3Q4NA

Crystal structure of hypothetical protein mj0754 from methanococcus jannaschii dsm 2661
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
169
structure length
169
Chain Sequence
PISEEEKEGLIEMREEEKLARDVYLTLYNKWKLQIFKNIAESEQTHMDAVKYLLEKYNIPDPVKNDSIGVFSNPKFEELYKKLVEKGDKSEVDALKVGATIEDLDIADLEKWINKTDNEDIKFVYENLMKGSRNHMRAFVRMLNNYGSNYTPQYISKEEYEEIISSSTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ0754
publication title Structural insights into the metal binding properties of hypothetical protein MJ0754 from Methanococcus jannaschii DSM 2661
doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Unknown function
total genus 77
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09968 DUF2202 Uncharacterized protein domain (DUF2202)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3q4nA00
2PYBA 5E2DA 4Z5SA 5J93A 3EGMA 5GU0X 1F33A 2V2IA 3TA8A 5GN8A 3GHQA 4ML5A 3QVDA 2FL0A 2Z5QA 1UVHA 4TOHA 5D8SA 3AK8A 5GU2X 4ZL6A 1JKUA 1QGHA 3R2KA 4M35A 4PGIA 1S3QA 3AJPA 4RC5A 4TW3A 4XKSA 4CY9A 3UNOA 1TJOA 1TKPA 4TOFA 5GN8B 2QF9A 1EUMA 2Z90A 1ZS3A 4ISPA 3RGDA 4RC7A 2V15A 2V2RA 5ERKA 4XKUA 3EZ0A 1HRSA 4M32A 3F37A 1LKOA 5HJHA 2V2JA 4MKUA 4MJYA 4ZKWA 2ZA7A 4EVEA 4M34A 2C2JA 3R2SA 1S2ZA 2V2MA 3F36A 5D8QA 5FFBA 1Z6OM 2WLUA 4CVSA 3WVVA 4IWKA 4KVQA 1VEIA 3SH6A 5CMQA 5D8PA 3NP2X 2BW1A 3Q4NA 1YUZA 2FG4A 3F32A 3E1LA 3BVKA 4LQJA 3SE1A 4E6KA 3HIUA 1BG7A 4ITTA 5K53A 2IY4A 2ZURX 3E6RA 3R2MA 2D5KA 2ZG8X 2X170 4DI0A 1DVBA 1Z4AA 2YW6A 2HTNA 1JYBA 3A9QA 3KX9A 1DPSA 2BKCA 3KA8A 4DYZA 3BVFA 4ZLWA 3RE7A 2C6RA 2VXIA 3PVTB 5C6FA 3IS8A 2XGWA 2XJNA 4PGKA 1VJXA 5I4JA 3KWOA 1JI5A 3F38A 1RCCA 3ERZA 3ES3A 5JKMA 2CLBA 2Y3QA 5GOUA 2BK6A 4ETRA 5J9VA 4CVRA 1MFRA 2CEIA 2G4HA 5HQOA 1B71A 4AM5A 2OH3A 5LG2A 2V2OA 2ZA6A 5D8RA 5K52A 2JD60 1BFRA 5J8SA 5LBHA 4ZTTA 3PVRA 5GU3X 2CF7A 3Q4QA 4LQNA 4DZ0A 1IERA 1JI4A 3IQ1A 4IXKA 2CN7A 2CLUA 2W0OA 2YJKA 3BT5A 3HL1A 3QD8A 1JTSA 1LKMA 3VNXA 3Q4RA 2XJMA 4AM2A 2IU2A 1VLGA 2C2FA 3BKNA 5E1UA 3PVRB 2WLAA 4TODA 2WTLA 1O9RA 1N1QA 3E1OA 4YKHA 2CHIA 4PG0A 3E1QA 4EVCA 3E1PA 4CMYV 4P18A 2GS4A 1OTKA 3AF8X 1JKVA 3AF9X 1RCDA 4RC5B 3RAVA 4LQHA 3PWQA 2ZG7X 3PWQC 5JKMG 5D8OA 3QHBA 2V2SA 1NFVA 4RC7B 5GU1X 2UX1A 4II4A 4DYXA 1RCEA 4TOGA 3R2HA 5FFDA 4KVRA 3KA3A 2BJYA 4TOCA 3ISEA 4REUA 2CIHA 3F39A 5ERJA 2JD70 3EZUA 1AEWA 1TK6A 4DYUA 4EVBA 1R03A 1YV1A 4ZMCA 1XZ1A 4ZL5A 1QYBA 4RC6A 1TKOA 4EVDA 4MY7A 5JACA 3QB9A 1JGCA 4LPJA 3E1NA 4R42A 3FSEA 3KA6A 1KRQA 2V2NA 5FFAA 3WVUA 1O9IA 1JREA 1UMNA 2FJCA 3AK9A 3KA4A 4CVPA 3IS7A 1FHAA 5D8XA 3WNWA 1JIGA 3F35A 1J30A 2V2LA 3PW1A 4MN9A 1NF4A 3NP0X 4AM4A 1L8HA 1DATA 2QQYA 2ZG9X 2VZBA 2YW7A 2FFXJ 2RBDA 3BVLA 3R2OA 2CHPA 4LYXA 4CVTA 3PW1B 4A25A 3BVEA 3A68A 3NOZX 1VEQA 4XGSA 1NF6A 4TO9A 4LQVA 3SHXA 4M33A 5AXSA 3E1JA 2HR5A 2FG8A 5D8YA 3BVIA 4ZKXA 1BCFA 5LG8A 3PW8A 3RBCA 3WVWA 2C2UA 3PW8C 4OYNA 5FFEA 2YJJA 3GE4A 2ZA8A 1L8IA 4Y08A 5HJFA 