2JD80

Crystal structure of the zn-soaked ferritin from the hyperthermophilic archaeal anaerobe pyrococcus furiosus
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
167
structure length
167
Chain Sequence
MLSERMLKALNDQLNRELYSAYLYFAMAAYFEDLGLEGFANWMKAQAEEEIGHALRFYNYIYDRNGRVELDEIPKPPKEWESPLKAFEAAYEHEKFISKSIYELAALAEEEKDYSTRAFLEWFINEQVEEEASVKKILDKLKFAKDSPQILFMLDKELSARAPKLPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords FERRITIN HOMOLOG
publication title Crystal Structure of the Ferritin from the Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 72
structure length 167
sequence length 167
chains with identical sequence 1, 2, 3, 4, 5, 6, 7, 8, 9, A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z
ec nomenclature
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
0 PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2jd8000
3QVDA 1B71A 1ZS3A 1RCEA 2Y3QA 2ZA6A 2XKQA 5LS9A 2CIHA 3UOFA 4MUDA 2V2PA 4EVDA 1JYBA 4ML5A 4ZMCA 3H7GA 4YKHA 4AM2A 3BVFA 3IQ1A 3NOZX 2V2IA 4E6KA 1LKPA 3F39A 5FFBA 2CEIA 2ZA7A 3KA8A 3PVTA 4TW3A 1TKOA 2BKCA 3OJ5A 3AF8X 3PW1A 3ERZA 5D8RA 4KVRA 3BKNA 3AJQA 5HQOA 4RC6B 2UX1A 1JTSA 4A25A 1DPSA 1BG7A 3E1NA 3F34A 1F33A 5LG8A 1JREA 5LBHA 5FFCA 1UVHA 4CMYA 1LKOA 2HTNA 3FVBA 3U90A 1TKPA 3QB9A 3ISEA 1JI5A 1R03A 3BVLA 2BJYA 2VXXA 3E1OA 2X170 1OTKA 5LG2A 3PVYA 4RC5B 3PZAA 2XJMA 5I4JA 1KRQA 3UOIA 2FG4A 2VXIA 3KX9A 3Q4NA 4ZLWA 2YW6A 5JKLG 1RCGA 2GYQA 5GOUA 1MOJA 2ZG7X 1L8IA 5D8SA 3BVKA 1O9RA 2FL0A 2VZBA 5E1UA 4II4B 1RCDA 3AF7X 1EUMA 5CMQA 2PYBA 5FFAA 1JGCA 3AK9A 3OGHA 3E6RA 5JACA 1IERA 1SOFA 3FI6A 3MPSA 3PVRB 3A9QA 4ZJKA 5J8WA 2W0OA 2GYDA 2FHAA 4DZ0A 1VJXA 3R2HA 1DATA 2FFXJ 3WVUA 2Z5PA 3E1LA 1SQ3A 3F33A 4ZL6A 3ISFA 4ISPA 2V2RA 4RC7B 3BT5A 2WTLA 2RBDA 3R2OA 1JIGA 4XKTA 3BVIA 3AK8A 3A68A 1XZ1A 4ERUA 2V2JA 3IS8A 4IWJA 2BW1A 2C6RA 2ITBA 2JD70 4M33A 1RYTA 3QHBA 2G4HA 4Z5SA 2FKZA 2CN7A 3QZ3A 1S3QA 3F35A 1YUXA 3KA9A 2FG8A 4Y08A 2JD80 3AF9X 5D8QA 4XKUA 5GU3X 5HJHA 3WVWA 3ES3A 3WNWA 1TK6A 3F32A 1MFRA 4CVSA 3AJPA 3Q4RA 2BK6A 5GN8A 4ITTA 1IESA 5AXSA 2C2FA 4TOBA 3VNXA 1VLGA 2OH3A 3QD8A 4DYUA 5D8YA 4DI0A 2V15A 1NNQA 4PG0A 5JKMG 4M32A 4LQJA 1NFVA 2V2LA 1VEIA 2D5KA 3EZUA 3O7SA 4PGKA 4AM5A 2Z5RA 3PVTB 2IB0A 3PW1B 4DYXA 3KA6A 2CHPA 4ISMA 3HL1A 2GS4A 3NP2X 4II4A 4TOFA 4CY9A 3WVVA 4EVCA 4TOAA 2YW7A 4CVTA 3Q4QA 5D8PA 1ZUJA 4LQNA 2IY4A 1DVBA 2Z6MA 5J93A 2C41A 2OC5A 4ZL5A 3SH6A 4Z3BA 1JI4A 2V2OA 1F30A 5FFEA 1AEWA 5HJFA 1VEQA 4IXKA 2V2MA 1S30A 3SE1A 4PGIA 2CN6A 3E1JA 3PVYB 4LPMA 4ZTTA 4RC8A 2ZURX 2WLAA 3T9JA 4MKUA 3PWQA 1L8HA 2XGWA 3R2SA 2JD60 5K52A 3AJOA 4CYAA 4LYUA 1UMNA 5FEJA 4EVBA 5C6FA 4LQHA 1FHAA 2CLBA 4TOHA 5K53A 2WLUA 4PG1A 4CVPA 4MY7A 3RBCA 2Z90A 4ZKHA 2FJCA 5GU1X 4OYNA 4RC6A 3KWOA 3F38A 4XKSA 2QQYA 2F7NA 2FZFA 2V2SA 3R2KA 3PWQC 4CMYV 1J30A 3HIUA 5GU2X 4REUA 2CF7A 1LKMA 1HRSA 4TOGA 4DE6A 3UNOA 3E2CA 3RE7A 3FSEA 4LYXA 1S2ZA 4U3GA 1JKVA 