  5GU1 X;  2WLA A;  2FG4 A;  5FFD A;  3VVA A;  1RCE A;  2CF7 A;  3PWQ C;  4DZ0 A;  3A9Q A;  2WWX B;  3AK9 A;  1VEL A;  4PG0 A;  5JKL A;  3E1L A;  4RC7 B;  2ZA6 A;  4E40 A;  3KHK A;  3PW8 A;  4M35 A;  5FEJ A;  5JKM A;  2VXI A;  2FKZ A;  1S2Z A;  3BT5 A;  1N1Q A;  5HQO A;  2C41 A;  2OC5 A;  1LKM A;  4ZTT A;  5FFE A;  3PW8 C;  3FVB A;  4EVC A;  4DYX A;  3AJP A;  3E1O A;  4DE6 A;  1XZ1 A;  4W4K B;  3F33 A;  3E1P A;  3E6R A;  4YVZ A;  1JRE A;  4ZMC A;  3HL1 A;  1HRS A;  3PVT A;  1UMN A;  4ZKW A;  1H96 A;  4ZLW A;  4CYB A;  3ISF A;  4TOD A;  2JD8 0;  4CVS A;  5D8S A;  4RC7 A;  4CVT A;  2BK6 A;  4ZKX A;  1DAT A;  2AR0 A;  3FI6 A;  5GN8 A;  4LQV A;  3A68 A;  2C2F A;  2ZG9 X;  2V15 A;  4XGS A;  4MN9 A;  1DVB A;  1BCF A;  3BKN A;  3OGH A;  5J93 A;  5GU2 X;  1B71 A;  4R42 A;  1TKO A;  2CEI A;  5IX6 A;  2RBD A;  2N02 A;  2FFX J;  4ZL6 A;  4ERU A;  1JI5 A;  2ZUR X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...