5JKLA 4LPMA 1LB3A 1IESA 4CYAA 4CMYA 1XZ3A 5FEJA 3H7GA 4XKTA 3O7SA 3FI6A 1S30A 3O7RA 3F33A 5IX6A 3UOIA 2CN6A 2Z5RA 2FHAA 4U3GA 3RD0A 2F7NA 3UOFA 3FVBA 5CMRA 3T9JA 3R2RA 1RCIA 2XKQA 2Z6MA 1MOJA 3AJQA 2GYDA 2IB0A 4CYBA 5J8WA 3Q4OA 5CZUA 4KVSA 4II4B 3KXUA 3PZAA 2JD80 1F30A 4LPNA 2FKZA 4MUDA 3U90A 4TOBA 4Z3BA 3GVYA 3QZ3A 2OC5A 4ERUA 3PVTA 1H96A 3PVYA 2GYQA 4DE6A 4QUWA 2FZFA 5LS9A 4DASA 3E6SA 1SQ3A 4ZKHA 3SIDA 1Z6OA 1GWGA 1YUXA 1SOFA 3QHCA 3AJOA 4DYYA 4RC6B 1ZUJA 5JKLG 2V2PA 3PVYB 4PG1A 3E2CA 4ITWA 5FFCA 3ISFA 4LYUA 4IWJA 3OGHA 1VELA 4TOEA 3F34A 3R2LA 3MPSA 1LKPA 1RCGA 4TOAA 4RC8A 2C41A 3OJ5A 3PWFA 2ITBA 3AF7X 2VXXA 2XJOA 3E1MA 4ZJKA 4ISMA 3KA9A 2Z5PA 1NNQA 1RYTA
chains in the Genus database with same CATH superfamily
2PYBA 5E2DA 4Z5SA 3M6JA 5J93A 3EGMA 5GU0X 1F33A 2V2IA 3TA8A 5GN8A 3GHQA 4ML5A 3QVDA 2FL0A 2Z5QA 1UVHA 4TOHA 5D8SA 3AK8A 5GU2X 4ZL6A 1JKUA 2AR0A 1QGHA 3R2KA 4M35A 4PGIA 1S3QA 3AJPA 4RC5A 4TW3A 4XKSA 4CY9A 2Y44A 3UNOA 1TJOA 1TKPA 4TOFA 5GN8B 2QF9A 1EUMA 2Z90A 1ZS3A 4ISPA 3RGDA 4RC7A 2V15A 2V2RA 5ERKA 4XKUA 3EZ0A 5JDOB 1HRSA 4M32A 5HU6D 3F37A 1LKOA 5HJHA 2V2JA 4MKUA 4MJYA 4ZKWA 2ZA7A 4EVEA 4M34A 2C2JA 3R2SA 1S2ZA 3C1YA 2V2MA 3F36A 5D8QA 5FFBA 1Z6OM 2WLUA 4CVSA 3WVVA 4IWKA 4KVQA 1VEIA 3SH6A 5CMQA 4W4LB 5D8PA 3NP2X 2OKCA 2BW1A 3C23A 3Q4NA 1YUZA 2FG4A 3F32A 3E1LA 3BVKA 4LQJA 3SE1A 4E6KA 3HIUA 1BG7A 4ITTA 5K53A 2IY4A 2ZURX 3E6RA 3R2MA 2D5KA 2ZG8X 2X170 4DI0A 3DBYA 1DVBA 1Z4AA 2YW6A 2HTNA 1JYBA 3A9QA 3KX9A 1DPSA 2BKCA 3KA8A 4DYZA 3BVFA 4ZLWA 3RE7A 2C6RA 2VXIA 3PVTB 5C6FA 4WJG4 3IS8A 2XGWA 2XJNA 4PGKA 3FRSA 1VJXA 5I4JA 3KWOA 1JI5A 3F38A 1RCCA 3ERZA 4MXPA 3ES3A 5JKMA 2CLBA 2Y3QA 5GOUA 2BK6A 4ETRA 5J9VA 4CVRA 1MFRA 2CEIA 4W4KB 2G4HA 5HQOA 1B71A 3UFBA 2OH3A 5LG2A 4AM5A 2V2OA 2ZA6A 2N02A 5D8RA 5K52A 2JD60 1BFRA 5J8SA 5LBHA 4ZTTA 3PVRA 3GGZA 5GU3X 2CF7A 3Q4QA 4LQNA 4DZ0A 1IERA 1JI4A 3IQ1A 4IXKA 2CN7A 2CLUA 2W0OA 2YJKA 3BT5A 3HL1A 3QD8A 1JTSA 1LKMA 3VNXA 3Q4RA 2XJMA 4AM2A 2IU2A 1VLGA 2C2FA 3BKNA 5E1UA 4YXJA 3PVRB 2WLAA 4TODA 2WTLA 1O9RA 1N1QA 3E1OA 4YKHA 2CHIA 4PG0A 3E1QA 4EVCA 3E1PA 4CMYV 4P18A 3W54A 2GS4A 1OTKA 3AF8X 1JKVA 3AF9X 1RCDA 4RC5B 4X0JA 3RAVA 3VV9A 4LQHA 3PWQA 2ZG7X 3PWQC 5JKMG 5D8OA 3QHBA 2V2SA 1NFVA 4RC7B 5GU1X 2UX1A 4II4A 4DYXA 1RCEA 4TOGA 3R2HA 3L0MA 5FFDA 4KVRA 3KA3A 2BJYA 4TOCA 3ISEA 4REUA 2G38B 2CIHA 3F39A 5ERJA 2JD70 3EZUA 1AEWA 1TK6A 4DYUA 4EVBA 1R03A 1YV1A 4ZMCA 1XZ1A 4ZL5A 3N6OA 1QYBA 4RC6A 1TKOA 4EVDA 4MY7A 5JACA 3QB9A 1JGCA 4LPJA 3E1NA 4R42A 3FSEA 3KA6A 1KRQA 2V2NA 5FFAA 3WVUA 4YXMA 1O9IA 1JREA 1UMNA 2FJCA 3AK9A 3KA4A 4CVPA 3IS7A 1FHAA 5D8XA 3WNWA 1JIGA 3F35A 1J30A 2V2LA 3PW1A 3GGYA 4MN9A 1NF4A 3NP0X 4AM4A 1L8HA 1DATA 2QQYA 2ZG9X 2VZBA 2MGYA 2YW7A 2FFXJ 2RBDA 3BVLA 3R2OA 2CHPA 4LYXA 4CVTA 3PW1B 4A25A 3BVEA 3A68A 3NOZX 1VEQA 4XGSA 1NF6A 4TO9A 3JZ9A 4LQVA 3C21A 3SHXA 4M33A 3VVAA 5AXSA 3E1JA 2HR5A 2V8UA 2FG8A 5D8YA 3BVIA 4ZKXA 