3F36A 4ITWA 4DYYA 2C2UA 4RC5A 1RCCA 3EZ0A 1GWGA 4ZKWA 1VELA 2XJOA 3RD0A 3KXUA 5FFDA 3R2MA 5J8SA 4TOEA 3E1PA 3E6SA 2YJKA 4IWKA 1Z6OA 3KA4A 2IU2A 3RGDA 4TODA 1NF6A 4ETRA 3SHXA 3GE4A 1NF4A 5GN8B 3E1QA 4ZKXA 3TA8A 3PW8A 2C2JA 3O7RA 5D8OA 1O9IA 4P18A 1XZ3A 2ZG9X 1Z4AA 5GU0X 3NP0X 3PVRA 2XJNA 3RAVA 4XGSA 3EGMA 5ERKA 5CMRA 4AM4A 1BCFA 4EVEA 4MN9A 5D8XA 1QYBA 4TO9A 4KVQA 4DASA 1LB3A 4DYZA 4RC7A 5IX6A 4M34A 4M35A 2CLUA 3GVYA 3F37A 2CHIA 1JKUA 1N1QA 5CZUA 1Z6OM 4KVSA 5J9VA 3R2LA 3PW8C 3Q4OA 4MJYA 1QGHA 2ZG8X 2QF9A 4R42A 5JKMA 3PWFA 4LPNA 1YUZA 2Z5QA 3GHQA 4CVRA 5ERJA 3IS7A 4LQVA 1H96A 2ZA8A 3KA3A 3QHCA 2HR5A 1RCIA 3SIDA 3E1MA 3R2RA 5E2DA 3BVEA 4TOCA 1BFRA 2V2NA 4QUWA 1TJOA 2YJJA 1YV1A 5JKLA 4LPJA 4CYBA
chains in the Genus database with same CATH superfamily
3QVDA 1B71A 1ZS3A 1RCEA 2Y3QA 2ZA6A 2XKQA 5LS9A 2CIHA 3UOFA 4MUDA 2V2PA 4EVDA 1JYBA 4ML5A 4ZMCA 3H7GA 3W54A 4YKHA 2CWLA 4AM2A 3BVFA 3IQ1A 3NOZX 2V2IA 4E6KA 1LKPA 3F39A 5FFBA 2CEIA 2ZA7A 3V3KB 3KA8A 3PVTA 4TW3A 1TKOA 2BKCA 4W4LB 3OJ5A 2WWXB 3AF8X 3PW1A 3ERZA 5D8RA 4KVRA 3BKNA 2V8TA 3AJQA 5HQOA 4RC6B 2UX1A 1JTSA 4WJG4 4A25A 1DPSA 1BG7A 3E1NA 3F34A 1F33A 5LG8A 1JREA 5LBHA 5FFCA 1UVHA 4CMYA 1LKOA 2HTNA 3C21A 3FVBA 3U90A 1TKPA 3QB9A 3ISEA 1JI5A 1R03A 3BVLA 2BJYA 2VXXA 3E1OA 2X170 1OTKA 3KDQA 5LG2A 3PVYA 4RC5B 3PZAA 2XJMA 5I4JA 3JZ9A 1KRQA 3UOIA 2FG4A 2VXIA 4KXRB 5JDOA 4YXJA 3KX9A 3Q4NA 4ZLWA 2YW6A 5JKLG 1RCGA 2GYQA 5GOUA 1MOJA 2ZG7X 1L8IA 5D8SA 3BVKA 1O9RA 2FL0A 2VZBA 5E1UA 4II4B 1RCDA 3AF7X 1EUMA 5CMQA 2PYBA 5FFAA 1JGCA 3AK9A 3OGHA 3E6RA 5JACA 1IERA 1SOFA 3FI6A 3MPSA 3PVRB 3A9QA 3DBYA 4ZJKA 5J8WA 2W0OA 3VVAA 2GYDA 2FHAA 4YXMA 4DZ0A 1VJXA 3R2HA 1DATA 2FFXJ 3WVUA 2Z5PA 3E1LA 1SQ3A 3F33A 4ZL6A 3ISFA 4ISPA 2V2RA 4RC7B 3BT5A 2WTLA 2AR0A 2RBDA 3R2OA 3C1YA 1JIGA 4XKTA 3BVIA 3AK8A 3A68A 1XZ1A 4ERUA 2V2JA 3IS8A 4IWJA 2BW1A 2C6RA 2ITBA 2JD70 4M33A 1RYTA 3QHBA 2G4HA 4Z5SA 2FKZA 2CN7A 3QZ3A 1S3QA 3F35A 1YUXA 3KA9A 2FG8A 4Y08A 2JD80 3AF9X 5D8QA 4XKUA 5GU3X 4MXPA 5HJHA 3WVWA 3ES3A 3WNWA 1TK6A 3F32A 1MFRA 4CVSA 3AJPA 3Q4RA 2BK6A 5GN8A 4ITTA 1IESA 5AXSA 2C2FA 2Y44A 4TOBA 3GGYA 4YVZA 3VNXA 1VLGA 2OH3A 3QD8A 4DYUA 5D8YA 4DI0A 2V15A 1NNQA 4PG0A 5JKMG 4M32A 4LQJA 1NFVA 2V2LA 1VEIA 2D5KA 3EZUA 3O7SA 4PGKA 4AM5A 2Z5RA 3PVTB 2IB0A 3PW1B 4DYXA 2V8UA 3KA6A 2CHPA 4ISMA 3L0MA 3HL1A 2GS4A 3NP2X 4II4A 4TOFA 4CY9A 3WVVA 3C23A 4TOAA 4EVCA 2YW7A 4CVTA 3Q4QA 5D8PA 1ZUJA 4LQNA 2IY4A 1DVBA 2Z6MA 5J93A 2C41A 4E40A 2OC5A 5HU6D 4ZL5A 3SH6A 4Z3BA 1JI4A 2V2OA 1F30A 3UFBA 5FFEA 1AEWA 5HJFA 1VEQA 4IXKA 2V2MA 1S30A 3SE1A 4PGIA 2CN6A 3E1JA 3PVYB 4LPMA 4ZTTA 4RC8A 2ZURX 2WLAA 3T9JA 4MKUA 3PWQA 1L8HA 2XGWA 3R2SA 2JD60 5K52A 3AJOA 4CYAA 4LYUA 1UMNA 5FEJA 4EVBA 5C6FA 4LQHA 1FHAA 2CLBA 4TOHA 5K53A 2WLUA 4PG1A 4CVPA 4MY7A 3RBCA 2Z90A 4ZKHA 2FJCA 5GU1X 4OYNA 2G38B 3M6JA 4RC6A 3KWOA 3F38A 4XKSA 2QQYA 2F7NA 2FZFA 2V2SA 3R2KA 3PWQC 4CMYV 1J30A 3HIUA 5GU2X 4REUA 2CF7A 1LKMA 1HRSA 4X0JA 4TOGA 4DE6A 3UNOA 3E2CA 3RE7A 3FSEA 4LYXA 1S2ZA 4U3GA 1JKVA 3F36A 4ITWA 4DYYA 2C2UA 4RC5A 1RCCA 3EZ0A 1GWGA 4ZKWA 1VELA 2XJOA 3RD0A 3KXUA 5FFDA 3R2MA 5J8SA 3JZAB 3FRRA 4TOEA 3E1PA 3E6SA 2YJKA 4IWKA 1Z6OA 3KA4A 2IU2A 3KHKA 4W4KB 3RGDA 4TODA 1NF6A 4ETRA 3SHXA 3GGZA 3GE4A 1NF4A 5GN8B 3E1QA 4ZKXA 3TA8A 3PW8A 2C2JA 3O7RA 5D8OA 1O9IA 4P18A 3VV9A 1XZ3A 2ZG9X 1Z4AA 5GU0X 3NP0X 3PVRA 2XJNA 3RAVA 4XGSA 3EGMA 5ERKA 5CMRA 3C1ZA 4AM4A 1BCFA 4EVEA 4MN9A 5D8XA 1QYBA 3LKDA 4TO9A 4KVQA 4DASA 1LB3A 4DYZA 4RC7A 5IX6A 3N6OA 4M34A 4M35A 2CLUA 3GVYA 3F37A 2CHIA 1JKUA 1N1QA 5CZUA 1Z6OM 3FRSA 4KVSA 5J9VA 3R2LA 3PW8C 3Q4OA 4MJYA 1QGHA 2ZG8X 2QF9A 4R42A 5JKMA 5JDOB 3PWFA 4LPNA 2MGYA 1YUZA 2Z5QA 3GHQA 4CVRA 5ERJA 3IS7A 4LQVA 1H96A 2ZA8A 3D19A 3KA3A 3QHCA 2HR5A 1RCIA 3SIDA 3E1MA 2OKCA 3R2RA 5E2DA 3BVEA 4TOCA 1BFRA 2V2NA 4QUWA 1TJOA 2YJJA 1YV1A 5JKLA 4LPJA 4CYBA 2N02A
chains in the Genus database with same CATH topology
3QVDA 1B71A 1ZS3A 1RCEA 2Y3QA 2ZA6A 2XKQA 5LS9A 2CIHA 3UOFA 4MUDA 2V2PA 4EVDA 1JYBA 4ML5A 4ZMCA 3H7GA 3W54A 4YKHA 2CWLA 4AM2A 3BVFA 3IQ1A 3NOZX 2V2IA 4E6KA 1LKPA 3F39A 5FFBA 2CEIA 2ZA7A 3V3KB 3KA8A 3PVTA 4TW3A 1TKOA 2BKCA 4W4LB 3OJ5A 2WWXB 3AF8X 3PW1A 3ERZA 5D8RA 4KVRA 3BKNA 2V8TA 3AJQA 5HQOA 4RC6B 2UX1A 1JTSA 4WJG4 4A25A 1DPSA 1BG7A 3E1NA 3F34A 1F33A 5LG8A 1JREA 5LBHA 5FFCA 1UVHA 4CMYA 1LKOA 2HTNA 3C21A 3FVBA 3U90A 1TKPA 3QB9A 3ISEA 1JI5A 1R03A 3BVLA 2BJYA 2VXXA 3E1OA 2X170 1OTKA 3KDQA 5LG2A 3PVYA 4RC5B 3PZAA 2XJMA 5I4JA 3JZ9A 1KRQA 3UOIA 2FG4A 2VXIA 4KXRB 5JDOA 4YXJA 3KX9A 3Q4NA 4ZLWA 2YW6A 5JKLG 1RCGA 2GYQA 5GOUA 1MOJA 2ZG7X 1L8IA 5D8SA 3BVKA 1O9RA 2FL0A 2VZBA 5E1UA 4II4B 1RCDA 3AF7X 1EUMA 5CMQA 2PYBA 5FFAA 1JGCA 3AK9A 3OGHA 3E6RA 5JACA 1IERA 1SOFA 3FI6A 3MPSA 3PVRB 3A9QA 3DBYA 4ZJKA 5J8WA 2W0OA 3VVAA 2GYDA 2FHAA 4YXMA 4DZ0A 1VJXA 3R2HA 1DATA 2FFXJ 3WVUA 2Z5PA 3E1LA 1SQ3A 3F33A 4ZL6A 3ISFA 4ISPA 2V2RA 4RC7B 3BT5A 2WTLA 2AR0A 2RBDA 3R2OA 3C1YA 1JIGA 4XKTA 3BVIA 3AK8A 3A68A 1XZ1A 4ERUA 2V2JA 3IS8A 4IWJA 2BW1A 2C6RA 2ITBA 2JD70 4M33A 1RYTA 3QHBA 2G4HA 4Z5SA 2FKZA 2CN7A 3QZ3A 1S3QA 3F35A 1YUXA 3KA9A 2FG8A 4Y08A 2JD80 3AF9X 5D8QA 4XKUA 5GU3X 4MXPA 5HJHA 3WVWA 3ES3A 3WNWA 1TK6A 3F32A 1MFRA 4CVSA 3AJPA 3Q4RA 2BK6A 5GN8A 4ITTA 1IESA 5AXSA 2C2FA 2Y44A 4TOBA 3GGYA 4YVZA 3VNXA 1VLGA 2OH3A 3QD8A 4DYUA 5D8YA 4DI0A 2V15A 1NNQA 4PG0A 5JKMG 4M32A 4LQJA 1NFVA 2V2LA 1VEIA 2D5KA 3EZUA 3O7SA 4PGKA 4AM5A 2Z5RA 3PVTB 2IB0A 3PW1B 4DYXA 2V8UA 3KA6A 2CHPA 4ISMA 3L0MA 3HL1A 2GS4A 3NP2X 4II4A 4TOFA 4CY9A 3WVVA 3C23A 4TOAA 4EVCA 2YW7A 4CVTA 3Q4QA 5D8PA 1ZUJA 4LQNA 2IY4A 1DVBA 2Z6MA 5J93A 2C41A 4E40A 2OC5A 5HU6D 4ZL5A 3SH6A 4Z3BA 1JI4A 2V2OA 1F30A 3UFBA 5FFEA 1AEWA 5HJFA 1VEQA 4IXKA 2V2MA 1S30A 3SE1A 4PGIA 2CN6A 3E1JA 3PVYB 4LPMA 4ZTTA 4RC8A 2ZURX 2WLAA 3T9JA 4MKUA 3PWQA 1L8HA 2XGWA 3R2SA 2JD60 5K52A 3AJOA 4CYAA 4LYUA 1UMNA 5FEJA 4EVBA 5C6FA 4LQHA 1FHAA 