1BCFA 5LG8A 3PW8A 3RBCA 3WVWA 2C2UA 3PW8C 4OYNA 5FFEA 5JDOA 2YJJA 3GE4A 2ZA8A 3D19A 1L8IA 4Y08A 5HJFA 5JKLA 4LPMA 1LB3A 1IESA 4CYAA 4CMYA 1XZ3A 2CWLA 5FEJA 3H7GA 4XKTA 3O7SA 3FI6A 1S30A 3O7RA 2V8TA 3F33A 5IX6A 3UOIA 2CN6A 2Z5RA 2FHAA 3LKDA 4U3GA 3RD0A 2F7NA 3UOFA 3FVBA 5CMRA 3T9JA 3R2RA 3V3KB 1RCIA 2XKQA 2Z6MA 1MOJA 3AJQA 3JZAB 2GYDA 2IB0A 4E40A 4CYBA 5J8WA 3Q4OA 5CZUA 4KVSA 4II4B 3KXUA 3PZAA 2JD80 1F30A 4LPNA 2FKZA 4MUDA 3U90A 4TOBA 4Z3BA 3GVYA 3QZ3A 2OC5A 4ERUA 3PVTA 1H96A 3PVYA 2GYQA 3C1ZA 4DE6A 4QUWA 2FZFA 5LS9A 4DASA 3E6SA 1SQ3A 3FRRA 4ZKHA 4KXRB 3SIDA 1Z6OA 1GWGA 2WWXB 1YUXA 1SOFA 3QHCA 3AJOA 4DYYA 4RC6B 1ZUJA 5JKLG 2V2PA 3PVYB 4PG1A 3E2CA 4ITWA 5FFCA 3ISFA 4LYUA 4IWJA 3OGHA 3KDQA 1VELA 4TOEA 3F34A 3R2LA 3MPSA 1LKPA 1RCGA 4TOAA 4RC8A 2C41A 3OJ5A 3PWFA 2ITBA 3AF7X 4YVZA 2VXXA 2XJOA 3KHKA 3E1MA 4ZJKA 4ISMA 3KA9A 2Z5PA 1NNQA 1RYTA
chains in the Genus database with same CATH topology
2PYBA 5E2DA 4Z5SA 3M6JA 5J93A 3EGMA 5GU0X 1F33A 2V2IA 3TA8A 5GN8A 3GHQA 4ML5A 3QVDA 2FL0A 2Z5QA 1UVHA 4TOHA 5D8SA 3AK8A 5GU2X 4ZL6A 1JKUA 2AR0A 1QGHA 3R2KA 4M35A 4PGIA 1S3QA 3AJPA 4RC5A 4TW3A 4XKSA 4CY9A 2Y44A 3UNOA 1TJOA 1TKPA 4TOFA 5GN8B 2QF9A 1EUMA 2Z90A 1ZS3A 4ISPA 3RGDA 4RC7A 2V15A 2V2RA 5ERKA 4XKUA 3EZ0A 5JDOB 1HRSA 4M32A 5HU6D 3F37A 1LKOA 5HJHA 2V2JA 4MKUA 4MJYA 4ZKWA 2ZA7A 4EVEA 4M34A 2C2JA 3R2SA 1S2ZA 3C1YA 2V2MA 3F36A 5D8QA 5FFBA 1Z6OM 2WLUA 4CVSA 3WVVA 4IWKA 4KVQA 1VEIA 3SH6A 5CMQA 4W4LB 5D8PA 3NP2X 2OKCA 2BW1A 3C23A 3Q4NA 1YUZA 2FG4A 3F32A 3E1LA 3BVKA 4LQJA 3SE1A 4E6KA 3HIUA 1BG7A 4ITTA 5K53A 2IY4A 2ZURX 3E6RA 3R2MA 2D5KA 2ZG8X 2X170 4DI0A 3DBYA 1DVBA 1Z4AA 2YW6A 2HTNA 1JYBA 3A9QA 3KX9A 1DPSA 2BKCA 3KA8A 4DYZA 3BVFA 4ZLWA 3RE7A 2C6RA 2VXIA 3PVTB 5C6FA 4WJG4 3IS8A 2XGWA 2XJNA 4PGKA 3FRSA 1VJXA 5I4JA 3KWOA 1JI5A 3F38A 1RCCA 3ERZA 4MXPA 3ES3A 5JKMA 2CLBA 2Y3QA 5GOUA 2BK6A 4ETRA 5J9VA 4CVRA 1MFRA 2CEIA 4W4KB 2G4HA 5HQOA 1B71A 3UFBA 2OH3A 5LG2A 4AM5A 2V2OA 2ZA6A 2N02A 5D8RA 5K52A 2JD60 1BFRA 5J8SA 5LBHA 4ZTTA 3PVRA 3GGZA 5GU3X 2CF7A 3Q4QA 4LQNA 4DZ0A 1IERA 1JI4A 3IQ1A 4IXKA 2CN7A 2CLUA 2W0OA 2YJKA 3BT5A 3HL1A 3QD8A 1JTSA 1LKMA 3VNXA 3Q4RA 2XJMA 4AM2A 2IU2A 1VLGA 2C2FA 3BKNA 5E1UA 4YXJA 3PVRB 2WLAA 4TODA 2WTLA 1O9RA 1N1QA 3E1OA 4YKHA 2CHIA 4PG0A 3E1QA 4EVCA 3E1PA 4CMYV 4P18A 3W54A 2GS4A 1OTKA 3AF8X 1JKVA 3AF9X 1RCDA 4RC5B 4X0JA 3RAVA 3VV9A 4LQHA 3PWQA 2ZG7X 3PWQC 5JKMG 5D8OA 3QHBA 2V2SA 1NFVA 4RC7B 5GU1X 2UX1A 4II4A 4DYXA 1RCEA 4TOGA 3R2HA 3L0MA 5FFDA 4KVRA 3KA3A 2BJYA 4TOCA 3ISEA 4REUA 2G38B 2CIHA 3F39A 5ERJA 2JD70 3EZUA 1AEWA 1TK6A 4DYUA 4EVBA 1R03A 1YV1A 4ZMCA 1XZ1A 4ZL5A 3N6OA 1QYBA 4RC6A 1TKOA 4EVDA 4MY7A 5JACA 3QB9A 1JGCA 4LPJA 3E1NA 4R42A 3FSEA 3KA6A 1KRQA 2V2NA 5FFAA 3WVUA 4YXMA 1O9IA 1JREA 1UMNA 2FJCA 3AK9A 3KA4A 4CVPA 3IS7A 1FHAA 5D8XA 3WNWA 1JIGA 3F35A 1J30A 2V2LA 3PW1A 3GGYA 4MN9A 1NF4A 3NP0X 4AM4A 1L8HA 1DATA 2QQYA 2ZG9X 2VZBA 2MGYA 2YW7A 