2CLBA 4TOHA 5K53A 2WLUA 4PG1A 4CVPA 4MY7A 3RBCA 2Z90A 4ZKHA 2FJCA 5GU1X 4OYNA 2G38B 3M6JA 4RC6A 3KWOA 3F38A 4XKSA 2QQYA 2F7NA 2FZFA 2V2SA 3R2KA 3PWQC 4CMYV 1J30A 3HIUA 5GU2X 4REUA 2CF7A 1LKMA 1HRSA 4X0JA 4TOGA 4DE6A 3UNOA 3E2CA 3RE7A 3FSEA 4LYXA 1S2ZA 4U3GA 1JKVA 3F36A 4ITWA 4DYYA 2C2UA 4RC5A 1RCCA 3EZ0A 1GWGA 4ZKWA 1VELA 2XJOA 3RD0A 3KXUA 5FFDA 3R2MA 5J8SA 3JZAB 3FRRA 4TOEA 3E1PA 3E6SA 2YJKA 4IWKA 1Z6OA 3KA4A 2IU2A 3KHKA 4W4KB 3RGDA 4TODA 1NF6A 4ETRA 3SHXA 3GGZA 3GE4A 1NF4A 5GN8B 3E1QA 4ZKXA 3TA8A 3PW8A 2C2JA 3O7RA 5D8OA 1O9IA 4P18A 3VV9A 1XZ3A 2ZG9X 1Z4AA 5GU0X 3NP0X 3PVRA 2XJNA 3RAVA 4XGSA 3EGMA 5ERKA 5CMRA 3C1ZA 4AM4A 1BCFA 4EVEA 4MN9A 5D8XA 1QYBA 3LKDA 4TO9A 4KVQA 4DASA 1LB3A 4DYZA 4RC7A 5IX6A 3N6OA 4M34A 4M35A 2CLUA 3GVYA 3F37A 2CHIA 1JKUA 1N1QA 5CZUA 1Z6OM 3FRSA 4KVSA 5J9VA 3R2LA 3PW8C 3Q4OA 4MJYA 1QGHA 2ZG8X 2QF9A 4R42A 5JKMA 5JDOB 3PWFA 4LPNA 2MGYA 1YUZA 2Z5QA 3GHQA 4CVRA 5ERJA 3IS7A 4LQVA 1H96A 2ZA8A 3D19A 3KA3A 3QHCA 2HR5A 1RCIA 3SIDA 3E1MA 2OKCA 3R2RA 5E2DA 3BVEA 4TOCA 1BFRA 2V2NA 4QUWA 1TJOA 2YJJA 1YV1A 5JKLA 4LPJA 4CYBA 2N02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QVD A;  1B71 A;  1ZS3 A;  1RCE A;  2Y3Q A;  2ZA6 A;  2XKQ A;  5LS9 A;  2CIH A;  3UOF A;  4MUD A;  2V2P A;  4EVD A;  1JYB A;  4ML5 A;  4ZMC A;  3H7G A;  4YKH A;  4AM2 A;  3BVF A;  3IQ1 A;  3NOZ X;  2V2I A;  4E6K A;  1LKP A;  3F39 A;  5FFB A;  2CEI A;  2ZA7 A;  3KA8 A;  3PVT A;  4TW3 A;  1TKO A;  2BKC A;  3OJ5 A;  3AF8 X;  3PW1 A;  3ERZ A;  5D8R A;  4KVR A;  3BKN A;  3AJQ A;  5HQO A;  4RC6 B;  2UX1 A;  1JTS A;  4A25 A;  1DPS A;  1BG7 A;  3E1N A;  3F34 A;  1F33 A;  5LG8 A;  1JRE A;  5LBH A;  5FFC A;  1UVH A;  4CMY A;  1LKO A;  2HTN A;  3FVB A;  3U90 A;  1TKP A;  3QB9 A;  3ISE A;  1JI5 A;  1R03 A;  3BVL A;  2BJY A;  2VXX A;  3E1O A;  2X17 0;  1OTK A;  5LG2 A;  3PVY A;  4RC5 B;  3PZA A;  2XJM A;  5I4J A;  1KRQ A;  3UOI A;  2FG4 A;  2VXI A;  3KX9 A;  3Q4N A;  4ZLW A;  2YW6 A;  5JKL G;  1RCG A;  2GYQ A;  5GOU A;  1MOJ A;  2ZG7 X;  1L8I A;  5D8S A;  3BVK A;  1O9R A;  2FL0 A;  2VZB A;  5E1U A;  4II4 B;  1RCD A;  3AF7 X;  1EUM A;  5CMQ A;  2PYB A;  5FFA A;  1JGC A;  3AK9 A;  3OGH A;  3E6R A;  5JAC A;  1IER A;  1SOF A;  3FI6 A;  3MPS A;  3PVR B;  3A9Q A;  4ZJK A;  5J8W A;  2W0O A;  2GYD A;  2FHA A;  4DZ0 A;  1VJX A;  3R2H A;  1DAT A;  2FFX J;  3WVU A;  2Z5P A;  3E1L A;  1SQ3 A;  3F33 A;  4ZL6 A;  3ISF A;  4ISP A;  2V2R A;  4RC7 B;  3BT5 A;  2WTL A;  2RBD A;  3R2O A;  1JIG A;  4XKT A;  3BVI A;  3AK8 A;  3A68 A;  1XZ1 A;  4ERU A;  2V2J A;  3IS8 A;  4IWJ A;  2BW1 A;  2C6R A;  2ITB A;  2JD7 0;  4M33 A;  1RYT A;  3QHB A;  2G4H A;  4Z5S A;  2FKZ A;  2CN7 A;  3QZ3 A;  1S3Q A;  3F35 A;  1YUX A;  3KA9 A;  2FG8 A;  4Y08 A;  2JD8 0;  3AF9 X;  5D8Q A;  4XKU A;  5GU3 X;  5HJH A;  3WVW A;  3ES3 A;  3WNW A;  1TK6 A;  3F32 A;  1MFR A;  4CVS A;  3AJP A;  3Q4R A;  2BK6 A;  5GN8 A;  4ITT A;  1IES A;  5AXS A;  2C2F A;  4TOB A;  3VNX A;  1VLG A;  2OH3 A;  3QD8 A;  4DYU A;  5D8Y A;  4DI0 A;  2V15 A;  1NNQ A;  4PG0 A;  5JKM G;  4M32 A;  4LQJ A;  1NFV A;  2V2L A;  1VEI A;  2D5K A;  3EZU A;  3O7S A;  4PGK A;  4AM5 A;  2Z5R A;  3PVT B;  2IB0 A;  3PW1 B;  4DYX A;  3KA6 A;  2CHP A;  4ISM A;  3HL1 A;  2GS4 A;  3NP2 X;  4II4 A;  4TOF A;  4CY9 A;  3WVV A;  4EVC A;  4TOA A;  2YW7 A;  4CVT A;  3Q4Q A;  5D8P A;  1ZUJ A;  4LQN A;  2IY4 A;  1DVB A;  2Z6M A;  5J93 A;  2C41 A;  2OC5 A;  4ZL5 A;  3SH6 A;  4Z3B A;  1JI4 A;  2V2O A;  1F30 A;  5FFE A;  1AEW A;  5HJF A;  1VEQ A;  4IXK A;  2V2M A;  1S30 A;  3SE1 A;  4PGI A;  2CN6 A;  3E1J A;  3PVY B;  4LPM A;  4ZTT A;  4RC8 A;  2ZUR X;  2WLA A;  3T9J A;  4MKU A;  3PWQ A;  1L8H A;  2XGW A;  3R2S A;  2JD6 0;  5K52 A;  3AJO A;  4CYA A;  4LYU A;  1UMN A;  5FEJ A;  4EVB A;  5C6F A;  4LQH A;  1FHA A;  2CLB A;  4TOH A;  5K53 A;  2WLU A;  4PG1 A;  4CVP A;  4MY7 A;  3RBC A;  2Z90 A;  4ZKH A;  2FJC A;  5GU1 X;  4OYN A;  4RC6 A;  3KWO A;  3F38 A;  4XKS A;  2QQY A;  2F7N A;  2FZF A;  2V2S A;  3R2K A;  3PWQ C;  4CMY V;  1J30 A;  3HIU A;  5GU2 X;  4REU A;  2CF7 A;  1LKM A;  1HRS A;  4TOG A;  4DE6 A;  3UNO A;  3E2C A;  3RE7 A;  3FSE A;  4LYX A;  1S2Z A;  4U3G A;  1JKV A;  3F36 A;  4ITW A;  4DYY A;  2C2U A;  4RC5 A;  1RCC A;  3EZ0 A;  1GWG A;  4ZKW A;  1VEL A;  2XJO A;  3RD0 A;  3KXU A;  5FFD A;  3R2M A;  5J8S A;  4TOE A;  3E1P A;  3E6S A;  2YJK A;  4IWK A;  1Z6O A;  3KA4 A;  2IU2 A;  3RGD A;  4TOD A;  1NF6 A;  4ETR A;  3SHX A;  3GE4 A;  1NF4 A;  5GN8 B;  3E1Q A;  4ZKX A;  3TA8 A;  3PW8 A;  2C2J A;  3O7R A;  5D8O A;  1O9I A;  4P18 A;  1XZ3 A;  2ZG9 X;  1Z4A A;  5GU0 X;  3NP0 X;  3PVR A;  2XJN A;  3RAV A;  4XGS A;  3EGM A;  5ERK A;  5CMR A;  4AM4 A;  1BCF A;  4EVE A;  4MN9 A;  5D8X A;  1QYB A;  4TO9 A;  4KVQ A;  4DAS A;  1LB3 A;  4DYZ A;  4RC7 A;  5IX6 A;  4M34 A;  4M35 A;  2CLU A;  3GVY A;  3F37 A;  2CHI A;  1JKU A;  1N1Q A;  5CZU A;  1Z6O M;  4KVS A;  5J9V A;  3R2L A;  3PW8 C;  3Q4O A;  4MJY A;  1QGH A;  2ZG8 X;  2QF9 A;  4R42 A;  5JKM A;  3PWF A;  4LPN A;  1YUZ A;  2Z5Q A;  3GHQ A;  4CVR A;  5ERJ A;  3IS7 A;  4LQV A;  1H96 A;  2ZA8 A;  3KA3 A;  3QHC A;  2HR5 A;  1RCI A;  3SID A;  3E1M A;  3R2R A;  5E2D A;  3BVE A;  4TOC A;  1BFR A;  2V2N A;  4QUW A;  1TJO A;  2YJJ A;  1YV1 A;  5JKL A;  4LPJ A;  4CYB A; 
#chains in the Genus database with same CATH topology
 3QVD A;  1B71 A;  1ZS3 A;  1RCE A;  2Y3Q A;  2ZA6 A;  2XKQ A;  5LS9 A;  2CIH A;  3UOF A;  4MUD A;  2V2P A;  4EVD A;  1JYB A;  4ML5 A;  4ZMC A;  3H7G A;  3W54 A;  4YKH A;  2CWL A;  4AM2 A;  3BVF A;  3IQ1 A;  3NOZ X;  2V2I A;  4E6K A;  1LKP A;  3F39 A;  5FFB A;  2CEI A;  2ZA7 A;  3V3K B;  3KA8 A;  3PVT A;  4TW3 A;  1TKO A;  2BKC A;  4W4L B;  3OJ5 A;  2WWX B;  3AF8 X;  3PW1 A;  3ERZ A;  5D8R A;  4KVR A;  3BKN A;  2V8T A;  3AJQ A;  5HQO A;  4RC6 B;  2UX1 A;  1JTS A;  