2FFXJ 2RBDA 3BVLA 3R2OA 2CHPA 4LYXA 4CVTA 3PW1B 4A25A 3BVEA 3A68A 3NOZX 1VEQA 4XGSA 1NF6A 4TO9A 3JZ9A 4LQVA 3C21A 3SHXA 4M33A 3VVAA 5AXSA 3E1JA 2HR5A 2V8UA 2FG8A 5D8YA 3BVIA 4ZKXA 1BCFA 5LG8A 3PW8A 3RBCA 3WVWA 2C2UA 3PW8C 4OYNA 5FFEA 5JDOA 2YJJA 3GE4A 2ZA8A 3D19A 1L8IA 4Y08A 5HJFA 5JKLA 4LPMA 1LB3A 1IESA 4CYAA 4CMYA 1XZ3A 2CWLA 5FEJA 3H7GA 4XKTA 3O7SA 3FI6A 1S30A 3O7RA 2V8TA 3F33A 5IX6A 3UOIA 2CN6A 2Z5RA 2FHAA 3LKDA 4U3GA 3RD0A 2F7NA 3UOFA 3FVBA 5CMRA 3T9JA 3R2RA 3V3KB 1RCIA 2XKQA 2Z6MA 1MOJA 3AJQA 3JZAB 2GYDA 2IB0A 4E40A 4CYBA 5J8WA 3Q4OA 5CZUA 4KVSA 4II4B 3KXUA 3PZAA 2JD80 1F30A 4LPNA 2FKZA 4MUDA 3U90A 4TOBA 4Z3BA 3GVYA 3QZ3A 2OC5A 4ERUA 3PVTA 1H96A 3PVYA 2GYQA 3C1ZA 4DE6A 4QUWA 2FZFA 5LS9A 4DASA 3E6SA 1SQ3A 3FRRA 4ZKHA 4KXRB 3SIDA 1Z6OA 1GWGA 2WWXB 1YUXA 1SOFA 3QHCA 3AJOA 4DYYA 4RC6B 1ZUJA 5JKLG 2V2PA 3PVYB 4PG1A 3E2CA 4ITWA 5FFCA 3ISFA 4LYUA 4IWJA 3OGHA 3KDQA 1VELA 4TOEA 3F34A 3R2LA 3MPSA 1LKPA 1RCGA 4TOAA 4RC8A 2C41A 3OJ5A 3PWFA 2ITBA 3AF7X 4YVZA 2VXXA 2XJOA 3KHKA 3E1MA 4ZJKA 4ISMA 3KA9A 2Z5PA 1NNQA 1RYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PYB A;  5E2D A;  4Z5S A;  5J93 A;  3EGM A;  5GU0 X;  1F33 A;  2V2I A;  3TA8 A;  5GN8 A;  3GHQ A;  4ML5 A;  3QVD A;  2FL0 A;  2Z5Q A;  1UVH A;  4TOH A;  5D8S A;  3AK8 A;  5GU2 X;  4ZL6 A;  1JKU A;  1QGH A;  3R2K A;  4M35 A;  4PGI A;  1S3Q A;  3AJP A;  4RC5 A;  4TW3 A;  4XKS A;  4CY9 A;  3UNO A;  1TJO A;  1TKP A;  4TOF A;  5GN8 B;  2QF9 A;  1EUM A;  2Z90 A;  1ZS3 A;  4ISP A;  3RGD A;  4RC7 A;  2V15 A;  2V2R A;  5ERK A;  4XKU A;  3EZ0 A;  1HRS A;  4M32 A;  3F37 A;  1LKO A;  5HJH A;  2V2J A;  4MKU A;  4MJY A;  4ZKW A;  2ZA7 A;  4EVE A;  4M34 A;  2C2J A;  3R2S A;  1S2Z A;  2V2M A;  3F36 A;  5D8Q A;  5FFB A;  1Z6O M;  2WLU A;  4CVS A;  3WVV A;  4IWK A;  4KVQ A;  1VEI A;  3SH6 A;  5CMQ A;  5D8P A;  3NP2 X;  2BW1 A;  3Q4N A;  1YUZ A;  2FG4 A;  3F32 A;  3E1L A;  3BVK A;  4LQJ A;  3SE1 A;  4E6K A;  3HIU A;  1BG7 A;  4ITT A;  5K53 A;  2IY4 A;  2ZUR X;  3E6R A;  3R2M A;  2D5K A;  2ZG8 X;  2X17 0;  4DI0 A;  1DVB A;  1Z4A A;  2YW6 A;  2HTN A;  1JYB A;  3A9Q A;  3KX9 A;  1DPS A;  2BKC A;  3KA8 A;  4DYZ A;  3BVF A;  4ZLW A;  3RE7 A;  2C6R A;  2VXI A;  3PVT B;  5C6F A;  3IS8 A;  2XGW A;  2XJN A;  4PGK A;  1VJX A;  5I4J A;  3KWO A;  1JI5 A;  3F38 A;  1RCC A;  3ERZ A;  3ES3 A;  5JKM A;  2CLB A;  2Y3Q A;  5GOU A;  2BK6 A;  4ETR A;  5J9V A;  4CVR A;  1MFR A;  2CEI A;  2G4H A;  5HQO A;  1B71 A;  4AM5 A;  2OH3 A;  5LG2 A;  2V2O A;  2ZA6 A;  5D8R A;  5K52 A;  2JD6 0;  1BFR A;  5J8S A;  5LBH A;  4ZTT A;  3PVR A;  5GU3 X;  2CF7 A;  3Q4Q A;  4LQN A;  4DZ0 A;  1IER A;  1JI4 A;  3IQ1 A;  4IXK A;  2CN7 A;  2CLU A;  2W0O A;  2YJK A;  3BT5 A;  3HL1 A;  3QD8 A;  1JTS A;  1LKM A;  3VNX A;  3Q4R A;  2XJM A;  4AM2 A;  2IU2 A;  1VLG A;  2C2F A;  3BKN A;  5E1U A;  3PVR B;  2WLA A;  4TOD A;  2WTL A;  1O9R A;  1N1Q A;  3E1O