4WJG 4;  4A25 A;  1DPS A;  1BG7 A;  3E1N A;  3F34 A;  1F33 A;  5LG8 A;  1JRE A;  5LBH A;  5FFC A;  1UVH A;  4CMY A;  1LKO A;  2HTN A;  3C21 A;  3FVB A;  3U90 A;  1TKP A;  3QB9 A;  3ISE A;  1JI5 A;  1R03 A;  3BVL A;  2BJY A;  2VXX A;  3E1O A;  2X17 0;  1OTK A;  3KDQ A;  5LG2 A;  3PVY A;  4RC5 B;  3PZA A;  2XJM A;  5I4J A;  3JZ9 A;  1KRQ A;  3UOI A;  2FG4 A;  2VXI A;  4KXR B;  5JDO A;  4YXJ A;  3KX9 A;  3Q4N A;  4ZLW A;  2YW6 A;  5JKL G;  1RCG A;  2GYQ A;  5GOU A;  1MOJ A;  2ZG7 X;  1L8I A;  5D8S A;  3BVK A;  1O9R A;  2FL0 A;  2VZB A;  5E1U A;  4II4 B;  1RCD A;  3AF7 X;  1EUM A;  5CMQ A;  2PYB A;  5FFA A;  1JGC A;  3AK9 A;  3OGH A;  3E6R A;  5JAC A;  1IER A;  1SOF A;  3FI6 A;  3MPS A;  3PVR B;  3A9Q A;  3DBY A;  4ZJK A;  5J8W A;  2W0O A;  3VVA A;  2GYD A;  2FHA A;  4YXM A;  4DZ0 A;  1VJX A;  3R2H A;  1DAT A;  2FFX J;  3WVU A;  2Z5P A;  3E1L A;  1SQ3 A;  3F33 A;  4ZL6 A;  3ISF A;  4ISP A;  2V2R A;  4RC7 B;  3BT5 A;  2WTL A;  2AR0 A;  2RBD A;  3R2O A;  3C1Y A;  1JIG A;  4XKT A;  3BVI A;  3AK8 A;  3A68 A;  1XZ1 A;  4ERU A;  2V2J A;  3IS8 A;  4IWJ A;  2BW1 A;  2C6R A;  2ITB A;  2JD7 0;  4M33 A;  1RYT A;  3QHB A;  2G4H A;  4Z5S A;  2FKZ A;  2CN7 A;  3QZ3 A;  1S3Q A;  3F35 A;  1YUX A;  3KA9 A;  2FG8 A;  4Y08 A;  2JD8 0;  3AF9 X;  5D8Q A;  4XKU A;  5GU3 X;  4MXP A;  5HJH A;  3WVW A;  3ES3 A;  3WNW A;  1TK6 A;  3F32 A;  1MFR A;  4CVS A;  3AJP A;  3Q4R A;  2BK6 A;  5GN8 A;  4ITT A;  1IES A;  5AXS A;  2C2F A;  2Y44 A;  4TOB A;  3GGY A;  4YVZ A;  3VNX A;  1VLG A;  2OH3 A;  3QD8 A;  4DYU A;  5D8Y A;  4DI0 A;  2V15 A;  1NNQ A;  4PG0 A;  5JKM G;  4M32 A;  4LQJ A;  1NFV A;  2V2L A;  1VEI A;  2D5K A;  3EZU A;  3O7S A;  4PGK A;  4AM5 A;  2Z5R A;  3PVT B;  2IB0 A;  3PW1 B;  4DYX A;  2V8U A;  3KA6 A;  2CHP A;  4ISM A;  3L0M A;  3HL1 A;  2GS4 A;  3NP2 X;  4II4 A;  4TOF A;  4CY9 A;  3WVV A;  3C23 A;  4TOA A;  4EVC A;  2YW7 A;  4CVT A;  3Q4Q A;  5D8P A;  1ZUJ A;  4LQN A;  2IY4 A;  1DVB A;  2Z6M A;  5J93 A;  2C41 A;  4E40 A;  2OC5 A;  5HU6 D;  4ZL5 A;  3SH6 A;  4Z3B A;  1JI4 A;  2V2O A;  1F30 A;  3UFB A;  5FFE A;  1AEW A;  5HJF A;  1VEQ A;  4IXK A;  2V2M A;  1S30 A;  3SE1 A;  4PGI A;  2CN6 A;  3E1J A;  3PVY B;  4LPM A;  4ZTT A;  4RC8 A;  2ZUR X;  2WLA A;  3T9J A;  4MKU A;  3PWQ A;  1L8H A;  2XGW A;  3R2S A;  2JD6 0;  5K52 A;  3AJO A;  4CYA A;  4LYU A;  1UMN A;  5FEJ A;  4EVB A;  5C6F A;  4LQH A;  1FHA A;  2CLB A;  4TOH A;  5K53 A;  2WLU A;  4PG1 A;  4CVP A;  4MY7 A;  3RBC A;  2Z90 A;  4ZKH A;  2FJC A;  5GU1 X;  4OYN A;  2G38 B;  3M6J A;  4RC6 A;  3KWO A;  3F38 A;  4XKS A;  2QQY A;  2F7N A;  2FZF A;  2V2S A;  3R2K A;  3PWQ C;  4CMY V;  1J30 A;  3HIU A;  5GU2 X;  4REU A;  2CF7 A;  1LKM A;  1HRS A;  4X0J A;  4TOG A;  4DE6 A;  3UNO A;  3E2C A;  3RE7 A;  3FSE A;  4LYX A;  1S2Z A;  4U3G A;  1JKV A;  3F36 A;  4ITW A;  4DYY A;  2C2U A;  4RC5 A;  1RCC A;  3EZ0 A;  1GWG A;  4ZKW