A;  4YKH A;  2CHI A;  4PG0 A;  3E1Q A;  4EVC A;  3E1P A;  4CMY V;  4P18 A;  2GS4 A;  1OTK A;  3AF8 X;  1JKV A;  3AF9 X;  1RCD A;  4RC5 B;  3RAV A;  4LQH A;  3PWQ A;  2ZG7 X;  3PWQ C;  5JKM G;  5D8O A;  3QHB A;  2V2S A;  1NFV A;  4RC7 B;  5GU1 X;  2UX1 A;  4II4 A;  4DYX A;  1RCE A;  4TOG A;  3R2H A;  5FFD A;  4KVR A;  3KA3 A;  2BJY A;  4TOC A;  3ISE A;  4REU A;  2CIH A;  3F39 A;  5ERJ A;  2JD7 0;  3EZU A;  1AEW A;  1TK6 A;  4DYU A;  4EVB A;  1R03 A;  1YV1 A;  4ZMC A;  1XZ1 A;  4ZL5 A;  1QYB A;  4RC6 A;  1TKO A;  4EVD A;  4MY7 A;  5JAC A;  3QB9 A;  1JGC A;  4LPJ A;  3E1N A;  4R42 A;  3FSE A;  3KA6 A;  1KRQ A;  2V2N A;  5FFA A;  3WVU A;  1O9I A;  1JRE A;  1UMN A;  2FJC A;  3AK9 A;  3KA4 A;  4CVP A;  3IS7 A;  1FHA A;  5D8X A;  3WNW A;  1JIG A;  3F35 A;  1J30 A;  2V2L A;  3PW1 A;  4MN9 A;  1NF4 A;  3NP0 X;  4AM4 A;  1L8H A;  1DAT A;  2QQY A;  2ZG9 X;  2VZB A;  2YW7 A;  2FFX J;  2RBD A;  3BVL A;  3R2O A;  2CHP A;  4LYX A;  4CVT A;  3PW1 B;  4A25 A;  3BVE A;  3A68 A;  3NOZ X;  1VEQ A;  4XGS A;  1NF6 A;  4TO9 A;  4LQV A;  3SHX A;  4M33 A;  5AXS A;  3E1J A;  2HR5 A;  2FG8 A;  5D8Y A;  3BVI A;  4ZKX A;  1BCF A;  5LG8 A;  3PW8 A;  3RBC A;  3WVW A;  2C2U A;  3PW8 C;  4OYN A;  5FFE A;  2YJJ A;  3GE4 A;  2ZA8 A;  1L8I A;  4Y08 A;  5HJF A;  5JKL A;  4LPM A;  1LB3 A;  1IES A;  4CYA A;  4CMY A;  1XZ3 A;  5FEJ A;  3H7G A;  4XKT A;  3O7S A;  3FI6 A;  1S30 A;  3O7R A;  3F33 A;  5IX6 A;  3UOI A;  2CN6 A;  2Z5R A;  2FHA A;  4U3G A;  3RD0 A;  2F7N A;  3UOF A;  3FVB A;  5CMR A;  3T9J A;  3R2R A;  1RCI A;  2XKQ A;  2Z6M A;  1MOJ A;  3AJQ A;  2GYD A;  2IB0 A;  4CYB A;  5J8W A;  3Q4O A;  5CZU A;  4KVS A;  4II4 B;  3KXU A;  3PZA A;  2JD8 0;  1F30 A;  4LPN A;  2FKZ A;  4MUD A;  3U90 A;  4TOB A;  4Z3B A;  3GVY A;  3QZ3 A;  2OC5 A;  4ERU A;  3PVT A;  1H96 A;  3PVY A;  2GYQ A;  4DE6 A;  4QUW A;  2FZF A;  5LS9 A;  4DAS A;  3E6S A;  1SQ3 A;  4ZKH A;  3SID A;  1Z6O A;  1GWG A;  1YUX A;  1SOF A;  3QHC A;  3AJO A;  4DYY A;  4RC6 B;  1ZUJ A;  5JKL G;  2V2P A;  3PVY B;  4PG1 A;  3E2C A;  4ITW A;  5FFC A;  3ISF A;  4LYU A;  4IWJ A;  3OGH A;  1VEL A;  4TOE A;  3F34 A;  3R2L A;  3MPS A;  1LKP A;  1RCG A;  4TOA A;  4RC8 A;  2C41 A;  3OJ5 A;  3PWF A;  2ITB A;  3AF7 X;  2VXX A;  2XJO A;  3E1M A;  4ZJK A;  4ISM A;  3KA9 A;  2Z5P A;  1NNQ A;  1RYT A; 
#chains in the Genus database with same CATH topology
 2PYB A;  5E2D A;  4Z5S A;  3M6J A;  5J93 A;  3EGM A;  5GU0 X;  1F33 A;  2V2I A;  3TA8 A;  5GN8 A;  3GHQ A;  4ML5 A;  3QVD A;  2FL0 A;  2Z5Q A;  1UVH A;  4TOH A;  5D8S A;  3AK8 A;  5GU2 X;  4ZL6 A;  1JKU A;  2AR0 A;  1QGH A;  3R2K A;  4M35 A;  4PGI A;  1S3Q A;  3AJP A;  4RC5 A;  4TW3 A;  4XKS A;  4CY9 A;  2Y44 A;  3UNO A;  1TJO A;  1TKP A;  4TOF A;  5GN8 B;  2QF9 A;  1EUM A;  2Z90 A;  1ZS3 A;  4ISP A;  3RGD A;  4RC7 A;  2V15 A;  2V2R A;  5ERK A;  4XKU A;  3EZ0 A;  5JDO B;  1HRS A;  4M32 A;  5HU6 D;  3F37 A;  1LKO A;  5HJH A;  2V2J A;  4MKU A;  4MJY A;  4ZKW A;  2ZA7 A;  4EVE A;  4M34 A;  2C2J A;  3R2S A;  1S2Z A;  3C1Y A;  2V2M A;  3F36 A;  5D8Q A;  5FFB A;  1Z6O M;  2WLU A;  4CVS A;  3WVV A;  4IWK A;  4KVQ A;  1VEI A;  3SH6 A;  5CMQ A;  4W4L B;  5D8P A;  3NP2 X;  2OKC A;  2BW1 A;  3C23 A;  3Q4N A;  1YUZ A;  2FG4 A;  3F32 A;  3E1L A;  3BVK A;  4LQJ A;  3SE1 A;  4E6K A;  3HIU A;  1BG7 A;  4ITT A;  5K53 A;  2IY4 A;  2ZUR X;  3E6R A;  3R2M A;  2D5K A;  2ZG8 X;  2X17 0;  4DI0 A;  3DBY A;  1DVB A;  1Z4A A;  2YW6 A;  2HTN A;  1JYB A;  3A9Q A;  3KX9 A;  1DPS A;  2BKC A;  3KA8 A;  4DYZ A;  3BVF A;  4ZLW A;  3RE7 A;  2C6R A;  2VXI A;  3PVT B;  5C6F A;  4WJG 4;  3IS8 A;  2XGW A;  2XJN A;  4PGK A;  3FRS A;  1VJX A;  5I4J A;  3KWO A;  1JI5 A;  3F38 A;  1RCC A;  3ERZ A;  4MXP A;  3ES3 A;  5JKM A;  2CLB A;  2Y3Q A;  5GOU A;  2BK6 A;  4ETR A;  5J9V A;  4CVR A;  1MFR A;  2CEI A;  4W4K B;  2G4H A;  5HQO A;  1B71 A;  3UFB A;  2OH3 A;  5LG2 A;  4AM5 A;  2V2O A;  2ZA6 A;  2N02 A;  5D8R A;  5K52 A;  2JD6 0;  1BFR A;  5J8S A;  5LBH A;  4ZTT A;  3PVR A;  3GGZ A;  5GU3 X;  2CF7 A;  3Q4Q A;  4LQN A;  4DZ0 A;  1IER A;  1JI4 A;  3IQ1 A;  4IXK A;  2CN7 A;  2CLU A;  2W0O A;  2YJK A;  3BT5 A;  3HL1 A;  3QD8 A;  1JTS A;  1LKM A;  3VNX A;  3Q4R A;  2XJM A;  4AM2 A;  2IU2 A;  1VLG A;  2C2F A;  3BKN A;  5E1U A;  4YXJ A;  3PVR B;  2WLA A;  4TOD A;  2WTL A;  1O9R A;  1N1Q A;  3E1O A;  4YKH A;  2CHI A;  4PG0 A;  3E1Q A;  4EVC A;  3E1P A;  4CMY V;  4P18 A;  3W54 A;  2GS4 A;  1OTK A;  3AF8 X;  1JKV A;  3AF9 X;  1RCD A;  4RC5 B;  4X0J A;  3RAV A;  3VV9 A;  4LQH A;  3PWQ A;  2ZG7 X;  3PWQ C;  5JKM G;  5D8O A;  3QHB A;  2V2S A;  1NFV A;  4RC7 B;  5GU1 X;  2UX1 A;  4II4 A;  4DYX A;  1RCE A;  4TOG A;  3R2H A;  3L0M A;  5FFD A;  4KVR A;  3KA3 A;  2BJY A;  4TOC A;  3ISE A;  4REU A;  2G38 B;  2CIH A;  3F39 A;  5ERJ A;  2JD7 0;  3EZU A;  1AEW A;  1TK6 A;  4DYU A;  4EVB A;  1R03 A;  1YV1 A;  4ZMC A;  1XZ1 A;  4ZL5 A;  3N6O A;  1QYB A;  4RC6 A;  1TKO A;  4EVD A;  4MY7 A;  5JAC A;  3QB9 A;  1JGC A;  4LPJ A;  3E1N A;  4R42 A;  3FSE A;  3KA6 A;  1KRQ A;  2V2N A;  5FFA A;  3WVU A;  4YXM A;  1O9I A;  1JRE A;  1UMN A;  2FJC A;  3AK9 A;  3KA4 A;  4CVP A;  3IS7 A;  1FHA A;  5D8X A;  3WNW A;  1JIG A;  3F35 A;  1J30 A;  2V2L A;  3PW1 A;  3GGY A;  4MN9 A;  1NF4 A;  3NP0 X;  4AM4 A;  1L8H A;  1DAT A;  2QQY A;  2ZG9 X;  2VZB A;  2MGY A;  2YW7 A;  2FFX J;  2RBD A;  3BVL A;  3R2O A;  2CHP A;  4LYX A;  4CVT A;  3PW1 B;  4A25 A;  3BVE A;  3A68 A;  3NOZ X;  1VEQ A;  4XGS A;  1NF6 A;  4TO9 A;  3JZ9 A;  4LQV A;  3C21 A;  3SHX A;  4M33 A;  3VVA A;  5AXS A;  3E1J A;  2HR5 A;  2V8U A;  2FG8 A;  5D8Y A;  3BVI A;  4ZKX A;  1BCF A;  5LG8 A;  3PW8 A;  3RBC A;  3WVW A;  2C2U A;  3PW8 C;  4OYN A;  5FFE A;  5JDO A;  2YJJ A;  3GE4 A;  2ZA8 A;  3D19 A;  1L8I A;  4Y08 A;  5HJF A;  5JKL A;  4LPM A;  