A;  1VEL A;  2XJO A;  3RD0 A;  3KXU A;  5FFD A;  3R2M A;  5J8S A;  3JZA B;  3FRR A;  4TOE A;  3E1P A;  3E6S A;  2YJK A;  4IWK A;  1Z6O A;  3KA4 A;  2IU2 A;  3KHK A;  4W4K B;  3RGD A;  4TOD A;  1NF6 A;  4ETR A;  3SHX A;  3GGZ A;  3GE4 A;  1NF4 A;  5GN8 B;  3E1Q A;  4ZKX A;  3TA8 A;  3PW8 A;  2C2J A;  3O7R A;  5D8O A;  1O9I A;  4P18 A;  3VV9 A;  1XZ3 A;  2ZG9 X;  1Z4A A;  5GU0 X;  3NP0 X;  3PVR A;  2XJN A;  3RAV A;  4XGS A;  3EGM A;  5ERK A;  5CMR A;  3C1Z A;  4AM4 A;  1BCF A;  4EVE A;  4MN9 A;  5D8X A;  1QYB A;  3LKD A;  4TO9 A;  4KVQ A;  4DAS A;  1LB3 A;  4DYZ A;  4RC7 A;  5IX6 A;  3N6O A;  4M34 A;  4M35 A;  2CLU A;  3GVY A;  3F37 A;  2CHI A;  1JKU A;  1N1Q A;  5CZU A;  1Z6O M;  3FRS A;  4KVS A;  5J9V A;  3R2L A;  3PW8 C;  3Q4O A;  4MJY A;  1QGH A;  2ZG8 X;  2QF9 A;  4R42 A;  5JKM A;  5JDO B;  3PWF A;  4LPN A;  2MGY A;  1YUZ A;  2Z5Q A;  3GHQ A;  4CVR A;  5ERJ A;  3IS7 A;  4LQV A;  1H96 A;  2ZA8 A;  3D19 A;  3KA3 A;  3QHC A;  2HR5 A;  1RCI A;  3SID A;  3E1M A;  2OKC A;  3R2R A;  5E2D A;  3BVE A;  4TOC A;  1BFR A;  2V2N A;  4QUW A;  1TJO A;  2YJJ A;  1YV1 A;  5JKL A;  4LPJ A;  4CYB A;  2N02 A; 
#chains in the Genus database with same CATH homology
 3QVD A;  1B71 A;  1ZS3 A;  1RCE A;  2Y3Q A;  2ZA6 A;  2XKQ A;  5LS9 A;  2CIH A;  3UOF A;  4MUD A;  2V2P A;  4EVD A;  1JYB A;  4ML5 A;  4ZMC A;  3H7G A;  3W54 A;  4YKH A;  2CWL A;  4AM2 A;  3BVF A;  3IQ1 A;  3NOZ X;  2V2I A;  4E6K A;  1LKP A;  3F39 A;  5FFB A;  2CEI A;  2ZA7 A;  3V3K B;  3KA8 A;  3PVT A;  4TW3 A;  1TKO A;  2BKC A;  4W4L B;  3OJ5 A;  2WWX B;  3AF8 X;  3PW1 A;  3ERZ A;  5D8R A;  4KVR A;  3BKN A;  2V8T A;  3AJQ A;  5HQO A;  4RC6 B;  2UX1 A;  1JTS A;  4WJG 4;  4A25 A;  1DPS A;  1BG7 A;  3E1N A;  3F34 A;  1F33 A;  5LG8 A;  1JRE A;  5LBH A;  5FFC A;  1UVH A;  4CMY A;  1LKO A;  2HTN A;  3C21 A;  3FVB A;  3U90 A;  1TKP A;  3QB9 A;  3ISE A;  1JI5 A;  1R03 A;  3BVL A;  2BJY A;  2VXX A;  3E1O A;  2X17 0;  1OTK A;  3KDQ A;  5LG2 A;  3PVY A;  4RC5 B;  3PZA A;  2XJM A;  5I4J A;  3JZ9 A;  1KRQ A;  3UOI A;  2FG4 A;  2VXI A;  4KXR B;  5JDO A;  4YXJ A;  3KX9 A;  3Q4N A;  4ZLW A;  2YW6 A;  5JKL G;  1RCG A;  2GYQ A;  5GOU A;  1MOJ A;  2ZG7 X;  1L8I A;  5D8S A;  3BVK A;  1O9R A;  2FL0 A;  2VZB A;  5E1U A;  4II4 B;  1RCD A;  3AF7 X;  1EUM A;  5CMQ A;  2PYB A;  5FFA A;  1JGC A;  3AK9 A;  3OGH A;  3E6R A;  5JAC A;  1IER A;  1SOF A;  3FI6 A;  3MPS A;  3PVR B;  3A9Q A;  3DBY A;  4ZJK A;  5J8W A;  2W0O A;  3VVA A;  2GYD A;  2FHA A;  4YXM A;  4DZ0 A;  1VJX A;  3R2H A;  1DAT A;  2FFX J;  3WVU A;  2Z5P A;  3E1L A;  1SQ3 A;  3F33 A;  4ZL6 A;  3ISF A;  4ISP A;  2V2R A;  4RC7 B;  3BT5 A;  2WTL A;  2AR0 A;  2RBD A;  3R2O A;  3C1Y A;  1JIG A;  4XKT A;  3BVI A;  3AK8 A;  3A68 A;  1XZ1 A;  4ERU A;  2V2J A;  3IS8 A;  4IWJ A;  2BW1 A;  2C6R A;  2ITB A;  2JD7 0;  4M33 A;  1RYT A;  3QHB A;  2G4H A;  4Z5S A;  2FKZ A;  2CN7 A;  