1LB3 A;  1IES A;  4CYA A;  4CMY A;  1XZ3 A;  2CWL A;  5FEJ A;  3H7G A;  4XKT A;  3O7S A;  3FI6 A;  1S30 A;  3O7R A;  2V8T A;  3F33 A;  5IX6 A;  3UOI A;  2CN6 A;  2Z5R A;  2FHA A;  3LKD A;  4U3G A;  3RD0 A;  2F7N A;  3UOF A;  3FVB A;  5CMR A;  3T9J A;  3R2R A;  3V3K B;  1RCI A;  2XKQ A;  2Z6M A;  1MOJ A;  3AJQ A;  3JZA B;  2GYD A;  2IB0 A;  4E40 A;  4CYB A;  5J8W A;  3Q4O A;  5CZU A;  4KVS A;  4II4 B;  3KXU A;  3PZA A;  2JD8 0;  1F30 A;  4LPN A;  2FKZ A;  4MUD A;  3U90 A;  4TOB A;  4Z3B A;  3GVY A;  3QZ3 A;  2OC5 A;  4ERU A;  3PVT A;  1H96 A;  3PVY A;  2GYQ A;  3C1Z A;  4DE6 A;  4QUW A;  2FZF A;  5LS9 A;  4DAS A;  3E6S A;  1SQ3 A;  3FRR A;  4ZKH A;  4KXR B;  3SID A;  1Z6O A;  1GWG A;  2WWX B;  1YUX A;  1SOF A;  3QHC A;  3AJO A;  4DYY A;  4RC6 B;  1ZUJ A;  5JKL G;  2V2P A;  3PVY B;  4PG1 A;  3E2C A;  4ITW A;  5FFC A;  3ISF A;  4LYU A;  4IWJ A;  3OGH A;  3KDQ A;  1VEL A;  4TOE A;  3F34 A;  3R2L A;  3MPS A;  1LKP A;  1RCG A;  4TOA A;  4RC8 A;  2C41 A;  3OJ5 A;  3PWF A;  2ITB A;  3AF7 X;  4YVZ A;  2VXX A;  2XJO A;  3KHK A;  3E1M A;  4ZJK A;  4ISM A;  3KA9 A;  2Z5P A;  1NNQ A;  1RYT A; 
#chains in the Genus database with same CATH homology
 2PYB A;  5E2D A;  4Z5S A;  3M6J A;  5J93 A;  3EGM A;  5GU0 X;  1F33 A;  2V2I A;  3TA8 A;  5GN8 A;  3GHQ A;  4ML5 A;  3QVD A;  2FL0 A;  2Z5Q A;  1UVH A;  4TOH A;  5D8S A;  3AK8 A;  5GU2 X;  4ZL6 A;  1JKU A;  2AR0 A;  1QGH A;  3R2K A;  4M35 A;  4PGI A;  1S3Q A;  3AJP A;  4RC5 A;  4TW3 A;  4XKS A;  4CY9 A;  2Y44 A;  3UNO A;  1TJO A;  1TKP A;  4TOF A;  5GN8 B;  2QF9 A;  1EUM A;  2Z90 A;  1ZS3 A;  4ISP A;  3RGD A;  4RC7 A;  2V15 A;  2V2R A;  5ERK A;  4XKU A;  3EZ0 A;  5JDO B;  1HRS A;  4M32 A;  5HU6 D;  3F37 A;  1LKO A;  5HJH A;  2V2J A;  4MKU A;  4MJY A;  4ZKW A;  2ZA7 A;  4EVE A;  4M34 A;  2C2J A;  3R2S A;  1S2Z A;  3C1Y A;  2V2M A;  3F36 A;  5D8Q A;  5FFB A;  1Z6O M;  2WLU A;  4CVS A;  3WVV A;  4IWK A;  4KVQ A;  1VEI A;  3SH6 A;  5CMQ A;  4W4L B;  5D8P A;  3NP2 X;  2OKC A;  2BW1 A;  3C23 A;  3Q4N A;  1YUZ A;  2FG4 A;  3F32 A;  3E1L A;  3BVK A;  4LQJ A;  3SE1 A;  4E6K A;  3HIU A;  1BG7 A;  4ITT A;  5K53 A;  2IY4 A;  2ZUR X;  3E6R A;  3R2M A;  2D5K A;  2ZG8 X;  2X17 0;  4DI0 A;  3DBY A;  1DVB A;  1Z4A A;  2YW6 A;  2HTN A;  1JYB A;  3A9Q A;  3KX9 A;  1DPS A;  2BKC A;  3KA8 A;  4DYZ A;  3BVF A;  4ZLW A;  3RE7 A;  2C6R A;  2VXI A;  3PVT B;  5C6F A;  4WJG 4;  3IS8 A;  2XGW A;  2XJN A;  4PGK A;  3FRS A;  1VJX A;  5I4J A;  3KWO A;  1JI5 A;  3F38 A;  1RCC A;  3ERZ A;  4MXP A;  3ES3 A;  5JKM A;  2CLB A;  2Y3Q A;  5GOU A;  2BK6 A;  4ETR A;  5J9V A;  4CVR A;  1MFR A;  2CEI A;  4W4K B;  2G4H A;  5HQO A;  1B71 A;  3UFB A;  2OH3 A;  5LG2 A;  4AM5 A;  2V2O A;  2ZA6 A;  2N02 A;  5D8R A;  5K52 A;  2JD6 0;  1BFR A;  5J8S A;  5LBH A;  4ZTT A;  3PVR A;  3GGZ A;  5GU3 X;  2CF7 A;  3Q4Q A;  4LQN A;  4DZ0 A;  1IER A;  1JI4 A;  3IQ1 A;  4IXK A;  2CN7 A;  2CLU A;  2W0O A;  2YJK A;  3BT5 A;  3HL1 A;  3QD8 A;  1JTS A;  1LKM A;  3VNX A;  3Q4R A;  2XJM A;  4AM2 A;  2IU2 A;  1VLG A;  2C2F A;  3BKN A;  5E1U A;  4YXJ A;  3PVR B;  2WLA A;  4TOD A;  2WTL A;  1O9R A;  1N1Q A;  3E1O A;  4YKH A;  2CHI A;  4PG0 A;  3E1Q A;  4EVC A;  3E1P A;  4CMY V;  4P18 A;  3W54 A;  2GS4 A;  1OTK A;  3AF8 X;  1JKV A;  3AF9 X;  1RCD A;  4RC5 B;  4X0J A;  3RAV A;  3VV9 A;  4LQH A;  3PWQ A;  2ZG7 X;  3PWQ C;  5JKM G;  5D8O A;  3QHB A;  2V2S A;  1NFV A;  4RC7 B;  5GU1 X;  2UX1 A;  4II4 A;  4DYX A;  1RCE A;  4TOG A;  3R2H A;  3L0M A;  5FFD A;  4KVR A;  3KA3 A;  2BJY A;  4TOC A;  3ISE A;  4REU A;  2G38 B;  2CIH A;  3F39 A;  5ERJ A;  2JD7 0;  3EZU A;  1AEW A;  1TK6 A;  4DYU A;  4EVB A;  1R03 A;  1YV1 A;  4ZMC A;  1XZ1 A;  4ZL5 A;  3N6O A;  1QYB A;  4RC6 A;  1TKO A;  4EVD A;  4MY7 A;  5JAC A;  3QB9 A;  1JGC A;  4LPJ A;  3E1N A;  4R42 A;  3FSE A;  3KA6 A;  1KRQ A;  2V2N A;  5FFA A;  3WVU A;  4YXM A;  1O9I A;  1JRE A;  1UMN A;  2FJC A;  3AK9 A;  3KA4 A;  4CVP A;  3IS7 A;  1FHA A;  5D8X A;  3WNW A;  1JIG A;  3F35 A;  1J30 A;  2V2L A;  3PW1 A;  3GGY A;  4MN9 A;  1NF4 A;  3NP0 X;  4AM4 A;  1L8H A;  1DAT A;  2QQY A;  2ZG9 X;  2VZB A;  2MGY A;  2YW7 A;  2FFX J;  2RBD A;  3BVL A;  3R2O A;  2CHP A;  4LYX A;  4CVT A;  3PW1 B;  4A25 A;  3BVE A;  3A68 A;  3NOZ X;  1VEQ A;  4XGS A;  1NF6 A;  4TO9 A;  3JZ9 A;  4LQV A;  3C21 A;  3SHX A;  4M33 A;  3VVA A;  5AXS A;  3E1J A;  2HR5 A;  2V8U A;  2FG8 A;  5D8Y A;  3BVI A;  4ZKX A;  1BCF A;  5LG8 A;  3PW8 A;  3RBC A;  3WVW A;  2C2U A;  3PW8 C;  4OYN A;  5FFE A;  5JDO A;  2YJJ A;  3GE4 A;  2ZA8 A;  3D19 A;  1L8I A;  4Y08 A;  5HJF A;  5JKL A;  4LPM A;  1LB3 A;  1IES A;  4CYA A;  4CMY A;  1XZ3 A;  2CWL A;  5FEJ A;  3H7G A;  4XKT A;  3O7S A;  3FI6 A;  1S30 A;  3O7R A;  2V8T A;  3F33 A;  5IX6 A;  3UOI A;  2CN6 A;  2Z5R A;  2FHA A;  3LKD A;  4U3G A;  3RD0 A;  2F7N A;  3UOF A;  3FVB A;  5CMR A;  3T9J A;  3R2R A;  3V3K B;  1RCI A;  2XKQ A;  2Z6M A;  1MOJ A;  3AJQ A;  3JZA B;  2GYD A;  2IB0 A;  4E40 A;  4CYB A;  5J8W A;  3Q4O A;  5CZU A;  4KVS A;  4II4 B;  3KXU A;  3PZA A;  2JD8 0;  1F30 A;  4LPN A;  2FKZ A;  4MUD A;  3U90 A;  4TOB A;  4Z3B A;  3GVY A;  3QZ3 A;  2OC5 A;  4ERU A;  3PVT A;  1H96 A;  3PVY A;  2GYQ A;  3C1Z A;  4DE6 A;  4QUW A;  2FZF A;  5LS9 A;  4DAS A;  3E6S A;  1SQ3 A;  3FRR A;  4ZKH A;  4KXR B;  3SID A;  1Z6O A;  1GWG A;  2WWX B;  1YUX A;  1SOF A;  3QHC A;  3AJO A;  4DYY A;  4RC6 B;  1ZUJ A;  5JKL G;  2V2P A;  3PVY B;  4PG1 A;  3E2C A;  4ITW A;  5FFC A;  3ISF A;  4LYU A;  4IWJ A;  3OGH A;  3KDQ A;  1VEL A;  4TOE A;  3F34 A;  3R2L A;  3MPS A;  1LKP A;  1RCG A;  4TOA A;  4RC8 A;  2C41 A;  3OJ5 A;  3PWF A;  2ITB A;  3AF7 X;  4YVZ A;  2VXX A;  2XJO A;  3KHK A;  3E1M A;  4ZJK A;  4ISM A;  3KA9 A;  2Z5P A;  1NNQ A;  1RYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...