3QZ3 A;  1S3Q A;  3F35 A;  1YUX A;  3KA9 A;  2FG8 A;  4Y08 A;  2JD8 0;  3AF9 X;  5D8Q A;  4XKU A;  5GU3 X;  4MXP A;  5HJH A;  3WVW A;  3ES3 A;  3WNW A;  1TK6 A;  3F32 A;  1MFR A;  4CVS A;  3AJP A;  3Q4R A;  2BK6 A;  5GN8 A;  4ITT A;  1IES A;  5AXS A;  2C2F A;  2Y44 A;  4TOB A;  3GGY A;  4YVZ A;  3VNX A;  1VLG A;  2OH3 A;  3QD8 A;  4DYU A;  5D8Y A;  4DI0 A;  2V15 A;  1NNQ A;  4PG0 A;  5JKM G;  4M32 A;  4LQJ A;  1NFV A;  2V2L A;  1VEI A;  2D5K A;  3EZU A;  3O7S A;  4PGK A;  4AM5 A;  2Z5R A;  3PVT B;  2IB0 A;  3PW1 B;  4DYX A;  2V8U A;  3KA6 A;  2CHP A;  4ISM A;  3L0M A;  3HL1 A;  2GS4 A;  3NP2 X;  4II4 A;  4TOF A;  4CY9 A;  3WVV A;  3C23 A;  4TOA A;  4EVC A;  2YW7 A;  4CVT A;  3Q4Q A;  5D8P A;  1ZUJ A;  4LQN A;  2IY4 A;  1DVB A;  2Z6M A;  5J93 A;  2C41 A;  4E40 A;  2OC5 A;  5HU6 D;  4ZL5 A;  3SH6 A;  4Z3B A;  1JI4 A;  2V2O A;  1F30 A;  3UFB A;  5FFE A;  1AEW A;  5HJF A;  1VEQ A;  4IXK A;  2V2M A;  1S30 A;  3SE1 A;  4PGI A;  2CN6 A;  3E1J A;  3PVY B;  4LPM A;  4ZTT A;  4RC8 A;  2ZUR X;  2WLA A;  3T9J A;  4MKU A;  3PWQ A;  1L8H A;  2XGW A;  3R2S A;  2JD6 0;  5K52 A;  3AJO A;  4CYA A;  4LYU A;  1UMN A;  5FEJ A;  4EVB A;  5C6F A;  4LQH A;  1FHA A;  2CLB A;  4TOH A;  5K53 A;  2WLU A;  4PG1 A;  4CVP A;  4MY7 A;  3RBC A;  2Z90 A;  4ZKH A;  2FJC A;  5GU1 X;  4OYN A;  2G38 B;  3M6J A;  4RC6 A;  3KWO A;  3F38 A;  4XKS A;  2QQY A;  2F7N A;  2FZF A;  2V2S A;  3R2K A;  3PWQ C;  4CMY V;  1J30 A;  3HIU A;  5GU2 X;  4REU A;  2CF7 A;  1LKM A;  1HRS A;  4X0J A;  4TOG A;  4DE6 A;  3UNO A;  3E2C A;  3RE7 A;  3FSE A;  4LYX A;  1S2Z A;  4U3G A;  1JKV A;  3F36 A;  4ITW A;  4DYY A;  2C2U A;  4RC5 A;  1RCC A;  3EZ0 A;  1GWG A;  4ZKW A;  1VEL A;  2XJO A;  3RD0 A;  3KXU A;  5FFD A;  3R2M A;  5J8S A;  3JZA B;  3FRR A;  4TOE A;  3E1P A;  3E6S A;  2YJK A;  4IWK A;  1Z6O A;  3KA4 A;  2IU2 A;  3KHK A;  4W4K B;  3RGD A;  4TOD A;  1NF6 A;  4ETR A;  3SHX A;  3GGZ A;  3GE4 A;  1NF4 A;  5GN8 B;  3E1Q A;  4ZKX A;  3TA8 A;  3PW8 A;  2C2J A;  3O7R A;  5D8O A;  1O9I A;  4P18 A;  3VV9 A;  1XZ3 A;  2ZG9 X;  1Z4A A;  5GU0 X;  3NP0 X;  3PVR A;  2XJN A;  3RAV A;  4XGS A;  3EGM A;  5ERK A;  5CMR A;  3C1Z A;  4AM4 A;  1BCF A;  4EVE A;  4MN9 A;  5D8X A;  1QYB A;  3LKD A;  4TO9 A;  4KVQ A;  4DAS A;  1LB3 A;  4DYZ A;  4RC7 A;  5IX6 A;  3N6O A;  4M34 A;  4M35 A;  2CLU A;  3GVY A;  3F37 A;  2CHI A;  1JKU A;  1N1Q A;  5CZU A;  1Z6O M;  3FRS A;  4KVS A;  5J9V A;  3R2L A;  3PW8 C;  3Q4O A;  4MJY A;  1QGH A;  2ZG8 X;  2QF9 A;  4R42 A;  5JKM A;  5JDO B;  3PWF A;  4LPN A;  2MGY A;  1YUZ A;  2Z5Q A;  3GHQ A;  4CVR A;  5ERJ A;  3IS7 A;  4LQV A;  1H96 A;  2ZA8 A;  3D19 A;  3KA3 A;  3QHC A;  2HR5 A;  1RCI A;  3SID A;  3E1M A;  2OKC A;  3R2R A;  5E2D A;  3BVE A;  4TOC A;  1BFR A;  2V2N A;  4QUW A;  1TJO A;  2YJJ A;  1YV1 A;  5JKL A;  4LPJ A;  4CYB A;  2N02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...